Query         037265
Match_columns 305
No_of_seqs    263 out of 1569
Neff          7.2 
Searched_HMMs 46136
Date          Fri Mar 29 10:28:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037265.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037265hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1565 Gelatinase A and relat 100.0 1.5E-55 3.3E-60  430.5  20.0  225   45-304    29-262 (469)
  2 cd04278 ZnMc_MMP Zinc-dependen 100.0 5.1E-37 1.1E-41  261.4  15.1  150  152-303     1-157 (157)
  3 PF00413 Peptidase_M10:  Matrix 100.0 8.3E-35 1.8E-39  245.6  15.7  147  152-303     1-154 (154)
  4 cd04279 ZnMc_MMP_like_1 Zinc-d 100.0 1.2E-27 2.7E-32  203.3  13.5  139  158-303     2-156 (156)
  5 cd04268 ZnMc_MMP_like Zinc-dep  99.9 3.7E-24 8.1E-29  182.6   9.6  142  157-302     1-165 (165)
  6 smart00235 ZnMc Zinc-dependent  99.9 1.1E-22 2.3E-27  169.7   9.7  132  151-304     3-140 (140)
  7 cd04277 ZnMc_serralysin_like Z  99.9   3E-21 6.5E-26  168.6  13.7  122  171-303    34-186 (186)
  8 cd04327 ZnMc_MMP_like_3 Zinc-d  99.7 1.4E-16   3E-21  140.7  13.5  108  152-271     2-109 (198)
  9 cd00203 ZnMc Zinc-dependent me  99.7 1.2E-16 2.6E-21  136.2  12.3  117  171-302    22-167 (167)
 10 cd04276 ZnMc_MMP_like_2 Zinc-d  99.6 5.6E-15 1.2E-19  130.2  11.0  141  157-304     7-197 (197)
 11 PF12388 Peptidase_M57:  Dual-a  99.6 3.2E-14 6.8E-19  125.5  12.7  132  157-302    38-211 (211)
 12 cd04280 ZnMc_astacin_like Zinc  99.5 2.1E-13 4.6E-18  118.8  11.8   91  158-272     2-92  (180)
 13 PF01400 Astacin:  Astacin (Pep  99.4 5.4E-13 1.2E-17  117.3   9.6   96  152-272     2-97  (191)
 14 PF01471 PG_binding_1:  Putativ  99.4 5.9E-13 1.3E-17   94.1   6.4   56   43-115     2-57  (57)
 15 cd04281 ZnMc_BMP1_TLD Zinc-dep  99.4 5.2E-12 1.1E-16  111.6  12.3   99  150-272     7-105 (200)
 16 cd04282 ZnMc_meprin Zinc-depen  99.3 5.8E-11 1.3E-15  106.9  12.2   95  151-272    44-138 (230)
 17 cd04283 ZnMc_hatching_enzyme Z  99.2 1.3E-10 2.9E-15  101.2  11.0   92  158-272     4-95  (182)
 18 PF02031 Peptidase_M7:  Strepto  99.1 6.3E-10 1.4E-14   90.1   9.9  123  159-303     3-130 (132)
 19 KOG3714 Meprin A metalloprotea  99.1   9E-10   2E-14  107.5  10.9   98  151-272    80-177 (411)
 20 COG5549 Predicted Zn-dependent  98.8 8.5E-09 1.9E-13   90.0   6.3  124  171-303   104-233 (236)
 21 TIGR02869 spore_SleB spore cor  98.6 6.5E-08 1.4E-12   85.7   7.1   65   36-117     6-70  (201)
 22 PF11350 DUF3152:  Protein of u  98.2 6.5E-06 1.4E-10   72.1   9.0  115  157-275    28-160 (203)
 23 cd04267 ZnMc_ADAM_like Zinc-de  97.8 0.00011 2.3E-09   64.3   9.1   48  253-300   132-189 (192)
 24 PF13583 Reprolysin_4:  Metallo  97.8 2.9E-05 6.3E-10   69.1   5.0   48  254-302   137-198 (206)
 25 PRK10594 murein L,D-transpepti  97.8   4E-05 8.6E-10   77.7   6.3   83   36-118   234-343 (608)
 26 cd04273 ZnMc_ADAMTS_like Zinc-  97.6  0.0001 2.2E-09   65.4   5.8  119  174-302    70-198 (207)
 27 PF05572 Peptidase_M43:  Pregna  97.5   6E-05 1.3E-09   64.1   2.3   24  251-274    66-89  (154)
 28 COG1913 Predicted Zn-dependent  97.5 5.9E-05 1.3E-09   64.6   1.9   28  254-281   124-151 (181)
 29 COG3409 Putative peptidoglycan  97.4  0.0002 4.3E-09   61.6   5.3   66   37-119    39-106 (185)
 30 PF13574 Reprolysin_2:  Metallo  97.3 8.2E-05 1.8E-09   64.4   1.3   48  254-302   111-171 (173)
 31 PRK13267 archaemetzincin-like   97.2  0.0002 4.4E-09   62.3   2.8   27  254-280   125-151 (179)
 32 PF13582 Reprolysin_3:  Metallo  97.1 0.00019 4.1E-09   58.0   1.2   18  254-271   107-124 (124)
 33 PF13688 Reprolysin_5:  Metallo  97.1 0.00026 5.7E-09   61.9   1.8   23  252-274   140-162 (196)
 34 PF07998 Peptidase_M54:  Peptid  97.0 0.00034 7.4E-09   61.6   2.2   28  253-281   144-171 (194)
 35 cd04271 ZnMc_ADAM_fungal Zinc-  97.0 0.00066 1.4E-08   61.4   4.0   47  256-303   147-218 (228)
 36 cd04269 ZnMc_adamalysin_II_lik  97.0 0.00094   2E-08   58.4   4.7   48  253-301   130-183 (194)
 37 cd04275 ZnMc_pappalysin_like Z  96.9 0.00019 4.1E-09   64.8  -0.4   25  251-275   134-158 (225)
 38 COG2989 Uncharacterized protei  96.7  0.0031 6.8E-08   62.7   6.1   66   37-117   232-298 (561)
 39 PF01421 Reprolysin:  Reprolysi  96.5  0.0046   1E-07   54.3   5.2   50  252-301   129-186 (199)
 40 COG3023 ampD N-acetyl-anhydrom  96.4   0.007 1.5E-07   55.0   5.7   55   42-115   196-251 (257)
 41 cd04270 ZnMc_TACE_like Zinc-de  96.2  0.0079 1.7E-07   54.9   5.1   48  254-301   167-228 (244)
 42 cd04272 ZnMc_salivary_gland_MP  96.1  0.0073 1.6E-07   54.0   4.3   49  253-301   144-210 (220)
 43 PF08823 PG_binding_2:  Putativ  95.6   0.031 6.7E-07   41.6   5.4   57   42-115    14-74  (74)
 44 PF11150 DUF2927:  Protein of u  94.8    0.92   2E-05   40.6  13.3  146  151-304    28-195 (213)
 45 PF05548 Peptidase_M11:  Gameto  94.3   0.023   5E-07   53.8   1.9   19  254-272   150-168 (314)
 46 PF01457 Peptidase_M8:  Leishma  94.1   0.047   1E-06   55.3   3.7   60  199-270   159-226 (521)
 47 COG3409 Putative peptidoglycan  94.0    0.13 2.7E-06   44.0   5.8   61   40-116   124-184 (185)
 48 PF10462 Peptidase_M66:  Peptid  94.0   0.026 5.7E-07   53.1   1.6   21  252-272   191-211 (305)
 49 PF12044 Metallopep:  Putative   93.0   0.051 1.1E-06   53.4   1.8   24  255-280   317-340 (423)
 50 COG5549 Predicted Zn-dependent  93.0    0.33 7.1E-06   43.1   6.6  109  174-283    49-182 (236)
 51 TIGR03296 M6dom_TIGR03296 M6 f  92.2   0.038 8.3E-07   51.6  -0.2   19  255-273   166-184 (286)
 52 PF04298 Zn_peptidase_2:  Putat  91.8    0.16 3.5E-06   45.6   3.4   36  228-272    68-105 (222)
 53 COG3824 Predicted Zn-dependent  91.6   0.064 1.4E-06   43.4   0.5   19  252-270   107-125 (136)
 54 PTZ00337 surface protease GP63  90.9    0.22 4.8E-06   50.8   3.7   36  230-271   211-246 (567)
 55 PTZ00257 Glycoprotein GP63 (le  89.9    0.41 8.9E-06   49.1   4.6   62  198-271   204-273 (622)
 56 COG2738 Predicted Zn-dependent  88.6    0.51 1.1E-05   41.5   3.6   76  174-267    22-105 (226)
 57 PF04228 Zn_peptidase:  Putativ  88.2    0.43 9.3E-06   44.8   3.1   36  228-265   141-181 (292)
 58 PF09471 Peptidase_M64:  IgA Pe  87.0    0.34 7.4E-06   44.8   1.7   20  253-272   215-235 (264)
 59 KOG3658 Tumor necrosis factor-  86.6    0.42   9E-06   49.1   2.2   48  254-301   392-452 (764)
 60 PF06262 DUF1025:  Possibl zinc  85.9    0.45 9.8E-06   37.3   1.6   16  254-269    73-88  (97)
 61 PF05547 Peptidase_M6:  Immune   85.4    0.15 3.3E-06   52.7  -1.6   18  254-271   221-238 (645)
 62 KOG4525 Jacalin-like lectin do  85.4    0.55 1.2E-05   46.0   2.2   26  255-282   302-327 (614)
 63 COG4783 Putative Zn-dependent   85.2    0.48   1E-05   47.0   1.8   35  232-270   111-145 (484)
 64 PF09374 PG_binding_3:  Predict  84.5    0.84 1.8E-05   33.6   2.4   26   90-115     1-30  (72)
 65 KOG3607 Meltrins, fertilins an  84.3     1.1 2.4E-05   47.0   4.1   45  253-298   322-374 (716)
 66 PF06114 DUF955:  Domain of unk  78.5       1 2.2E-05   34.9   1.1   15  252-266    40-54  (122)
 67 PF14247 DUF4344:  Domain of un  78.5     1.1 2.3E-05   40.4   1.3   14  253-266    91-104 (220)
 68 PF13398 Peptidase_M50B:  Pepti  76.3     1.3 2.9E-05   39.1   1.3   16  252-267    20-35  (200)
 69 COG2856 Predicted Zn peptidase  73.7     1.5 3.2E-05   39.4   0.9   32  232-273    58-89  (213)
 70 PF01435 Peptidase_M48:  Peptid  73.2     1.9 4.1E-05   37.8   1.5   21  251-272    86-106 (226)
 71 PRK03982 heat shock protein Ht  70.7     2.3 4.9E-05   39.7   1.4   16  251-266   122-137 (288)
 72 COG0501 HtpX Zn-dependent prot  70.3     2.3   5E-05   39.2   1.4   16  251-266   154-169 (302)
 73 PRK03001 M48 family peptidase;  68.6     2.7 5.8E-05   39.1   1.4   16  251-266   121-136 (283)
 74 cd06163 S2P-M50_PDZ_RseP-like   68.6     2.6 5.7E-05   36.7   1.3   12  255-266    10-21  (182)
 75 PRK03072 heat shock protein Ht  68.1     2.8   6E-05   39.2   1.4   17  251-267   124-140 (288)
 76 PF12725 DUF3810:  Protein of u  67.9     3.6 7.8E-05   39.1   2.2   38  228-273   178-215 (318)
 77 KOG3538 Disintegrin metallopro  67.6     2.6 5.7E-05   45.2   1.4   35  250-284   313-353 (845)
 78 PRK01345 heat shock protein Ht  67.5     2.9 6.2E-05   39.7   1.4   19  252-271   122-140 (317)
 79 cd06161 S2P-M50_SpoIVFB SpoIVF  66.3     3.1 6.7E-05   36.9   1.3   16  253-268    37-52  (208)
 80 PRK04897 heat shock protein Ht  64.1     3.7   8E-05   38.6   1.4   16  251-266   134-149 (298)
 81 PRK05457 heat shock protein Ht  63.8     3.4 7.5E-05   38.5   1.2   15  251-265   131-145 (284)
 82 PF13485 Peptidase_MA_2:  Pepti  63.6     5.4 0.00012   31.1   2.2   15  252-266    23-37  (128)
 83 cd06258 Peptidase_M3_like The   63.0     7.7 0.00017   37.0   3.5   16  251-266   151-166 (365)
 84 PRK02870 heat shock protein Ht  62.4     4.1 8.9E-05   39.0   1.4   15  251-265   170-184 (336)
 85 PRK02391 heat shock protein Ht  62.3     4.1   9E-05   38.2   1.4   15  251-265   130-144 (296)
 86 PRK01265 heat shock protein Ht  62.1     4.2 9.1E-05   38.8   1.4   15  251-265   137-151 (324)
 87 cd06164 S2P-M50_SpoIVFB_CBS Sp  61.2     4.3 9.4E-05   36.6   1.3   16  254-269    53-68  (227)
 88 cd06459 M3B_Oligoendopeptidase  58.1     4.8  0.0001   39.1   1.1   15  252-266   220-234 (427)
 89 PF13699 DUF4157:  Domain of un  57.7     9.3  0.0002   28.6   2.4   36  225-266    38-73  (79)
 90 PF01432 Peptidase_M3:  Peptida  57.5     4.9 0.00011   39.7   1.1   23  174-196   138-160 (458)
 91 cd06162 S2P-M50_PDZ_SREBP Ster  57.3     5.5 0.00012   37.1   1.3   14  254-267   135-148 (277)
 92 cd06159 S2P-M50_PDZ_Arch Uncha  57.1     5.6 0.00012   36.8   1.3   16  254-269   118-133 (263)
 93 cd06455 M3A_TOP Peptidase M3 T  55.4     5.5 0.00012   39.8   1.0   14  253-266   262-275 (472)
 94 TIGR00181 pepF oligoendopeptid  55.2     7.8 0.00017   39.7   2.1   15  252-266   376-390 (591)
 95 TIGR02289 M3_not_pepF oligoend  55.1      11 0.00023   38.5   3.1   15  252-266   335-349 (549)
 96 cd06160 S2P-M50_like_2 Unchara  54.4     6.7 0.00015   34.2   1.3   21  254-274    41-61  (183)
 97 TIGR02290 M3_fam_3 oligoendope  53.0     5.9 0.00013   40.7   0.8   14  253-266   374-387 (587)
 98 PF01447 Peptidase_M4:  Thermol  52.8     6.5 0.00014   33.2   0.9   12  255-266   136-147 (150)
 99 PF01434 Peptidase_M41:  Peptid  52.0     7.8 0.00017   34.4   1.4   16  251-266    25-40  (213)
100 PLN02791 Nudix hydrolase homol  51.4     7.6 0.00017   41.3   1.4   21  253-273   584-604 (770)
101 cd06457 M3A_MIP Peptidase M3 m  51.3       7 0.00015   38.9   1.0   31  174-204   134-168 (458)
102 cd06456 M3A_DCP_Oligopeptidase  50.1     7.9 0.00017   38.2   1.2   15  252-266   206-220 (422)
103 KOG2921 Intramembrane metallop  49.3     8.2 0.00018   37.6   1.1   16  254-269   131-146 (484)
104 PF08434 CLCA_N:  Calcium-activ  48.8      12 0.00027   34.5   2.2   63  197-268    98-164 (262)
105 PF01863 DUF45:  Protein of unk  48.3      12 0.00027   32.4   2.0   43  230-277   145-187 (205)
106 COG4227 Antirestriction protei  47.9      12 0.00026   34.6   1.9   24  250-273   199-222 (316)
107 PRK10779 zinc metallopeptidase  46.9     8.6 0.00019   38.2   0.9   12  255-266    16-27  (449)
108 cd06158 S2P-M50_like_1 Unchara  46.9      10 0.00023   32.8   1.3   13  254-266     9-21  (181)
109 KOG2719 Metalloprotease [Gener  45.7      11 0.00023   37.2   1.3   21  251-272   277-297 (428)
110 TIGR00054 RIP metalloprotease   44.8     9.5 0.00021   37.5   0.8   12  255-266    15-26  (420)
111 COG1164 Oligoendopeptidase F [  42.7      11 0.00023   39.1   0.9   14  253-266   379-392 (598)
112 cd06460 M32_Taq Peptidase fami  42.0      11 0.00025   36.9   0.9   12  255-266   160-171 (396)
113 COG4103 Uncharacterized protei  40.2      40 0.00087   28.3   3.7   53    6-61     31-83  (148)
114 COG4784 Putative Zn-dependent   40.0      18  0.0004   34.8   1.9   16  251-266   121-136 (479)
115 COG2321 Predicted metalloprote  40.0      15 0.00032   34.2   1.2   38  228-266   138-179 (295)
116 PRK10911 oligopeptidase A; Pro  37.8      15 0.00032   38.6   1.0   14  253-266   462-475 (680)
117 PF14891 Peptidase_M91:  Effect  37.7      33 0.00071   29.4   3.0   17  253-269   102-118 (174)
118 PF03571 Peptidase_M49:  Peptid  36.3      16 0.00035   37.3   1.0   15  254-268   293-308 (549)
119 KOG2661 Peptidase family M48 [  35.9      31 0.00067   33.1   2.7   20  252-272   273-292 (424)
120 PF02102 Peptidase_M35:  Deuter  33.5      29 0.00063   33.6   2.2   46  221-268   262-311 (359)
121 PF06167 Peptidase_M90:  Glucos  32.5      21 0.00045   32.9   1.0   21  251-271   151-171 (253)
122 cd02641 R3H_Smubp-2_like R3H d  28.3      39 0.00086   23.8   1.6   21  253-273    28-48  (60)
123 PF07172 GRP:  Glycine rich pro  27.7      36 0.00077   26.5   1.4    8   11-18     15-22  (95)
124 PRK10280 dipeptidyl carboxypep  26.9      28 0.00061   36.6   0.9   27  178-204   369-397 (681)
125 cd02639 R3H_RRM R3H domain of   26.4      43 0.00092   23.8   1.5   23  253-275    28-50  (60)
126 PRK10733 hflB ATP-dependent me  25.9      34 0.00074   35.7   1.3   14  253-266   407-420 (644)
127 PF04450 BSP:  Peptidase of pla  25.9 1.6E+02  0.0035   26.1   5.4   38  230-267    71-109 (205)
128 PF02074 Peptidase_M32:  Carbox  24.7      35 0.00076   34.5   1.1   16  255-270   260-278 (494)
129 CHL00176 ftsH cell division pr  24.1      37 0.00081   35.4   1.2   14  253-266   437-450 (638)
130 COG0177 Nth Predicted EndoIII-  24.1      82  0.0018   28.2   3.2   53   43-121    66-118 (211)
131 PF12315 DUF3633:  Protein of u  23.0      42 0.00091   30.0   1.1   14  253-266    92-105 (212)
132 cd06461 M2_ACE Peptidase famil  22.9      43 0.00093   33.7   1.3   16  253-268   246-261 (477)
133 COG3590 PepO Predicted metallo  22.8      25 0.00054   36.0  -0.4   13  254-266   487-499 (654)
134 PF01726 LexA_DNA_bind:  LexA D  22.7      72  0.0016   22.8   2.1   36   46-111    12-47  (65)
135 PF01431 Peptidase_M13:  Peptid  21.9      49  0.0011   28.7   1.4   18  253-270    35-52  (206)
136 PF13670 PepSY_2:  Peptidase pr  21.3 1.5E+02  0.0033   21.8   3.8   14   45-58     30-43  (83)
137 smart00099 btg1 tob/btg1 famil  21.2      67  0.0014   25.7   1.8   33   44-93      7-39  (108)
138 COG3926 zliS Lysozyme family p  20.5      86  0.0019   28.4   2.5   28   89-116    94-125 (252)
139 PLN00081 photosystem I reactio  20.1      36 0.00079   27.7   0.1   39  231-269    81-127 (141)
140 PF10281 Ish1:  Putative stress  20.1 2.2E+02  0.0048   17.8   3.8   15   47-61      7-21  (38)
141 COG5504 Predicted Zn-dependent  20.0 1.9E+02  0.0041   26.8   4.6   77  172-273    81-159 (280)

No 1  
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures]
Probab=100.00  E-value=1.5e-55  Score=430.54  Aligned_cols=225  Identities=40%  Similarity=0.692  Sum_probs=199.7

Q ss_pred             cHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhhccCcccCCc
Q 037265           45 GIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTMAQPRCGLPD  124 (305)
Q Consensus        45 ~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m~~PRCg~pD  124 (305)
                      +...++.||++|||+.+.+...            ...  .+..+++||+.||++++|++||++|.+|++.|.+||||+||
T Consensus        29 ~~~~~~~yl~~~~y~~~~~~~~------------~~~--~~~~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd   94 (469)
T KOG1565|consen   29 DKVALQDYLECYGYLPPTDLTA------------TRA--SQNVLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPD   94 (469)
T ss_pred             chhHHHHHhhhcccCCCccccc------------ccc--CchhhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCC
Confidence            6678999999999998842211            101  46889999999999999999999999999999999999999


Q ss_pred             CCCCcccccCCCCCcccccccccccC-CCCCCCcceeEEeecCCCCh----hhHHHHHHHHHHhhccCcceEEecCCCCC
Q 037265          125 IINGTTRMQRGSTDKKYDIHYAFFEG-PRWPLTKKTVTYAFQPGTRD----DIHEPVRVALLLWSNWAPFTFEGSNDYEN  199 (305)
Q Consensus       125 ~~~~~~~~~~~~~~~~~~~~y~~~~g-~kW~~~k~~LtY~i~~~~~~----~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~  199 (305)
                      .                  +|.++++ +||+  +.+|||+|.+++++    +++.++++||+.|+++++|+|.|+.....
T Consensus        95 ~------------------~~~~~~~~~kW~--k~~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~  154 (469)
T KOG1565|consen   95 G------------------RYRYFPGKPKWN--KEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGE  154 (469)
T ss_pred             C------------------ccccCcccCccc--ccccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCC
Confidence            1                  4555556 9999  89999999998643    67788999999999999999999997679


Q ss_pred             ccEEEEeecCCCCCCCCCCCCCCcceeeecC---CcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCCCCC
Q 037265          200 ADIKISFQRGDHGDGTPFDGPWHTLGHAFSD---PYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSVKAA  276 (305)
Q Consensus       200 adI~I~f~~~~hgd~~~fdG~gg~laha~~P---~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~s  276 (305)
                      |||+|.|..+.|||++||||++|++||||+|   .+|++|||++|.|+++ ...+.+|+.||+|||||+|||.||.++++
T Consensus       155 aDi~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~~G~~hfD~dE~Wt~~-~~~g~~l~~Va~HEiGH~LGL~HS~~~~a  233 (469)
T KOG1565|consen  155 ADIRISFFPGDHGDGFPFDGPGGVLAHAFFPGPGIGGDLHFDKDETWTYG-DSNGVDLFLVAAHEIGHALGLGHSSDPDA  233 (469)
T ss_pred             CceeeeeeccCCCCCCcccCCCCceecccCCCCCCCCccccCcccceecc-CCccchhHHHhhhhcccccccCCCCCccc
Confidence            9999999999999999999999999999999   6789999999999996 34689999999999999999999999999


Q ss_pred             ccccccCCCC-CCCCCHHHHHHHHHHhCC
Q 037265          277 SMWPSTRAGT-TKGLNDDDIRRMKMLYGR  304 (305)
Q Consensus       277 vM~p~~~~~~-~~~l~~dDi~~iq~LYg~  304 (305)
                      ||||+|++.. ...|+.|||.|||.|||.
T Consensus       234 iM~P~y~~~~~~~~L~~DDv~giq~lYG~  262 (469)
T KOG1565|consen  234 IMYPFYQPDSGNFDLSQDDVRGIQHLYGG  262 (469)
T ss_pred             ccccccccCCCCcccChhhhhhhHHHhCC
Confidence            9999999522 238999999999999995


No 2  
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=100.00  E-value=5.1e-37  Score=261.35  Aligned_cols=150  Identities=43%  Similarity=0.764  Sum_probs=135.2

Q ss_pred             CCCCCcceeEEeecCCCC----hhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceee
Q 037265          152 RWPLTKKTVTYAFQPGTR----DDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHA  227 (305)
Q Consensus       152 kW~~~k~~LtY~i~~~~~----~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha  227 (305)
                      ||+  +++|||+|.+...    ...+++|++||+.|+++++|+|+|+...+.|||+|.|....|+++++|+|++|+++||
T Consensus         1 kW~--~~~itY~i~~~~~~~~~~~~~~~i~~A~~~W~~~~~l~F~e~~~~~~adi~I~~~~~~~~~~~~~~~~~g~l~~a   78 (157)
T cd04278           1 KWS--KTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFARGNHGDGYPFDGPGGTLAHA   78 (157)
T ss_pred             CCC--CCceeEEEECCCCCCCHHHHHHHHHHHHHHHHhhcCceeEEcccCCCCCEEEEEeecccCCCCCCCCCccccccc
Confidence            799  9999999987652    3677889999999999999999999876689999999999999999999999999999


Q ss_pred             ecC--CcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCCCCCccccccCCCC-CCCCCHHHHHHHHHHhC
Q 037265          228 FSD--PYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSVKAASMWPSTRAGT-TKGLNDDDIRRMKMLYG  303 (305)
Q Consensus       228 ~~P--~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~~~~~~-~~~l~~dDi~~iq~LYg  303 (305)
                      ++|  ..|+|+||.++.|++.....+.+++.|++|||||+|||.|+.++.+||||++.... ...|+++||.+||+|||
T Consensus        79 ~~p~~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~~vM~~~~~~~~~~~~l~~~D~~~~~~lYg  157 (157)
T cd04278          79 FFPGGIGGDIHFDDDEQWTLGSDSGGTDLFSVAAHEIGHALGLGHSSDPDSIMYPYYQGPVPKFKLSQDDIRGIQALYG  157 (157)
T ss_pred             cCCCCcceeEEECCCcccccCCCCccchHHHHHHHHhccccccCCCCCCcCeecccccCCCcCCCCCHHHHHHHHHhcC
Confidence            998  78999999999999865446678999999999999999999999999999998542 34999999999999998


No 3  
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=100.00  E-value=8.3e-35  Score=245.58  Aligned_cols=147  Identities=43%  Similarity=0.793  Sum_probs=131.5

Q ss_pred             CCCCCcceeEEeecCCCCh----hhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceee
Q 037265          152 RWPLTKKTVTYAFQPGTRD----DIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHA  227 (305)
Q Consensus       152 kW~~~k~~LtY~i~~~~~~----~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha  227 (305)
                      ||+  +++|||+|.+.++.    +.+++|++||+.|+++++++|+++.+ .++||+|.|....+++...|++.+++++++
T Consensus         1 ~W~--~~~ity~i~~~~~~~~~~~~~~~i~~A~~~W~~~~~~~F~~~~~-~~adi~i~~~~~~~~~~~~~~~~~~~~~~~   77 (154)
T PF00413_consen    1 KWP--KKTITYSISNTTPQLSQSEQRDAIRQAFQAWNDVAPLNFTEVSD-GNADIRISFGSNNHGDGYSFDGSGGTLAHA   77 (154)
T ss_dssp             SSS--SSEEEEEESSBCTTS-HHHHHHHHHHHHHHHHTTSSEEEEEESS-SSCSEEEEEESSSSSSSS-CSSSSSESEEE
T ss_pred             CCC--CCcEEEEEECCCCCCCHHHHHHHHHHHHHHHHhcCCceEEeccC-CCcceeeeeeccccCcccccccceeeeecc
Confidence            799  89999999987632    56788999999999999999999995 469999999999999999999999999999


Q ss_pred             ecCC---cceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCCCCCccccccCCCCCCCCCHHHHHHHHHHhC
Q 037265          228 FSDP---YAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSVKAASMWPSTRAGTTKGLNDDDIRRMKMLYG  303 (305)
Q Consensus       228 ~~P~---~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~~~~~~~~~l~~dDi~~iq~LYg  303 (305)
                      +.|.   .|+++|+.++.|...  ..+.++..|++|||||+|||+|+.+++|||||++.+.....|+.+||.+||+|||
T Consensus        78 ~~~~~~~~~~i~~~~~~~~~~~--~~~~~~~~v~~HEiGHaLGL~H~~~~~svM~~~~~~~~~~~l~~~Di~~i~~lYg  154 (154)
T PF00413_consen   78 YFPNNIVSGDIHFNDDESWTID--DSGNDLQSVAIHEIGHALGLDHSNDPNSVMYPYYRGPDNKTLSEDDIDGIQYLYG  154 (154)
T ss_dssp             EESSSTTTTEEEEETTSHEESS--SSSEEHHHHHHHHHHHHTTBESSSSTTSTTSSSCTSSSSTSTTHHHHHHHHHHHS
T ss_pred             ccccccccccccccccccchhh--hhhhhhhhhhhhccccccCcCcCCCcccceeeecccCCCCCCCHHHHHHHHHHhC
Confidence            9985   799999999999875  3467899999999999999999999999999999864424899999999999998


No 4  
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.95  E-value=1.2e-27  Score=203.30  Aligned_cols=139  Identities=31%  Similarity=0.442  Sum_probs=110.0

Q ss_pred             ceeEEeecCCCC------hhhHHHHHHHHHHhhccCcceEEecCCC-CCccEEEEeecCCCCCCCCCCCCCCcceeeecC
Q 037265          158 KTVTYAFQPGTR------DDIHEPVRVALLLWSNWAPFTFEGSNDY-ENADIKISFQRGDHGDGTPFDGPWHTLGHAFSD  230 (305)
Q Consensus       158 ~~LtY~i~~~~~------~~~~~~i~~A~~~Ws~~~~l~F~ev~~~-~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P  230 (305)
                      ..|+|++++.+.      .+.+++|++||+.|+++++|+|+++... .++||+|.|....     +|+|.++++||+++|
T Consensus         2 ~~i~~~i~~~~~~~~~~~~~~~~~v~~A~~~W~~~~~l~F~~~~~~~~~adi~I~f~~~~-----~~~~~g~~~a~a~~p   76 (156)
T cd04279           2 SPIRVYIDPTPAPPDSRAQSWLQAVKQAAAEWENVGPLKFVYNPEEDNDADIVIFFDRPP-----PVGGAGGGLARAGFP   76 (156)
T ss_pred             CCeEEEEcCCCCccccchHHHHHHHHHHHHHHHHhCCeEEEEccCCCCCCcEEEEecCCC-----CCCCCCCceEEeccc
Confidence            568899987642      2677889999999999999999998753 3899999998642     788999999999999


Q ss_pred             CcceEEEcccccccc------CCcCCcchhHHHHHHhhhhhcCCCCCCCCC-CccccccCCCCC--CCCCHHHHHHHHHH
Q 037265          231 PYAVVHFNGDVNWVM------GTVKGGFDMQTVALHELGHVLGLSHSSVKA-ASMWPSTRAGTT--KGLNDDDIRRMKML  301 (305)
Q Consensus       231 ~~G~ihfd~~e~w~~------~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~-svM~p~~~~~~~--~~l~~dDi~~iq~L  301 (305)
                      ..|.  ++....|..      .....+.+++.|++|||||+|||.|+.++. ++|||++.....  ..|+++|+++|+.|
T Consensus        77 ~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~~siM~p~~~~~~~~~~~l~~~D~~~i~~l  154 (156)
T cd04279          77 LISD--GNRKLFNRTDINLGPGQPRGAENLQAIALHELGHALGLWHHSDRPEDAMYPSQGQGPDGNPTLSARDVATLKRL  154 (156)
T ss_pred             ccCC--CcccccccceEeecCCcCccchHHHHHHHHHhhhhhcCCCCCCCccceeeeecccCCcCcCCCCHHHHHHHHHH
Confidence            7533  222222221      111125689999999999999999999999 999999986433  38999999999999


Q ss_pred             hC
Q 037265          302 YG  303 (305)
Q Consensus       302 Yg  303 (305)
                      ||
T Consensus       155 Y~  156 (156)
T cd04279         155 YG  156 (156)
T ss_pred             hC
Confidence            97


No 5  
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=99.90  E-value=3.7e-24  Score=182.63  Aligned_cols=142  Identities=25%  Similarity=0.303  Sum_probs=106.6

Q ss_pred             cceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEE
Q 037265          157 KKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVH  236 (305)
Q Consensus       157 k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ih  236 (305)
                      ++.|+|+|.+..+...+++|++||+.|+++++++|+++.....+||+|.+....+..    +|..+.+++...|..|+|+
T Consensus         1 ~~~I~y~i~~~~~~~~r~~i~~A~~~W~~~~~i~F~e~~~~~~~di~i~~~~~~~~~----~~~~~~~~~~~~~~~g~i~   76 (165)
T cd04268           1 KKPITYYIDDSVPDKLRAAILDAIEAWNKAFAIGFKNANDVDPADIRYSVIRWIPYN----DGTWSYGPSQVDPLTGEIL   76 (165)
T ss_pred             CCCEEEEEcCCCCHHHHHHHHHHHHHHHHHhCcCceeccccCccCceEEEEEeecCC----CCccccCCccCCCCCccEE
Confidence            468999999886667888999999999999999999998766899999987642111    1111222233346678999


Q ss_pred             EccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCC----------------CCCccccccCCC-------CCCCCCHH
Q 037265          237 FNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSV----------------KAASMWPSTRAG-------TTKGLNDD  293 (305)
Q Consensus       237 fd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~----------------~~svM~p~~~~~-------~~~~l~~d  293 (305)
                      ++....|.......+..+..|++|||||+|||.|+.+                ..|||++.....       ....|+.+
T Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~~~~~~~~~~~~~~~~~SvM~y~~~~~~~~~~~~~~~~~~~~  156 (165)
T cd04268          77 LARVYLYSSFVEYSGARLRNTAEHELGHALGLRHNFAASDRDDNVDLLAEKGDTSSVMDYAPSNFSIQLGDGQKYTIGPY  156 (165)
T ss_pred             eeEEEEchhHHHHHHHHHHHHHHHHHHHHhcccccCcCCccCCcchhhccCCCCcccCCCCccccccccccccCCCCCHH
Confidence            9876654321112345789999999999999999998                899999765421       23489999


Q ss_pred             HHHHHHHHh
Q 037265          294 DIRRMKMLY  302 (305)
Q Consensus       294 Di~~iq~LY  302 (305)
                      ||.+||.||
T Consensus       157 Di~ai~~lY  165 (165)
T cd04268         157 DIAAIKKLY  165 (165)
T ss_pred             HHHHHHhcC
Confidence            999999999


No 6  
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=99.88  E-value=1.1e-22  Score=169.68  Aligned_cols=132  Identities=33%  Similarity=0.466  Sum_probs=106.0

Q ss_pred             CCCCCCcceeEEeec-CCCChh-hHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeee
Q 037265          151 PRWPLTKKTVTYAFQ-PGTRDD-IHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAF  228 (305)
Q Consensus       151 ~kW~~~k~~LtY~i~-~~~~~~-~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~  228 (305)
                      .+|+  +.+|+|.|. +..... .++.|++||+.|+++++|+|+|+.+  ++||.|.|...++        .|..+++++
T Consensus         3 ~~W~--~~~v~Y~i~~~~~~~~~~~~~i~~A~~~w~~~t~i~F~e~~~--~ad~~I~f~~~~~--------~g~~~a~~g   70 (140)
T smart00235        3 KKWP--KGTVPYVIDSSSLSPEEVREAIARAFAEWSDVTCLRFVERTS--TADIYISFGKGDG--------SGCTLSHAG   70 (140)
T ss_pred             CcCC--CCcEEEEEcCCCCCHHHHHHHHHHHHHHHhcCCeeEEEECCC--CCCeEEEEEECCC--------CCcceeeee
Confidence            5899  889999997 332223 4788999999999999999999874  8999999998755        122268888


Q ss_pred             cCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCCCCC---ccccccCCCC-CCCCCHHHHHHHHHHhCC
Q 037265          229 SDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSVKAA---SMWPSTRAGT-TKGLNDDDIRRMKMLYGR  304 (305)
Q Consensus       229 ~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~s---vM~p~~~~~~-~~~l~~dDi~~iq~LYg~  304 (305)
                      .| .|+++++. +.|+.+        ..|++|||||+|||.|+.++.+   +|++.+.... ...++++|..+++.+||+
T Consensus        71 ~~-~g~~~~~~-~~~~~~--------~~~~~HEigHaLGl~H~~~~~drd~~~~~~~~~~~~~~~~~~~~~~~~~~~yg~  140 (140)
T smart00235       71 RP-GGDQHFSL-GNGCIN--------TGVAAHELGHALGLYHEQSRSDRDNYMYINYTNITRNFDLSNDDSLGIPYDYGS  140 (140)
T ss_pred             cC-CCceEEEc-cCCcCC--------cccHHHHHHHHhcCCcCCCCCcccCeEEEehhhhhhccccccccCCCchhccCc
Confidence            88 78999976 566543        2499999999999999998888   9999997431 126778899999999985


No 7  
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=99.86  E-value=3e-21  Score=168.60  Aligned_cols=122  Identities=25%  Similarity=0.284  Sum_probs=95.1

Q ss_pred             hhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCC-------cceEEEcccccc
Q 037265          171 DIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDP-------YAVVHFNGDVNW  243 (305)
Q Consensus       171 ~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~-------~G~ihfd~~e~w  243 (305)
                      ..++.|++||+.|+++++|+|+|+....++||+|.+.....         +++.+.|++|.       .|+|++|.+..+
T Consensus        34 ~~~~~i~~A~~~w~~~~~l~F~e~~~~~~adI~i~~~~~~~---------~~~~g~a~~p~~~~~~~~~g~i~~~~~~~~  104 (186)
T cd04277          34 AQQAAARDALEAWEDVADIDFVEVSDNSGADIRFGNSSDPD---------GNTAGYAYYPGSGSGTAYGGDIWFNSSYDT  104 (186)
T ss_pred             HHHHHHHHHHHHHHhhcCceeEECCCCCcceEEEEeccCCC---------CCccEEEECCCCCccccccceeEEecCccc
Confidence            56678899999999999999999997778999998875321         45677888873       368999988766


Q ss_pred             ccCCcCCcchhHHHHHHhhhhhcCCCCCCCC----------------CCccccccCCC--------CCCCCCHHHHHHHH
Q 037265          244 VMGTVKGGFDMQTVALHELGHVLGLSHSSVK----------------AASMWPSTRAG--------TTKGLNDDDIRRMK  299 (305)
Q Consensus       244 ~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~----------------~svM~p~~~~~--------~~~~l~~dDi~~iq  299 (305)
                      ...  ..+.....|++|||||+|||.|+.+.                .+||.......        ....++..||.+||
T Consensus       105 ~~~--~~g~~~~~t~~HEiGHaLGL~H~~~~~~~~~~~~~~~~~~~~~SVMSY~~~~~~~~~~~~~~~~~~~~~DI~AlQ  182 (186)
T cd04277         105 NSD--SPGSYGYQTIIHEIGHALGLEHPGDYNGGDPVPPTYALDSREYTVMSYNSGYGNGASAGGGYPQTPMLLDIAALQ  182 (186)
T ss_pred             ccC--CCChhhHHHHHHHHHHHhcCCCCCcCCCCCCCCccccccCcceEEEeecCCCCCCccccCcccCCccHHHHHHHH
Confidence            542  23456789999999999999998752                46896543332        12378899999999


Q ss_pred             HHhC
Q 037265          300 MLYG  303 (305)
Q Consensus       300 ~LYg  303 (305)
                      +|||
T Consensus       183 ~lYG  186 (186)
T cd04277         183 YLYG  186 (186)
T ss_pred             HhhC
Confidence            9998


No 8  
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.71  E-value=1.4e-16  Score=140.72  Aligned_cols=108  Identities=30%  Similarity=0.501  Sum_probs=76.8

Q ss_pred             CCCCCcceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCC
Q 037265          152 RWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDP  231 (305)
Q Consensus       152 kW~~~k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~  231 (305)
                      +|++ +++|+|.|........++.|++||+.|+++++|+|++++. .+++|+|.|..+. | ++++.|..+..   ..+.
T Consensus         2 ~W~~-~~~~~~~f~~~~~~~~r~~I~~A~~~W~~~t~i~F~~~~~-~~adi~I~f~~~~-G-c~S~vG~~~~~---~~~~   74 (198)
T cd04327           2 LWRN-GTVLRIAFLGGPDAFLKDKVRAAAREWLPYANLKFKFVTD-ADADIRISFTPGD-G-YWSYVGTDALL---IGAD   74 (198)
T ss_pred             CCCC-CCeEEEEeCCCCcHHHHHHHHHHHHHHhhhcCeEEEECCC-CCCCEEEEEecCC-C-CCCCcCCcccc---cCCC
Confidence            6986 6789999987755567788999999999999999999985 4799999998742 3 46677764321   1111


Q ss_pred             cceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCC
Q 037265          232 YAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHS  271 (305)
Q Consensus       232 ~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs  271 (305)
                      ...+.+.    |.... ..+.+...|++|||||||||.|+
T Consensus        75 ~~t~~l~----~~~~~-~~~~~~~~~i~HElgHaLG~~HE  109 (198)
T cd04327          75 APTMNLG----WFTDD-TPDPEFSRVVLHEFGHALGFIHE  109 (198)
T ss_pred             Cceeeee----eecCC-CchhhHHHHHHHHHHHHhcCccc
Confidence            2234443    21110 12346678999999999999996


No 9  
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=99.70  E-value=1.2e-16  Score=136.24  Aligned_cols=117  Identities=25%  Similarity=0.327  Sum_probs=88.0

Q ss_pred             hhHHHHHHHHHHhhccCcceEEecCCC-CCccEEEEeecCCCCCCCCCCCCCCcceeeecCC-----cceEEEccccccc
Q 037265          171 DIHEPVRVALLLWSNWAPFTFEGSNDY-ENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDP-----YAVVHFNGDVNWV  244 (305)
Q Consensus       171 ~~~~~i~~A~~~Ws~~~~l~F~ev~~~-~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~-----~G~ihfd~~e~w~  244 (305)
                      ..+..|+.|++.|+++++++|+++... ..+||.+.+...+.        .++.+++|+.|.     .|.+.++....+ 
T Consensus        22 ~~~~~v~~a~~~w~~~~~i~f~~~~~~~~~~di~~~~~~~~~--------~~~~~g~a~~~~~c~~~~~~~~~~~~~~~-   92 (167)
T cd00203          22 QIQSLILIAMQIWRDYLNIRFVLVGVEIDKADIAILVTRQDF--------DGGTGGWAYLGRVCDSLRGVGVLQDNQSG-   92 (167)
T ss_pred             HHHHHHHHHHHHHHhhhCceEEEeccCCCcCcEEEEeccccC--------CCCceEEEecCCccCCCCCcEEEecCCcc-
Confidence            566788999999999999999999854 48999998876432        234456676653     255555433222 


Q ss_pred             cCCcCCcchhHHHHHHhhhhhcCCCCCCC--------------------CCCccccccCC---CCCCCCCHHHHHHHHHH
Q 037265          245 MGTVKGGFDMQTVALHELGHVLGLSHSSV--------------------KAASMWPSTRA---GTTKGLNDDDIRRMKML  301 (305)
Q Consensus       245 ~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~--------------------~~svM~p~~~~---~~~~~l~~dDi~~iq~L  301 (305)
                            ......|++|||||+|||.|..+                    ..+||+|....   .....++..||..||++
T Consensus        93 ------~~~~~~~~~HElGH~LGl~H~~~~~~~~~~~~~~~~~~~~~~~~~siM~y~~~~~~~~~~~~fS~~d~~~i~~~  166 (167)
T cd00203          93 ------TKEGAQTIAHELGHALGFYHDHDRKDRDDYPTIDDTLNAEDDDYYSVMSYTKGSFSDGQRKDFSQCDIDQINKL  166 (167)
T ss_pred             ------cccchhhHHHHHHHHhCCCccCcCCCCCCCccccccccCCCCCCCeEeccCccccCcccCCCcCHHHHHHHHhh
Confidence                  34678999999999999999865                    46899987764   13448999999999999


Q ss_pred             h
Q 037265          302 Y  302 (305)
Q Consensus       302 Y  302 (305)
                      |
T Consensus       167 Y  167 (167)
T cd00203         167 Y  167 (167)
T ss_pred             C
Confidence            8


No 10 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.60  E-value=5.6e-15  Score=130.16  Aligned_cols=141  Identities=17%  Similarity=0.184  Sum_probs=90.4

Q ss_pred             cceeEEeecCCCChhhHHHHHHHHHHhhcc------CcceEEecCCC--CCccEE---EEeecCCCCCCCCCCCCCCcce
Q 037265          157 KKTVTYAFQPGTRDDIHEPVRVALLLWSNW------APFTFEGSNDY--ENADIK---ISFQRGDHGDGTPFDGPWHTLG  225 (305)
Q Consensus       157 k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~------~~l~F~ev~~~--~~adI~---I~f~~~~hgd~~~fdG~gg~la  225 (305)
                      |+.|||+|+++++.+++++|++||+.|+++      .++.+.++...  ...||+   |+|....       ++..+...
T Consensus         7 k~pItyyI~~~~p~~~r~aI~~A~~~Wn~~fe~~Gf~~a~~v~~~p~~~~~~Diry~~ir~~~~~-------~~~~~~gp   79 (197)
T cd04276           7 KEPIVYYLDNTFPEKYRDAIREGVLYWNKAFEKAGFKNAIIVKVLPDDADPGDIRYNVIRWIHSP-------NGGWAYGP   79 (197)
T ss_pred             CCCEEEEecCCCcHHHHHHHHHHHHHHHHHHHhcCCCccEEEEeCCCCcCcccceEEEEEEEecC-------CCcceecc
Confidence            899999999998878889999999999997      34555555432  236888   5555322       12233344


Q ss_pred             eeecCCc-----ceEEEccccccccCC---cCCcchhHHHHHHhhhhhcCCCCCCC---------------------CCC
Q 037265          226 HAFSDPY-----AVVHFNGDVNWVMGT---VKGGFDMQTVALHELGHVLGLSHSSV---------------------KAA  276 (305)
Q Consensus       226 ha~~P~~-----G~ihfd~~e~w~~~~---~~~~~~l~~Va~HEiGHaLGL~Hs~~---------------------~~s  276 (305)
                      +...|..     ++|.++.........   ...+..+..+++||+||+|||.|...                     ..|
T Consensus        80 s~~dPrTGeIl~a~V~l~~~~~~~~~~~~~~~~~~~~~~~~~he~gh~lGl~hn~~~s~~~~~~~l~~~~~~~~~~~~~S  159 (197)
T cd04276          80 SVVDPRTGEILKADVILYSGFLRQDQLWYEDLLAASLRYLLAHEVGHTLGLRHNFKASSDGSNEELEDPLGTKEKGATSS  159 (197)
T ss_pred             cccCCCCCCeEEEEEEeCchhhccchhHHHHHHHHHHHHHHHHHHHHHhcCcccccccccCchhhhcchhhhhhcCCcce
Confidence            4555654     455665443211100   01123478899999999999999641                     246


Q ss_pred             cccc---ccCC-------CCCCCCCHHHHHHHHHHhCC
Q 037265          277 SMWP---STRA-------GTTKGLNDDDIRRMKMLYGR  304 (305)
Q Consensus       277 vM~p---~~~~-------~~~~~l~~dDi~~iq~LYg~  304 (305)
                      ||-.   .+..       .....+...||.+||++||.
T Consensus       160 VMdY~~~~~~~~~~~~~~~~~~~~g~yDi~Aiq~~Y~~  197 (197)
T cd04276         160 VMDYPPPNVAAQGEDQGDYYPPTIGPYDKWAIEYGYTP  197 (197)
T ss_pred             eecCccccccccCccccccccCCCchHHHHHHHHHcCC
Confidence            7732   1210       01237889999999999985


No 11 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=99.57  E-value=3.2e-14  Score=125.49  Aligned_cols=132  Identities=20%  Similarity=0.301  Sum_probs=91.9

Q ss_pred             cceeEEeecCCC----ChhhHHHHHHHHHHhhcc-CcceEEec--CCCCCccEEEEeecCCCCCCCCCCCCCCcceeeec
Q 037265          157 KKTVTYAFQPGT----RDDIHEPVRVALLLWSNW-APFTFEGS--NDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFS  229 (305)
Q Consensus       157 k~~LtY~i~~~~----~~~~~~~i~~A~~~Ws~~-~~l~F~ev--~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~  229 (305)
                      .++|+..+.+..    ....+.++++|++.|+.+ ..|+|+-+  .....+||.|.-...        +.+.|+.+.|.|
T Consensus        38 ~~~I~i~~~~~~~~~l~s~~~~al~~AI~~yNalgl~i~F~~t~g~~~~~~di~v~~~~~--------~~~~G~ggsAGF  109 (211)
T PF12388_consen   38 PRTITIIGYTGGSQSLNSAWRTALDEAINNYNALGLSITFTLTFGTNYQNADIIVYSNSS--------NNPSGAGGSAGF  109 (211)
T ss_pred             CCEEEEEeCCCccccccHHHHHHHHHHHHHHHhhCCceEEEEecCCCcCCCceEEEeccC--------CCCCCcceeccC
Confidence            578888887732    225677899999999997 45777522  233467776632221        123455677888


Q ss_pred             C-Ccc----eEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC------------------------------CC
Q 037265          230 D-PYA----VVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS------------------------------VK  274 (305)
Q Consensus       230 P-~~G----~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~------------------------------~~  274 (305)
                      | .+|    .|.+     +.+.+ ........|++|||||+|||.|++                              |+
T Consensus       110 P~s~G~P~~~I~I-----~~~~~-~~~~~~~hvi~HEiGH~IGfRHTD~~~R~SCG~~~nEg~~~vGAi~IpGTPt~~d~  183 (211)
T PF12388_consen  110 PTSNGNPYKFIQI-----YGLSN-YSVNVIEHVITHEIGHCIGFRHTDYFNRSSCGSGGNEGSAGVGAIHIPGTPTGADP  183 (211)
T ss_pred             CCCCCCCCceEEE-----EecCC-CchhHHHHHHHHHhhhhccccccCcCCcccccccCCcCccccceEECCCCCCCCCC
Confidence            8 555    4555     11111 122346789999999999999975                              46


Q ss_pred             CCccccccCCCCCCCCCHHHHHHHHHHh
Q 037265          275 AASMWPSTRAGTTKGLNDDDIRRMKMLY  302 (305)
Q Consensus       275 ~svM~p~~~~~~~~~l~~dDi~~iq~LY  302 (305)
                      +|||...+..+....++..||.++++||
T Consensus       184 ~SiM~ac~~~~~~~~f~~~Di~Al~~lY  211 (211)
T PF12388_consen  184 NSIMNACFSSGEDGEFTSNDITALNYLY  211 (211)
T ss_pred             chhhhccccCCCCCCcChhhHHHHHhhC
Confidence            7999999876655699999999999999


No 12 
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=99.50  E-value=2.1e-13  Score=118.80  Aligned_cols=91  Identities=21%  Similarity=0.205  Sum_probs=63.2

Q ss_pred             ceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEE
Q 037265          158 KTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHF  237 (305)
Q Consensus       158 ~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihf  237 (305)
                      ..|.|.|+..-....++.|++||+.|+++++|+|++.+.   ++..|.|..+ .| ++++-|..+        ....+.+
T Consensus         2 ~~VpY~i~~~~~~~~~~~I~~A~~~w~~~TcIrF~~~~~---~~~~I~f~~~-~G-c~S~vG~~~--------~~q~i~l   68 (180)
T cd04280           2 GTVPYVIDGSFDESDRSLILRAMREIESNTCIRFVPRTT---EKDYIRIVKG-SG-CWSYVGRVG--------GRQVVSL   68 (180)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHhCCcceEEECCC---CCcEEEEEcC-CC-cceecCccC--------CceeEEe
Confidence            478999998544467788999999999999999999874   4556677654 33 344444321        1123333


Q ss_pred             ccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          238 NGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       238 d~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      ..           ++....+++|||||||||.|..
T Consensus        69 ~~-----------~c~~~g~v~HE~~HalG~~HEh   92 (180)
T cd04280          69 GS-----------GCFSLGTIVHELMHALGFYHEQ   92 (180)
T ss_pred             CC-----------CcCcCchhHHHHHHHhcCcchh
Confidence            21           2333689999999999999964


No 13 
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=99.43  E-value=5.4e-13  Score=117.30  Aligned_cols=96  Identities=28%  Similarity=0.460  Sum_probs=61.0

Q ss_pred             CCCCCcceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCC
Q 037265          152 RWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDP  231 (305)
Q Consensus       152 kW~~~k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~  231 (305)
                      +|+  ..+|.|.|...-+...++.|++|+..|++.++|+|+++. . .....|.|..+ .| ++++-|..+        .
T Consensus         2 ~Wp--~~~IpY~~~~~~~~~~~~~I~~Am~~~e~~TcI~F~~~~-~-~~~~~i~~~~~-~g-C~S~vG~~~--------g   67 (191)
T PF01400_consen    2 KWP--NGTIPYYIDPSFSSSQRQRIRKAMDEWEKNTCIRFVERT-E-NEDDYISFSNG-SG-CWSYVGRQG--------G   67 (191)
T ss_dssp             S-G--GGEEEEEEETTS-HHHHHHHHHHHHHHHHHSSEEEEE-S-S-SSSSEEEEESS-SS-EEEESS--S--------S
T ss_pred             cCC--CCEEEEEECCCCCHHHHHHHHHHHHHHHhCCCEEEEECC-C-CCceEEEeecC-cc-ccchhhhcC--------c
Confidence            799  889999999865546677899999999999999999998 3 44445566542 23 234444321        0


Q ss_pred             cceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          232 YAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       232 ~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      .-.|.+.           .+.....|++|||||||||.|..
T Consensus        68 ~q~i~l~-----------~~c~~~~~i~HEl~HaLG~~HEh   97 (191)
T PF01400_consen   68 EQTINLG-----------DGCFSVGTILHELGHALGFWHEH   97 (191)
T ss_dssp             EEEEEE------------TTC-SHHHHHHHHHHHHTB--GG
T ss_pred             ceeEEec-----------ceeCCccchHHHHHHHHhhhhhh
Confidence            1123222           12334679999999999999964


No 14 
>PF01471 PG_binding_1:  Putative peptidoglycan binding domain;  InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure. PGBD may have a general peptidoglycan binding function, has a core structure consisting of a closed, three-helical bundle with a left-handed twist. It is found at the N or C terminus of a variety of enzymes involved in bacterial cell wall degradation [, , ]. Examples are:   Muramoyl-pentapeptide carboxypeptidase (3.4.17.8 from EC) N-acetylmuramoyl-L-alanine amidase cwlA precursor (cell wall hydrolase, autolysin, 3.5.1.28 from EC) Autolytic lysozyme (1,4-beta-N-acetylmuramidase, autolysin, 3.2.1.17 from EC) Membrane-bound lytic murein transglycosylase B Zinc-containing D-alanyl-D-alanine-cleaving carboxypeptidase, VanX [].   Many of the proteins having this domain are as yet uncharacterised. However, some are known to belong to MEROPS peptidase family M15 (clan MD), subfamily M15A metallopeptidases. A number of the proteins belonging to subfamily M15A are non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity. Eukaryotic enzymes can contain structurally similar PGBD-like domains. Matrix metalloproteinases (MMP), which catalyse extracellular matrix degradation, have N-terminal domains that resemble PGBD. Examples are gelatinase A (MMP-2), which degrades type IV collagen [], stromelysin-1 (MMP-3), which plays a role in arthritis and tumour invasion [, ], and gelatinase B (MMP-9) secreted by neutrophils as part of the innate immune defence mechanism []. Several MMPs are implicated in cancer progression, since degradation of the extracellular matrix is an essential step in the cascade of metastasis [].; GO: 0008152 metabolic process; PDB: 1L6J_A 3BKH_A 3BKV_A 1GXD_A 1EAK_D 1CK7_A 1SLM_A 1LBU_A 1SU3_B.
Probab=99.40  E-value=5.9e-13  Score=94.09  Aligned_cols=56  Identities=29%  Similarity=0.460  Sum_probs=49.4

Q ss_pred             hhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhh
Q 037265           43 VKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTM  115 (305)
Q Consensus        43 ~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m  115 (305)
                      +++|..+|.+|.++||++.                 ..++.|++.+++||++||+.+||++||++|.+|+++|
T Consensus         2 ~~~v~~lq~~L~~~gy~~~-----------------~~~g~~~~~t~~Av~~fQ~~~gL~~tG~~d~~T~~~L   57 (57)
T PF01471_consen    2 GPDVKALQQYLNRLGYYPG-----------------PVDGIFDPETREAVKAFQKANGLPVTGVVDPETWEAL   57 (57)
T ss_dssp             SHHHHHHHHHHHHTTTT-S-----------------STTSBSHHHHHHHHHHHHHHTTS-SSSSBCHHHHHHH
T ss_pred             cHHHHHHHHHHHHcCCCCC-----------------CCCCCcCHHHHHHHHHHHHHcCcCCCCccCHHHHhcC
Confidence            5678999999999999965                 3467899999999999999999999999999999886


No 15 
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=99.38  E-value=5.2e-12  Score=111.59  Aligned_cols=99  Identities=23%  Similarity=0.414  Sum_probs=66.2

Q ss_pred             CCCCCCCcceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeec
Q 037265          150 GPRWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFS  229 (305)
Q Consensus       150 g~kW~~~k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~  229 (305)
                      ..+|+  +..|-|.|...-....+..|++|++.|++.++|+|++..+ ...  .|.|..+..| ++++.|.-+.-.+   
T Consensus         7 ~~~Wp--~~~VpY~i~~~~~~~~~~~I~~Am~~~~~~TCirF~~r~~-~~~--yi~f~~~~~G-C~S~vG~~~~g~q---   77 (200)
T cd04281           7 ERIWP--GGVIPYVIDGNFTGSQRAMFKQAMRHWENFTCVTFVERTP-EEN--YIVFTYRPCG-CCSYVGRRGNGPQ---   77 (200)
T ss_pred             cCcCC--CCEEEEEECCCCCHHHHHHHHHHHHHHHhCCceEEEECCC-CCC--EEEEEECCCC-eeEcCCCcCCCce---
Confidence            47999  8899999976544356678999999999999999998764 233  4455443334 3455554220000   


Q ss_pred             CCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          230 DPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       230 P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                          .+.        ++.   +.....+++|||||||||.|..
T Consensus        78 ----~is--------l~~---~C~~~Gti~HEl~HaLGf~HEh  105 (200)
T cd04281          78 ----AIS--------IGK---NCDKFGIVVHELGHVIGFWHEH  105 (200)
T ss_pred             ----eee--------cCC---CcCcCchHHHHHHHHhcCcchh
Confidence                122        221   2334579999999999999964


No 16 
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=99.26  E-value=5.8e-11  Score=106.92  Aligned_cols=95  Identities=21%  Similarity=0.317  Sum_probs=64.7

Q ss_pred             CCCCCCcceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecC
Q 037265          151 PRWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSD  230 (305)
Q Consensus       151 ~kW~~~k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P  230 (305)
                      .+|+  + .|-|.|...-....+..|++|++.|++.|+++|++.+.. ..  .|.|..+ .| +|++-|..|        
T Consensus        44 ~~Wp--~-~VPY~i~~~~~~~~~~~I~~Am~~~~~~TCirF~~rt~e-~~--yi~i~~~-~G-C~S~vG~~g--------  107 (230)
T cd04282          44 YRWP--F-PIPYILDDSLDLNAKGVILKAFEMYRLKSCVDFKPYEGE-SN--YIFFFKG-SG-CWSMVGDQQ--------  107 (230)
T ss_pred             cCCC--c-ceeEEECCCCCHHHHHHHHHHHHHHHhCCCeeEEECCCC-Cc--EEEEEcC-CC-eeeccCccC--------
Confidence            6999  6 899999876444667789999999999999999987642 33  3455543 23 344544322        


Q ss_pred             CcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          231 PYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       231 ~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      ..-.+.        ++   .++....+++|||||||||.|..
T Consensus       108 g~q~is--------l~---~~C~~~Gti~HEl~HalGf~HEq  138 (230)
T cd04282         108 GGQNLS--------IG---AGCDYKATVEHEFLHALGFYHEQ  138 (230)
T ss_pred             CeEEEE--------EC---CCcCCCchHHHHHHHHhCCcccc
Confidence            011232        22   13344689999999999999964


No 17 
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=99.20  E-value=1.3e-10  Score=101.16  Aligned_cols=92  Identities=20%  Similarity=0.267  Sum_probs=59.6

Q ss_pred             ceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEE
Q 037265          158 KTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHF  237 (305)
Q Consensus       158 ~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihf  237 (305)
                      -+|-|.|+..-....++.|++|++.|++.++|+|++.+. ...-|  .|..+ .| ++++-|..|.        .-.+.+
T Consensus         4 ~~IpY~i~~~~~~~~~~~I~~A~~~~~~~TCirF~~~~~-~~~yi--~~~~~-~g-C~S~vG~~gg--------~q~i~l   70 (182)
T cd04283           4 VYVPYVISPQYSENERAVIEKAMQEFETLTCVRFVPRTT-ERDYL--NIESR-SG-CWSYIGRQGG--------RQTVSL   70 (182)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHhCCceeeEECCC-CCcEE--EEEcC-CC-ceEecCccCC--------ceeEec
Confidence            468899976544456788999999999999999998763 23344  44432 23 3444443220        011222


Q ss_pred             ccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          238 NGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       238 d~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      .          ..+.....+++|||||||||.|..
T Consensus        71 ~----------~~~C~~~G~i~HEl~HaLG~~HEh   95 (182)
T cd04283          71 Q----------KQGCMYKGIIQHELLHALGFYHEQ   95 (182)
T ss_pred             C----------CCCcCccchHHHHHHHHhCCcccc
Confidence            1          113344679999999999999974


No 18 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=99.10  E-value=6.3e-10  Score=90.07  Aligned_cols=123  Identities=20%  Similarity=0.286  Sum_probs=72.0

Q ss_pred             eeEEeecCCCChhhHHHHHHHHHHhhc-cCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEE
Q 037265          159 TVTYAFQPGTRDDIHEPVRVALLLWSN-WAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHF  237 (305)
Q Consensus       159 ~LtY~i~~~~~~~~~~~i~~A~~~Ws~-~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihf  237 (305)
                      +|+|.-...  .+.+.+|.+|.+.|+. |.+++|.+..   .++|+|.-...          +++..+..--...|.|.+
T Consensus         3 tv~Ydas~A--~~f~~~i~~aa~iWN~sV~NV~L~~~s---~a~~~~~~~~~----------~~~sya~~~g~G~G~I~l   67 (132)
T PF02031_consen    3 TVYYDASRA--PEFRSAIAQAAQIWNSSVSNVRLVEGS---SADIRYYEGND----------PRGSYASTDGLGSGYIFL   67 (132)
T ss_dssp             EEEEEEEE---GGGHHHHHHHHHHHHHH-SSEEEEE-S---S-SEEEEEE------------TT--EEEE-SSS-EEEEE
T ss_pred             EEEEeCCCC--chhHHHHHHHHHHHhcccCceEEeecC---CCcEEEEEecC----------CCCcccccCCCCcEEEEe
Confidence            456654332  2678899999999986 8999999976   48988765431          233333332234688988


Q ss_pred             ccccccccCCcCCcchhHHHHHHhhhhhcCCC-CCCCC-CCccccccCCCCCC--CCCHHHHHHHHHHhC
Q 037265          238 NGDVNWVMGTVKGGFDMQTVALHELGHVLGLS-HSSVK-AASMWPSTRAGTTK--GLNDDDIRRMKMLYG  303 (305)
Q Consensus       238 d~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~-Hs~~~-~svM~p~~~~~~~~--~l~~dDi~~iq~LYg  303 (305)
                      |..  +.     .+++-..|++|||||+|||. |-+-| .++|.-.-.+....  .....++..+.++|.
T Consensus        68 ~~~--~~-----qgy~~~RIaaHE~GHiLGLPD~y~GpCS~LMSG~~aG~sCtN~~Pna~E~a~V~~~~a  130 (132)
T PF02031_consen   68 DYQ--QN-----QGYNSTRIAAHELGHILGLPDHYPGPCSELMSGGSAGTSCTNAYPNAAERARVNSLFA  130 (132)
T ss_dssp             EHH--HH-----HHS-HHHHHHHHHHHHHT----TTS-TT-GGGTTTT-TT----S--HHHHHHHHHHCT
T ss_pred             chH--Hh-----hCCccceeeeehhccccCCCCCCCCccHHhhcCCCCCCCCCCCCCCHHHHHHHHHHhc
Confidence            842  21     25677889999999999994 44333 46787443322222  567789999999985


No 19 
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones]
Probab=99.06  E-value=9e-10  Score=107.53  Aligned_cols=98  Identities=24%  Similarity=0.344  Sum_probs=68.4

Q ss_pred             CCCCCCcceeEEeecCCCChhhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecC
Q 037265          151 PRWPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSD  230 (305)
Q Consensus       151 ~kW~~~k~~LtY~i~~~~~~~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P  230 (305)
                      .+|+  ...|.|.|...-....+..|+.||+.|++.|+++|.+..+. ..+..+.+..+  | ++++-|..|        
T Consensus        80 ~~Wp--~~~ipY~i~~~~~~~~r~~i~~A~~~~~~~TCi~F~~~~~~-~~~~~~~~~~~--g-C~S~VGr~g--------  145 (411)
T KOG3714|consen   80 RRWP--NGVIPYYIDGSFTSSQRALIRQAMREIENHTCIRFVERTTP-DKDYLIVFTGG--G-CYSYVGRRG--------  145 (411)
T ss_pred             hcCC--CCeeeeEECCCCCHHHHHHHHHHHHHHhhCcceEEEeCCCC-CcceEEEeCCC--c-ceeeeCccC--------
Confidence            8999  78999999987443667788999999999999999998743 34444444432  3 345555433        


Q ss_pred             CcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCC
Q 037265          231 PYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       231 ~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                       .+.      +.-+++   .+.....|++|||+||||+.|.+
T Consensus       146 -g~~------q~~sl~---~~C~~~G~i~HEl~HaLGf~Heh  177 (411)
T KOG3714|consen  146 -GGQ------QLLSLG---DGCDRFGTIVHELMHALGFWHEH  177 (411)
T ss_pred             -CCc------cceecC---CCcCcCchhHHHHHHHhhhhhcc
Confidence             111      112232   24455899999999999999964


No 20 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=98.80  E-value=8.5e-09  Score=89.97  Aligned_cols=124  Identities=21%  Similarity=0.273  Sum_probs=75.9

Q ss_pred             hhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCC----cceeeecC-CcceEEEcccccccc
Q 037265          171 DIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWH----TLGHAFSD-PYAVVHFNGDVNWVM  245 (305)
Q Consensus       171 ~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg----~laha~~P-~~G~ihfd~~e~w~~  245 (305)
                      ..++++-.|++.|++.-|+..+|-.  +.|||+|...+. -|.++  ++-+.    .++.-|+- ..|--|++....-.+
T Consensus       104 ~wq~a~~tava~wa~~fpl~ive~~--eeaDItie~~n~-pgtg~--~~~grArtal~~~efl~~~~~~~~lnhr~~i~~  178 (236)
T COG5549         104 RWQGAYLTAVAGWAKTFPLIIVERF--EEADITIEVGNP-PGTGW--RQYGRARTALIAYEFLGHALGLGHLNHRGDIMY  178 (236)
T ss_pred             hHHHHHHHHHHHHHHhCCceeeecc--eeeeEEEEecCC-CCCcc--cccchHHHHHHHHHHhhhccCcccccccccccC
Confidence            3467899999999999776666544  589999987653 22221  12111    01111111 112123332111111


Q ss_pred             CCcCCcchhHHHHHHhhhhhcCCC-CCCCCCCccccccCCCCCCCCCHHHHHHHHHHhC
Q 037265          246 GTVKGGFDMQTVALHELGHVLGLS-HSSVKAASMWPSTRAGTTKGLNDDDIRRMKMLYG  303 (305)
Q Consensus       246 ~~~~~~~~l~~Va~HEiGHaLGL~-Hs~~~~svM~p~~~~~~~~~l~~dDi~~iq~LYg  303 (305)
                      .......++..+|.||+|||||+. ||+- .++|.+..+   ...++..|+..++.+|-
T Consensus       179 ~pg~~~e~L~~tarhElGhaLgi~ghsd~-ks~aly~~s---~~~is~rdv~tL~r~Ye  233 (236)
T COG5549         179 PPGELRENLNPTARHELGHALGIWGHSDL-KSDALYGIS---WQGISRRDVKTLERKYE  233 (236)
T ss_pred             CcccchhhhhHHHHHhhcchheecccccc-hhhhhcchh---hcccCHHHHHHHHHHhc
Confidence            222344578999999999999997 8775 577765444   23599999999999995


No 21 
>TIGR02869 spore_SleB spore cortex-lytic enzyme. Members of this protein family are the spore cortex-lytic enzyme SleB from Bacillus subtilis and other Gram-positive, endospore-forming bacterial species. This protein is stored in an inactive form in the spore and activated during germination.
Probab=98.64  E-value=6.5e-08  Score=85.75  Aligned_cols=65  Identities=22%  Similarity=0.317  Sum_probs=58.6

Q ss_pred             CCCCCCchhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhh
Q 037265           36 GSQKGDKVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTM  115 (305)
Q Consensus        36 ~~~~g~~~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m  115 (305)
                      ..+.|+.+++|..+|..|...||...                 ..++.|+..+++||+.||+.+||+++|++|..|+..|
T Consensus         6 ~l~~G~~g~~V~~LQ~~L~~lG~~~g-----------------~idG~fg~~T~~AV~~FQ~~~GL~~dG~vg~~T~~~L   68 (201)
T TIGR02869         6 TYQRGSTGSDVIEIQRRLKAWGYYNG-----------------KVDGVFGWLTYWAVRKFQSKNGLTVDGIVGPKTKAAL   68 (201)
T ss_pred             cCCCCCCcHHHHHHHHHHHHcCCCCC-----------------CCCCccCHHHHHHHHHHHHHhCCCCCCCcCHHHHHHh
Confidence            35669999999999999999999875                 3367899999999999999999999999999999999


Q ss_pred             cc
Q 037265          116 AQ  117 (305)
Q Consensus       116 ~~  117 (305)
                      ..
T Consensus        69 ~~   70 (201)
T TIGR02869        69 GI   70 (201)
T ss_pred             CC
Confidence            43


No 22 
>PF11350 DUF3152:  Protein of unknown function (DUF3152);  InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function. Some are annotated as membrane proteins, however this cannot be confirmed.
Probab=98.23  E-value=6.5e-06  Score=72.14  Aligned_cols=115  Identities=23%  Similarity=0.243  Sum_probs=77.0

Q ss_pred             cceeEEeecCCCC---------hhhHHHHHHHH---HHhhccCcceEEecCCCCCccEEEEeecCCCCCCCC--CCCCCC
Q 037265          157 KKTVTYAFQPGTR---------DDIHEPVRVAL---LLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTP--FDGPWH  222 (305)
Q Consensus       157 k~~LtY~i~~~~~---------~~~~~~i~~A~---~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~--fdG~gg  222 (305)
                      .+.++|.+.....         ++..+.|.+.+   +-|.....+.|..|... .+|++|...+...-+..+  .+-.  
T Consensus        28 ~~~~rY~VeVE~Gi~~~~~gg~~~fA~~V~~tL~DpRgW~~~g~~~F~rV~~~-~~Df~I~Lasp~T~~~lC~g~~~~--  104 (203)
T PF11350_consen   28 GRLYRYRVEVEDGIDVDAYGGDDAFAAMVDATLADPRGWTADGRVRFQRVDSG-APDFRISLASPGTTDRLCAGLDTS--  104 (203)
T ss_pred             CceEEEEEEEccCcCCcccccHHHHHHHHHHHhcCCCCCCcCCCEEEEECCCC-CCCEEEEECCcchhhhhccCcCcC--
Confidence            4789999974321         23444455555   34999899999999975 499999999865544322  2221  


Q ss_pred             cceeeecCCcceEEEccccccccCCcCCcc----hhHHHHHHhhhhhcCCCCCCCCC
Q 037265          223 TLGHAFSDPYAVVHFNGDVNWVMGTVKGGF----DMQTVALHELGHVLGLSHSSVKA  275 (305)
Q Consensus       223 ~laha~~P~~G~ihfd~~e~w~~~~~~~~~----~l~~Va~HEiGHaLGL~Hs~~~~  275 (305)
                      .....+.|..++|.+|.. .|..+....+-    ....|+-||+||+||-.|..-+.
T Consensus       105 ~e~SC~~~~g~~VvIN~~-RWv~Ga~~f~gdl~~YRqYvINHEVGH~LGh~H~~Cpg  160 (203)
T PF11350_consen  105 GETSCRNPAGGRVVINLA-RWVRGAPAFGGDLASYRQYVINHEVGHALGHGHEPCPG  160 (203)
T ss_pred             ceeEeecCCCCeEEEehH-HhhccCcccCCcHHHHHHHhhhhhhhhhcccCCCcCCC
Confidence            123444555678877764 58876533322    34679999999999999987643


No 23 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=97.82  E-value=0.00011  Score=64.25  Aligned_cols=48  Identities=23%  Similarity=0.242  Sum_probs=35.3

Q ss_pred             hhHHHHHHhhhhhcCCCCCCCC----------CCccccccCCCCCCCCCHHHHHHHHH
Q 037265          253 DMQTVALHELGHVLGLSHSSVK----------AASMWPSTRAGTTKGLNDDDIRRMKM  300 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~~----------~svM~p~~~~~~~~~l~~dDi~~iq~  300 (305)
                      ....|++||+||.|||.|....          +-||.|.........++...+..|+.
T Consensus       132 ~~~~~~aHElGH~lG~~HD~~~~~~~~c~~~~~~IM~~~~~~~~~~~FS~CS~~~i~~  189 (192)
T cd04267         132 LTALTMAHELGHNLGAEHDGGDELAFECDGGGNYIMAPVDSGLNSYRFSQCSIGSIRE  189 (192)
T ss_pred             eehhhhhhhHHhhcCCcCCCCCCccccCCCCCCeEEcccccCCCCCccChhhHHHHHH
Confidence            4567999999999999997652          24899876531234788887777764


No 24 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=97.79  E-value=2.9e-05  Score=69.09  Aligned_cols=48  Identities=21%  Similarity=0.190  Sum_probs=33.1

Q ss_pred             hHHHHHHhhhhhcCCCCCCCC--------------CCccccccCCCCCCCCCHHHHHHHHHHh
Q 037265          254 MQTVALHELGHVLGLSHSSVK--------------AASMWPSTRAGTTKGLNDDDIRRMKMLY  302 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~~--------------~svM~p~~~~~~~~~l~~dDi~~iq~LY  302 (305)
                      ...+++|||||+|||.|..+.              .+||.+ ........++.-+|..|+...
T Consensus       137 ~~~~~aHEiGH~lGl~H~~~~~~~~~~~~~~~~~~~tIMsY-~~~~~~~~FS~~~i~~i~~~~  198 (206)
T PF13583_consen  137 GYQTFAHEIGHNLGLRHDFDYSGDPYSYAYECDSGQTIMSY-ASRPSRPYFSPPSIEYIREVV  198 (206)
T ss_pred             cchHHHHHHHHHhcCCCCcccCCCcccccccCCCCCEEeCC-CCCCCCCCCCchhHHHHhCCC
Confidence            347799999999999997532              368973 221222358888888886543


No 25 
>PRK10594 murein L,D-transpeptidase; Provisional
Probab=97.78  E-value=4e-05  Score=77.69  Aligned_cols=83  Identities=18%  Similarity=0.256  Sum_probs=59.5

Q ss_pred             CCCCCCchhcHHHHHHHHHhcCCCCCCC--CCC--Cc----cCC-------------------CCCCCCCCCCccchHHH
Q 037265           36 GSQKGDKVKGIHQLRKYLQSLGYVNQNN--IRP--SI----SLD-------------------NSDNESHIEDDYFGEDL   88 (305)
Q Consensus        36 ~~~~g~~~~~v~~~~~yL~~~GYl~~~~--~~~--~~----~~~-------------------~~~~~~~~~~~~~~~~~   88 (305)
                      ..+.|+...+|..+.+.|...|++....  ..+  ..    .++                   +...+....+..|++++
T Consensus       234 ~LrpG~~~~~V~~LR~RL~~~G~l~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~YD~~L  313 (608)
T PRK10594        234 TLRPGQWSNDVPALREILQRTGMLDGGPKITLPGDDTPTDAVVSPSAVTVETAETKPMDKQTTSRSKPAPAVRAAYDNEL  313 (608)
T ss_pred             CCCCCCCCchHHHHHHHHHHcCCcccccccccccccccccccccccccccccccccccccccccccccccccccccCHHH
Confidence            4677999999999999999999985310  000  00    000                   00000011245699999


Q ss_pred             HHHHHHHHHhcCCCccccCCHHhhhhhccC
Q 037265           89 ESAIKTYQINFNLNATGTLDLQTISTMAQP  118 (305)
Q Consensus        89 ~~Ai~~fQ~~~gL~~TG~lD~~T~~~m~~P  118 (305)
                      .+|||+||+.+||.++|+++..|+..|+.|
T Consensus       314 v~AVK~FQ~rhGL~~DGvIG~~T~~~LNvs  343 (608)
T PRK10594        314 VEAVKRFQAWQGLGADGVIGPRTRDWLNVT  343 (608)
T ss_pred             HHHHHHHHHHcCCCCCcCcCHHHHHHHcCC
Confidence            999999999999999999999999998755


No 26 
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=97.61  E-value=0.0001  Score=65.38  Aligned_cols=119  Identities=22%  Similarity=0.243  Sum_probs=68.4

Q ss_pred             HHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEEccccccccCCcCCcch
Q 037265          174 EPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWVMGTVKGGFD  253 (305)
Q Consensus       174 ~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihfd~~e~w~~~~~~~~~~  253 (305)
                      ...-+.|..|.......-.  ......|+.+-+...+....   ++++++++.|+..   .+. .......+.. ..+..
T Consensus        70 ~~~L~~F~~w~~~~~~~~~--~~~~~~D~a~llt~~d~~~~---~~~~~~~G~A~~g---giC-~~~~s~~i~~-~~~~~  139 (207)
T cd04273          70 QKSLKSFCRWQKKLNPPND--SDPEHHDHAILLTRQDICRS---NGNCDTLGLAPVG---GMC-SPSRSCSINE-DTGLS  139 (207)
T ss_pred             HHHHHHHHHHHHHcCCccc--ccccccceEEEEeeeccccc---CCCCCceEEeccc---cCC-CCCcceEEEc-CCCce
Confidence            3346789999763322110  11236787777765433221   4567777777642   111 0000111111 12334


Q ss_pred             hHHHHHHhhhhhcCCCCCCC---------CCCccccccCCC-CCCCCCHHHHHHHHHHh
Q 037265          254 MQTVALHELGHVLGLSHSSV---------KAASMWPSTRAG-TTKGLNDDDIRRMKMLY  302 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~---------~~svM~p~~~~~-~~~~l~~dDi~~iq~LY  302 (305)
                      ...|++|||||.||+.|-.+         .+-||+|..... ....++..-+..++.+.
T Consensus       140 ~a~~~aHElGH~LG~~HD~~~~~C~~~~~~~~IM~~~~~~~~~~~~fS~CS~~~~~~~l  198 (207)
T cd04273         140 SAFTIAHELGHVLGMPHDGDGNSCGPEGKDGHIMSPTLGANTGPFTWSKCSRRYLTSFL  198 (207)
T ss_pred             eEEeeeeechhhcCCCCCCCCCCCCCCCCCceeecccccCCCCCCCcCHHHHHHHHHHH
Confidence            56799999999999999865         268999987642 23367777777666543


No 27 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=97.48  E-value=6e-05  Score=64.12  Aligned_cols=24  Identities=33%  Similarity=0.541  Sum_probs=15.7

Q ss_pred             cchhHHHHHHhhhhhcCCCCCCCC
Q 037265          251 GFDMQTVALHELGHVLGLSHSSVK  274 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLGL~Hs~~~  274 (305)
                      ..+...|++||+||-|||.|....
T Consensus        66 ~~~~g~TltHEvGH~LGL~HtF~~   89 (154)
T PF05572_consen   66 QYNFGKTLTHEVGHWLGLYHTFGG   89 (154)
T ss_dssp             TS-SSHHHHHHHHHHTT---TT--
T ss_pred             ccccccchhhhhhhhhcccccccC
Confidence            445679999999999999998643


No 28 
>COG1913 Predicted Zn-dependent proteases [General function prediction only]
Probab=97.45  E-value=5.9e-05  Score=64.62  Aligned_cols=28  Identities=46%  Similarity=0.583  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhhcCCCCCCCCCCccccc
Q 037265          254 MQTVALHELGHVLGLSHSSVKAASMWPS  281 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~~~svM~p~  281 (305)
                      ...=++||+||+|||.|=+++.=||++.
T Consensus       124 v~KEv~HElGH~~GL~HC~N~~CVM~FS  151 (181)
T COG1913         124 VVKEVLHELGHLLGLSHCPNPRCVMNFS  151 (181)
T ss_pred             HHHHHHHHhhhhcCcccCCCCCcEEeCC
Confidence            3556899999999999999999999954


No 29 
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane]
Probab=97.45  E-value=0.0002  Score=61.58  Aligned_cols=66  Identities=20%  Similarity=0.343  Sum_probs=57.5

Q ss_pred             CCCCCchhcHHHHHHHHHhcCCCC-CCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCC-CccccCCHHhhhh
Q 037265           37 SQKGDKVKGIHQLRKYLQSLGYVN-QNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNL-NATGTLDLQTIST  114 (305)
Q Consensus        37 ~~~g~~~~~v~~~~~yL~~~GYl~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL-~~TG~lD~~T~~~  114 (305)
                      ...+..+..|..+|.-|.+.||.. .                 ..++.|+..+..||+.||+.+|| +++|+++.+|+..
T Consensus        39 ~~~~~~~~~v~~lq~~L~~~g~~~~~-----------------~~dg~~g~~t~~av~~fQ~~~gl~~~dG~~g~~t~~a  101 (185)
T COG3409          39 LTLGAEGPSVRILQAALNALGYYPDG-----------------VIDGVYGPETAAAVRAFQQKNGLSPVDGIVGPATRAA  101 (185)
T ss_pred             cccCCCCchHHHHHHHHHhcCCCCCC-----------------CccCccCcccHHHHHHHhhhcCcccccccccHHHHHH
Confidence            344667889999999999999998 4                 44788999999999999999999 8999999999999


Q ss_pred             hccCc
Q 037265          115 MAQPR  119 (305)
Q Consensus       115 m~~PR  119 (305)
                      +....
T Consensus       102 l~~~~  106 (185)
T COG3409         102 LPSQL  106 (185)
T ss_pred             HHHHh
Confidence            87643


No 30 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=97.32  E-value=8.2e-05  Score=64.37  Aligned_cols=48  Identities=23%  Similarity=0.252  Sum_probs=19.2

Q ss_pred             hHHHHHHhhhhhcCCCCCCCC-------------CCccccccCCCCCCCCCHHHHHHHHHHh
Q 037265          254 MQTVALHELGHVLGLSHSSVK-------------AASMWPSTRAGTTKGLNDDDIRRMKMLY  302 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~~-------------~svM~p~~~~~~~~~l~~dDi~~iq~LY  302 (305)
                      -..|++|||||.||+.|..+.             ..||++.... ....+++.-|..|+.+-
T Consensus       111 ~~~~~aHElGH~lGa~Hd~~~~~~~~~~~~~~sg~~IMsy~~~~-~~~~fS~cS~~~i~~~l  171 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHDFDNGCNPGSPTCPGSGGYIMSYAGIC-NNDKFSPCSIRQIRAVL  171 (173)
T ss_dssp             HHHHHHHHHHHHHT---SSSS----SS--T-STTT-TT-SS-GG-GG---------------
T ss_pred             eeeeehhhhHhhcCCCCCCCCCCCCCCCcCCCCCCEEEeeCCCC-CCccccccccccccccc
Confidence            467899999999999998654             2789855221 22378888888877653


No 31 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=97.24  E-value=0.0002  Score=62.35  Aligned_cols=27  Identities=37%  Similarity=0.503  Sum_probs=24.3

Q ss_pred             hHHHHHHhhhhhcCCCCCCCCCCcccc
Q 037265          254 MQTVALHELGHVLGLSHSSVKAASMWP  280 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~~~svM~p  280 (305)
                      +..+++||+||.|||.|-.++.-+|+.
T Consensus       125 ~~k~~~HElGH~lGL~HC~~~~CvM~~  151 (179)
T PRK13267        125 VRKEVTHELGHTLGLEHCDNPRCVMNF  151 (179)
T ss_pred             HHHHHHHHHHHHcCCccCCCCCccCCC
Confidence            456799999999999999999999994


No 32 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=97.10  E-value=0.00019  Score=58.01  Aligned_cols=18  Identities=44%  Similarity=0.672  Sum_probs=12.6

Q ss_pred             hHHHHHHhhhhhcCCCCC
Q 037265          254 MQTVALHELGHVLGLSHS  271 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs  271 (305)
                      ...|++|||||.|||.|+
T Consensus       107 ~~~~~~HEiGH~lGl~Hd  124 (124)
T PF13582_consen  107 GVDTFAHEIGHNLGLNHD  124 (124)
T ss_dssp             STTHHHHHHHHHTT----
T ss_pred             cceEeeehhhHhcCCCCC
Confidence            348999999999999995


No 33 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=97.06  E-value=0.00026  Score=61.86  Aligned_cols=23  Identities=30%  Similarity=0.494  Sum_probs=15.3

Q ss_pred             chhHHHHHHhhhhhcCCCCCCCC
Q 037265          252 FDMQTVALHELGHVLGLSHSSVK  274 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~Hs~~~  274 (305)
                      .....|++|||||.||+.|..+.
T Consensus       140 ~~~~~~~AHEiGH~lGa~HD~~~  162 (196)
T PF13688_consen  140 YNGAITFAHEIGHNLGAPHDGDY  162 (196)
T ss_dssp             HHHHHHHHHHHHHHTT-----SS
T ss_pred             CceehhhHHhHHHhcCCCCCCCC
Confidence            45678999999999999997664


No 34 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=97.04  E-value=0.00034  Score=61.59  Aligned_cols=28  Identities=39%  Similarity=0.531  Sum_probs=20.1

Q ss_pred             hhHHHHHHhhhhhcCCCCCCCCCCccccc
Q 037265          253 DMQTVALHELGHVLGLSHSSVKAASMWPS  281 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~~~svM~p~  281 (305)
                      .+..+++||+||.+||.|=.+ .-+|++.
T Consensus       144 R~~Kea~HElGH~~GL~HC~~-~CvM~~s  171 (194)
T PF07998_consen  144 RVCKEAVHELGHLFGLDHCEN-RCVMNFS  171 (194)
T ss_dssp             HHHHHHHHHHHHHTT----SS-TSTTS--
T ss_pred             HHHHHHHHHHHHHcCCcCCCC-CCccCCC
Confidence            356899999999999999999 9999965


No 35 
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=97.01  E-value=0.00066  Score=61.36  Aligned_cols=47  Identities=28%  Similarity=0.395  Sum_probs=35.2

Q ss_pred             HHHHHhhhhhcCCCCCCCC-------------------------CCccccccCCCCCCCCCHHHHHHHHHHhC
Q 037265          256 TVALHELGHVLGLSHSSVK-------------------------AASMWPSTRAGTTKGLNDDDIRRMKMLYG  303 (305)
Q Consensus       256 ~Va~HEiGHaLGL~Hs~~~-------------------------~svM~p~~~~~~~~~l~~dDi~~iq~LYg  303 (305)
                      .|++|||||.||+.|=.+.                         .=||+|.... ....++..-+..|+.+..
T Consensus       147 ~t~AHElGHnLGm~HD~~~~~C~~~~~~~~~~Cp~~~~~C~~~~~~IM~~~~~~-~~~~FS~CS~~~~~~~l~  218 (228)
T cd04271         147 QVFAHEIGHTFGAVHDCTSGTCSDGSVGSQQCCPLSTSTCDANGQYIMNPSSSS-GITEFSPCTIGNICSLLG  218 (228)
T ss_pred             eehhhhhhhhcCCCCCCCCCccccccccccccCCCcccccCCCCCEEeecCcCC-CCCccChhhHHHHHHHHh
Confidence            6999999999999995431                         1299998654 344788888888877653


No 36 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=96.99  E-value=0.00094  Score=58.39  Aligned_cols=48  Identities=25%  Similarity=0.382  Sum_probs=32.7

Q ss_pred             hhHHHHHHhhhhhcCCCCCC------CCCCccccccCCCCCCCCCHHHHHHHHHH
Q 037265          253 DMQTVALHELGHVLGLSHSS------VKAASMWPSTRAGTTKGLNDDDIRRMKML  301 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~------~~~svM~p~~~~~~~~~l~~dDi~~iq~L  301 (305)
                      ....|++|||||.||+.|-.      ..+-||+|.... ....++..-+.-++.+
T Consensus       130 ~~a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~-~~~~fS~CS~~~~~~~  183 (194)
T cd04269         130 LFAVTMAHELGHNLGMEHDDGGCTCGRSTCIMAPSPSS-LTDAFSNCSYEDYQKF  183 (194)
T ss_pred             HHHHHHHHHHHhhcCCCcCCCCCCCCCCCeEecCCCCC-CCCCCChhhHHHHHHH
Confidence            44689999999999999953      246799987653 2335665555444443


No 37 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=96.91  E-value=0.00019  Score=64.76  Aligned_cols=25  Identities=36%  Similarity=0.604  Sum_probs=21.2

Q ss_pred             cchhHHHHHHhhhhhcCCCCCCCCC
Q 037265          251 GFDMQTVALHELGHVLGLSHSSVKA  275 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLGL~Hs~~~~  275 (305)
                      ..++-.|++||+||.|||.|+...+
T Consensus       134 ~~n~g~t~~HEvGH~lGL~HtF~~~  158 (225)
T cd04275         134 PYNLGDTATHEVGHWLGLYHTFQGG  158 (225)
T ss_pred             cccccceeEEeccceeeeeeeecCC
Confidence            4577789999999999999987554


No 38 
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=96.70  E-value=0.0031  Score=62.71  Aligned_cols=66  Identities=20%  Similarity=0.263  Sum_probs=55.2

Q ss_pred             CCCCCchhcHHHHHHHHHhcCC-CCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhh
Q 037265           37 SQKGDKVKGIHQLRKYLQSLGY-VNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTM  115 (305)
Q Consensus        37 ~~~g~~~~~v~~~~~yL~~~GY-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m  115 (305)
                      .+.|+...+|..+.+-|..-|- ++..               ......|+.++.+|||+||+.+||+.+|+++..|++.|
T Consensus       232 LrpG~~~~~v~aL~~~L~~~~~d~~~a---------------~~~s~~yd~el~~avKrfQ~~~GL~~DGviG~~T~~aL  296 (561)
T COG2989         232 LRPGVTSPDVPALRARLARSGMDLPSA---------------AGSSPAYDPELVEAVKRFQARHGLPADGVIGPATRAAL  296 (561)
T ss_pred             cCCCCCchhHHHHHHHHHhcCccchhh---------------ccCcccccHHHHHHHHHHHHHhCCCCCCcccHHHHHHh
Confidence            5779999999999999999885 2220               12244789999999999999999999999999999999


Q ss_pred             cc
Q 037265          116 AQ  117 (305)
Q Consensus       116 ~~  117 (305)
                      +-
T Consensus       297 n~  298 (561)
T COG2989         297 NV  298 (561)
T ss_pred             cc
Confidence            64


No 39 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=96.46  E-value=0.0046  Score=54.26  Aligned_cols=50  Identities=24%  Similarity=0.453  Sum_probs=32.0

Q ss_pred             chhHHHHHHhhhhhcCCCCCCC--------CCCccccccCCCCCCCCCHHHHHHHHHH
Q 037265          252 FDMQTVALHELGHVLGLSHSSV--------KAASMWPSTRAGTTKGLNDDDIRRMKML  301 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~Hs~~--------~~svM~p~~~~~~~~~l~~dDi~~iq~L  301 (305)
                      ..+-.+++|||||.||+.|-..        ..-||.|...+.....++..-+..++.+
T Consensus       129 ~~~a~~~AHelGH~lGm~HD~~~~C~C~~~~~cIM~~~~~~~~~~~fS~CS~~~~~~~  186 (199)
T PF01421_consen  129 LSFAVIIAHELGHNLGMPHDGDNGCKCPRRDGCIMSPSIGPSSSDKFSNCSRRQFEEF  186 (199)
T ss_dssp             HHHHHHHHHHHHHHTT---TTTCTHCSSSSSSSTTSSSSSSSSTSSS-HHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCCCCCCCCcCCcCCCCCccccccccCCCCCCcCHHHHHHHHHH
Confidence            4556899999999999999655        4678999655333336777666666544


No 40 
>COG3023 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane]
Probab=96.36  E-value=0.007  Score=55.02  Aligned_cols=55  Identities=24%  Similarity=0.487  Sum_probs=47.6

Q ss_pred             chhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCC-CccccCCHHhhhhh
Q 037265           42 KVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNL-NATGTLDLQTISTM  115 (305)
Q Consensus        42 ~~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL-~~TG~lD~~T~~~m  115 (305)
                      +..+|..+|..|.+|||-.+                 .  +.|++.++.+|+.||.-|+= ..+|+.|.+|...+
T Consensus       196 ~~~~v~~lq~~L~~YGY~v~-----------------~--~~~d~~t~~vv~aFQ~hfrp~~~dg~~d~et~a~l  251 (257)
T COG3023         196 KGEDVAALQEMLARYGYGVE-----------------I--GVFDQETQQVVRAFQMHFRPGLYDGEADVETIAIL  251 (257)
T ss_pred             ccCCHHHHHHHHHHhCcCCC-----------------c--chhhHHHHHHHHHHHHHhCCCCCCCCCChHHHHHH
Confidence            34889999999999999876                 2  46799999999999998875 48999999998875


No 41 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=96.16  E-value=0.0079  Score=54.89  Aligned_cols=48  Identities=23%  Similarity=0.373  Sum_probs=33.1

Q ss_pred             hHHHHHHhhhhhcCCCCCCC-----C------CCccccccCCC---CCCCCCHHHHHHHHHH
Q 037265          254 MQTVALHELGHVLGLSHSSV-----K------AASMWPSTRAG---TTKGLNDDDIRRMKML  301 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~-----~------~svM~p~~~~~---~~~~l~~dDi~~iq~L  301 (305)
                      ...|++|||||.||+.|-..     +      .=||+|.-..+   ....++..-+..++.+
T Consensus       167 ~a~t~AHElGHnlGm~HD~~~~~C~~~~~~~~~cIM~~~~~~~~~~~~~~FS~CS~~~~~~~  228 (244)
T cd04270         167 SDLVTAHELGHNFGSPHDPDIAECAPGESQGGNYIMYARATSGDKENNKKFSPCSKKSISKV  228 (244)
T ss_pred             HHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCceEecCccccCCCCCCCCCCHhHHHHHHHH
Confidence            34799999999999999554     1      34899875321   1236777766666543


No 42 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=96.06  E-value=0.0073  Score=54.02  Aligned_cols=49  Identities=18%  Similarity=0.184  Sum_probs=33.0

Q ss_pred             hhHHHHHHhhhhhcCCCCCCC------------------CCCccccccCCCCCCCCCHHHHHHHHHH
Q 037265          253 DMQTVALHELGHVLGLSHSSV------------------KAASMWPSTRAGTTKGLNDDDIRRMKML  301 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~------------------~~svM~p~~~~~~~~~l~~dDi~~iq~L  301 (305)
                      ....+++||+||.||+.|-.+                  .+-||.+.........++..-+.-++.+
T Consensus       144 ~~~~~~AHElGH~lG~~HD~~~~~~~~~~~~~~~~C~~~~~~IM~~~~~~~~~~~fS~CS~~~~~~~  210 (220)
T cd04272         144 YGVYTMTHELAHLLGAPHDGSPPPSWVKGHPGSLDCPWDDGYIMSYVVNGERQYRFSQCSQRQIRNV  210 (220)
T ss_pred             ccHHHHHHHHHHHhCCCCCCCCCCccCCCCCccCcCCCCCCeEEeeccCCCCCCccCcchHHHHHHH
Confidence            446899999999999999422                  2468997643222236777666666544


No 43 
>PF08823 PG_binding_2:  Putative peptidoglycan binding domain;  InterPro: IPR014927 This entry may be a peptidoglycan binding domain. 
Probab=95.65  E-value=0.031  Score=41.63  Aligned_cols=57  Identities=19%  Similarity=0.342  Sum_probs=44.6

Q ss_pred             chhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCC----ccccCCHHhhhhh
Q 037265           42 KVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLN----ATGTLDLQTISTM  115 (305)
Q Consensus        42 ~~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~----~TG~lD~~T~~~m  115 (305)
                      ..+-+.++|.-|++.||+..                 ..++.+++++++|++.|+..-++.    ..|++|..+++.|
T Consensus        14 ~~~~~~evq~~L~~lGyy~g-----------------~~~g~~d~a~~~Al~~~~g~ENfE~R~~~~~~ID~~VL~~L   74 (74)
T PF08823_consen   14 DGDVAREVQEALKRLGYYKG-----------------EADGVWDEATEDALRAWAGTENFEERIRGDGKIDPVVLAYL   74 (74)
T ss_pred             cHHHHHHHHHHHHHcCCccC-----------------CCCCcccHHHHHHHHHHHHHhhHHhhcCCCCccCHHHHhhC
Confidence            35556789999999999987                 235678999999999999888774    4556887776543


No 44 
>PF11150 DUF2927:  Protein of unknown function (DUF2927);  InterPro: IPR021323  This family is conserved in Proteobacteria. Several members are described as being putative lipoproteins, but otherwise the function is not known. 
Probab=94.82  E-value=0.92  Score=40.64  Aligned_cols=146  Identities=18%  Similarity=0.122  Sum_probs=81.3

Q ss_pred             CCCCCCcceeEEeecCCCCh---hhHHHHHHHHHHhhccCcceEEecCCCCCccEEEEeecCCCC---------CCCCCC
Q 037265          151 PRWPLTKKTVTYAFQPGTRD---DIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHG---------DGTPFD  218 (305)
Q Consensus       151 ~kW~~~k~~LtY~i~~~~~~---~~~~~i~~A~~~Ws~~~~l~F~ev~~~~~adI~I~f~~~~hg---------d~~~fd  218 (305)
                      .||.   ..++.++....+.   ...+.+..-++.-+.++.+.+..++.. +|+|.|.|...+..         ...++.
T Consensus        28 ~Rw~---~PVrv~v~~~~~~~~~~d~~~v~~~~~rL~~itg~~I~~~~~~-~aN~~v~~~~~~~~~~~ir~~~p~~~~~~  103 (213)
T PF11150_consen   28 RRWE---GPVRVRVEGVPPADRARDLARVRAYLARLRRITGHPISQVSSP-NANFHVIFVSEDDWRPRIRRLLPGAACFV  103 (213)
T ss_pred             ccCC---CCeEEEEeccChhhHHHHHHHHHHHHhhhccccCCceeeccCC-CCcEEEEEeccchhhHHHHHhcccccccc
Confidence            7997   4688888733322   223445555777788899999888865 89999999876551         111111


Q ss_pred             CC--------CCcceeeecCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCC-CCC-CCCCccccccCCCCCC
Q 037265          219 GP--------WHTLGHAFSDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLS-HSS-VKAASMWPSTRAGTTK  288 (305)
Q Consensus       219 G~--------gg~laha~~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~-Hs~-~~~svM~p~~~~~~~~  288 (305)
                      -+        ..-+..++....+.+.....-- .+........+...+..||-++|||. .|. ...||-+--   ....
T Consensus       104 ~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~vi-~i~~~~~~~~~~~Ci~EElaQ~LGl~NDs~~~~pSIFNDd---~~~~  179 (213)
T PF11150_consen  104 VPNFSSLPRYARCLVFARSNWSGEITRARAVI-FIRADHPPQERRDCIHEELAQGLGLPNDSPRARPSIFNDD---NEFA  179 (213)
T ss_pred             chhhhcccccceEEEEEEecCCCceEEEEEEE-EEeccCCchHHHHHHHHHHHHHcCCccCCCcCCCceeeCC---Cccc
Confidence            10        0001111111111111100000 01111123356788889999999994 332 233443311   2234


Q ss_pred             CCCHHHHHHHHHHhCC
Q 037265          289 GLNDDDIRRMKMLYGR  304 (305)
Q Consensus       289 ~l~~dDi~~iq~LYg~  304 (305)
                      .|+.-|..-|+.||-+
T Consensus       180 ~LT~~D~lLLr~LYdP  195 (213)
T PF11150_consen  180 LLTGFDELLLRMLYDP  195 (213)
T ss_pred             cccHHHHHHHHHHcCc
Confidence            8899999999999975


No 45 
>PF05548 Peptidase_M11:  Gametolysin peptidase M11;  InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M11 (gametolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The type example is gametolysin from the unicellular biflagellated alga, Chlamydomonas reinhardtii Gametolysin is a zinc-containing metallo-protease, which is responsible for the degradation of the cell wall. Homologues of gametolysin have also been reported in the simple multicellular organism, Volvox [, ].
Probab=94.32  E-value=0.023  Score=53.83  Aligned_cols=19  Identities=47%  Similarity=0.697  Sum_probs=16.9

Q ss_pred             hHHHHHHhhhhhcCCCCCC
Q 037265          254 MQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~  272 (305)
                      -..|++||+||-|||.|+.
T Consensus       150 ~~~~~~HElgHN~GL~Ha~  168 (314)
T PF05548_consen  150 DWATIMHELGHNLGLWHAG  168 (314)
T ss_pred             cHHHHHHHhhhhccccccC
Confidence            3569999999999999995


No 46 
>PF01457 Peptidase_M8:  Leishmanolysin This Prosite motif covers only the active site. This is family M8 in the peptidase classification. ;  InterPro: IPR001577 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M8 (leishmanolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.   Leishmanolysin is an enzyme found in the eukaryotes including Leishmania and related parasitic protozoa []. The endopeptidase is the most abundant protein on the cell surface during the promastigote stage of the parasite, and is attached to the membrane by a glycosylphosphatidylinositol anchor []. In the amastigote form, the parasite lives in lysosomes of host macrophages, producing a form of the protease that has an acidic pH optimum []. This differs from most other metalloproteases and may be an adaptation to the environment in which the organism survives [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0007155 cell adhesion, 0016020 membrane; PDB: 1LML_A.
Probab=94.10  E-value=0.047  Score=55.26  Aligned_cols=60  Identities=23%  Similarity=0.256  Sum_probs=30.4

Q ss_pred             CccEEEEeecCCCCCCCCCCCCCCcceeee--------cCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCC
Q 037265          199 NADIKISFQRGDHGDGTPFDGPWHTLGHAF--------SDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSH  270 (305)
Q Consensus       199 ~adI~I~f~~~~hgd~~~fdG~gg~laha~--------~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~H  270 (305)
                      ++|+.|.....+.+        .+++|.|.        .|..|.|.|+...   +... ....+..|++|||.|+||+.-
T Consensus       159 ~~D~vlyV~~~~~~--------~~~~A~A~~C~~~~~~RP~~G~in~~p~~---i~~~-~~~~~~~~~~HEi~HaLGFs~  226 (521)
T PF01457_consen  159 NADFVLYVTARPSS--------SSTLAWAAPCQQDSDGRPIAGVININPSY---IPSF-YFQEFFRTVIHEIAHALGFSS  226 (521)
T ss_dssp             S-SEEEEEE----S--------TT---EEEEEEE-TTS-EEEEEEE--GGG------S---HHHHHHHHHHHHHHTT-SH
T ss_pred             CccEEEEEEEeecc--------CCceEEEeehhhccCCCCeeEEEEEchhH---ccch-hhhcccceeeeeeeeeeeecc
Confidence            67877765543222        25666664        2556888887643   2111 223567899999999999976


No 47 
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane]
Probab=94.02  E-value=0.13  Score=43.97  Aligned_cols=61  Identities=28%  Similarity=0.407  Sum_probs=49.3

Q ss_pred             CCchhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhhc
Q 037265           40 GDKVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTMA  116 (305)
Q Consensus        40 g~~~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m~  116 (305)
                      +.....+..++.-+...+|....                ..++.|+..++.|++.||+.++|+++|+....|...+.
T Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~~----------------~~dg~fg~~t~~~v~~~q~~~~l~~dgi~g~~t~~~l~  184 (185)
T COG3409         124 GLGGGDVATLQQPLPLLGYRSGI----------------RVDGIFGPQTEAAVKAFQRQYGLTVDGIVGPQTWAALR  184 (185)
T ss_pred             cccccchHHHHHHHHhcccccCC----------------CCCCcccHHHHHHHHHHHHHhCCCCCeeecHHHHHHhh
Confidence            44455566677777777777651                36889999999999999999999999999999987763


No 48 
>PF10462 Peptidase_M66:  Peptidase M66;  InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of metallopeptidases belonging to MEROPS peptidase family M66 (StcE peptidase, clan MA). The StcE peptidase is a virulence factor found in Shiga toxigenic Escherichia coli strains. StcE peptidase cleaves C1 esterase inhibitor []. The SwissProt proteins in this entry have been name "Dictomallein". ; GO: 0004222 metalloendopeptidase activity; PDB: 3UJZ_A.
Probab=94.01  E-value=0.026  Score=53.06  Aligned_cols=21  Identities=38%  Similarity=0.637  Sum_probs=15.2

Q ss_pred             chhHHHHHHhhhhhcCCCCCC
Q 037265          252 FDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      .....+++||+||++||.|..
T Consensus       191 ~s~~~~f~HE~GH~~GL~H~p  211 (305)
T PF10462_consen  191 YSYGNEFSHELGHNFGLGHYP  211 (305)
T ss_dssp             S-SHHHHHHHHHHTTT--SST
T ss_pred             cCccceeehhhhhhcCCCCCC
Confidence            345789999999999999943


No 49 
>PF12044 Metallopep:  Putative peptidase family;  InterPro: IPR021917  This family of proteins is functionally uncharacterised. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 625 to 773 amino acids in length. 
Probab=93.01  E-value=0.051  Score=53.38  Aligned_cols=24  Identities=33%  Similarity=0.529  Sum_probs=19.8

Q ss_pred             HHHHHHhhhhhcCCCCCCCCCCcccc
Q 037265          255 QTVALHELGHVLGLSHSSVKAASMWP  280 (305)
Q Consensus       255 ~~Va~HEiGHaLGL~Hs~~~~svM~p  280 (305)
                      ....+|||||++||.|..+  -||--
T Consensus       317 iGA~lHEiGH~fg~pH~~~--GIM~R  340 (423)
T PF12044_consen  317 IGAFLHEIGHLFGCPHQED--GIMLR  340 (423)
T ss_pred             hHHHHHHHHHhcCCCCCCC--CeeeC
Confidence            4578999999999999876  67743


No 50 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=93.01  E-value=0.33  Score=43.12  Aligned_cols=109  Identities=22%  Similarity=0.274  Sum_probs=59.7

Q ss_pred             HHHHHHHHHhhccCcce--EEecC---------CCCCccEEEEeecCCC-CCCCC-CCCC--CCc--ceeeecC------
Q 037265          174 EPVRVALLLWSNWAPFT--FEGSN---------DYENADIKISFQRGDH-GDGTP-FDGP--WHT--LGHAFSD------  230 (305)
Q Consensus       174 ~~i~~A~~~Ws~~~~l~--F~ev~---------~~~~adI~I~f~~~~h-gd~~~-fdG~--gg~--laha~~P------  230 (305)
                      ..+..|++.|++-++..  |.++.         +...++++|.|..+-. ..+.+ |.+.  ..+  .+. ++|      
T Consensus        49 ~dl~~aLaq~e~sgn~gdyfsQv~tspv~~L~~S~f~v~v~irwpq~l~n~~~ap~wq~a~~tava~wa~-~fpl~ive~  127 (236)
T COG5549          49 EDLEKALAQWENSGNGGDYFSQVETSPVGYLIWSEFPVDVRIRWPQNLENVEGAPRWQGAYLTAVAGWAK-TFPLIIVER  127 (236)
T ss_pred             ccHHHHHHHHHhcCCcccccceecccccceeecccCcceeeecccccccccccchhHHHHHHHHHHHHHH-hCCceeeec
Confidence            45899999999876543  44332         2346788888876322 11111 1110  000  111 244      


Q ss_pred             -CcceEEEccccccccCCcC-CcchhHHHHHHhhhhhcCCCCCCCCCCccccccC
Q 037265          231 -PYAVVHFNGDVNWVMGTVK-GGFDMQTVALHELGHVLGLSHSSVKAASMWPSTR  283 (305)
Q Consensus       231 -~~G~ihfd~~e~w~~~~~~-~~~~l~~Va~HEiGHaLGL~Hs~~~~svM~p~~~  283 (305)
                       +..||.....+.=..+-.. .......++-|++||++||+|.+....||+|.+.
T Consensus       128 ~eeaDItie~~n~pgtg~~~~grArtal~~~efl~~~~~~~~lnhr~~i~~~pg~  182 (236)
T COG5549         128 FEEADITIEVGNPPGTGWRQYGRARTALIAYEFLGHALGLGHLNHRGDIMYPPGE  182 (236)
T ss_pred             ceeeeEEEEecCCCCCcccccchHHHHHHHHHHhhhccCcccccccccccCCccc
Confidence             1234443322110111111 1223456788999999999999999999987765


No 51 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=92.19  E-value=0.038  Score=51.57  Aligned_cols=19  Identities=47%  Similarity=0.538  Sum_probs=16.3

Q ss_pred             HHHHHHhhhhhcCCCCCCC
Q 037265          255 QTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       255 ~~Va~HEiGHaLGL~Hs~~  273 (305)
                      ..|++||+||.|||.+--+
T Consensus       166 igv~~HE~gH~lGLPDlY~  184 (286)
T TIGR03296       166 VGVIAHELGHDLGLPDLYD  184 (286)
T ss_pred             eeeeehhhhcccCCCcccc
Confidence            6899999999999987543


No 52 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=91.83  E-value=0.16  Score=45.56  Aligned_cols=36  Identities=33%  Similarity=0.580  Sum_probs=21.9

Q ss_pred             ecCCcceEEEccccccccCCcCCcchh--HHHHHHhhhhhcCCCCCC
Q 037265          228 FSDPYAVVHFNGDVNWVMGTVKGGFDM--QTVALHELGHVLGLSHSS  272 (305)
Q Consensus       228 ~~P~~G~ihfd~~e~w~~~~~~~~~~l--~~Va~HEiGHaLGL~Hs~  272 (305)
                      |.|.+-.+.+..+.       .++.++  ..||+||.|||  +-|..
T Consensus        68 YdP~~k~vrLS~~v-------y~~~SiaAvaVAAHEvGHA--iQ~a~  105 (222)
T PF04298_consen   68 YDPRNKVVRLSEDV-------YNGRSIAAVAVAAHEVGHA--IQHAE  105 (222)
T ss_pred             cCCCCCEEEeCCcc-------CCCCCHHHHHHHHHHHhHH--Hhccc
Confidence            34555556554432       223343  68999999999  45554


No 53 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=91.58  E-value=0.064  Score=43.39  Aligned_cols=19  Identities=42%  Similarity=0.718  Sum_probs=16.0

Q ss_pred             chhHHHHHHhhhhhcCCCC
Q 037265          252 FDMQTVALHELGHVLGLSH  270 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~H  270 (305)
                      --...|++|||||-.||+-
T Consensus       107 d~vthvliHEIgHhFGLsD  125 (136)
T COG3824         107 DQVTHVLIHEIGHHFGLSD  125 (136)
T ss_pred             hHhhhhhhhhhhhhcCCCh
Confidence            3467899999999999964


No 54 
>PTZ00337 surface protease GP63; Provisional
Probab=90.95  E-value=0.22  Score=50.83  Aligned_cols=36  Identities=33%  Similarity=0.360  Sum_probs=25.8

Q ss_pred             CCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCC
Q 037265          230 DPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHS  271 (305)
Q Consensus       230 P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs  271 (305)
                      |..|.|.|+....   ..   ......|++|||.||||+..+
T Consensus       211 Pi~G~in~np~~i---~~---~~~~~~v~~HEi~HALGFs~~  246 (567)
T PTZ00337        211 PFAAAVNFDPRQI---AV---TNGDVRVAAHELGHALGFVRD  246 (567)
T ss_pred             ceEEEEEECHHHc---cc---hhHHHHHHHHHHHHHHccCHH
Confidence            6678888886431   11   235678999999999999653


No 55 
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional
Probab=89.93  E-value=0.41  Score=49.14  Aligned_cols=62  Identities=19%  Similarity=0.152  Sum_probs=37.3

Q ss_pred             CCccEEEEeecCCCCCCCCCCCCCCcceeee--------cCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCC
Q 037265          198 ENADIKISFQRGDHGDGTPFDGPWHTLGHAF--------SDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLS  269 (305)
Q Consensus       198 ~~adI~I~f~~~~hgd~~~fdG~gg~laha~--------~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~  269 (305)
                      .++|+.|.....+.+        .+++|-|.        .|..|.|.|+....   .+ ........|++|||.|+||+.
T Consensus       204 ~naD~vLYVta~P~~--------~~~lA~A~~C~~~~d~RPi~G~iNinp~~i---~s-~~~~~~~rv~~HEi~HALGFS  271 (622)
T PTZ00257        204 SNADFVLYVASVPSE--------PGVLAWATTCQVFSDDHPAVGVMNIPAANI---VS-RYDQGTTRTVTHEVAHALGFS  271 (622)
T ss_pred             cccCEEEEEEEecCC--------CCeeEEEEEeccccCCCceEEEEeeCHHHC---CC-ccchHHHHHHHHHHHHHhcCC
Confidence            367777665543221        24444443        36678888875431   11 112246799999999999996


Q ss_pred             CC
Q 037265          270 HS  271 (305)
Q Consensus       270 Hs  271 (305)
                      -+
T Consensus       272 ~~  273 (622)
T PTZ00257        272 SV  273 (622)
T ss_pred             HH
Confidence            43


No 56 
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=88.62  E-value=0.51  Score=41.50  Aligned_cols=76  Identities=18%  Similarity=0.183  Sum_probs=39.4

Q ss_pred             HHHHHHHHHhhccCc---ceEEecCC-----CCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEEcccccccc
Q 037265          174 EPVRVALLLWSNWAP---FTFEGSND-----YENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWVM  245 (305)
Q Consensus       174 ~~i~~A~~~Ws~~~~---l~F~ev~~-----~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihfd~~e~w~~  245 (305)
                      ..+..+++.|++|..   ++=.||..     ..--|+.+.-..             |.|..-|-|..-.+.+.... +. 
T Consensus        22 ~kvks~y~KySkV~~s~g~TGaevAr~iLd~nGl~dV~Ve~v~-------------G~LTDHYDP~~kvvrLSe~~-y~-   86 (226)
T COG2738          22 SKVKSTYKKYSKVRASSGLTGAEVARMILDENGLYDVPVEEVP-------------GTLTDHYDPRRKVVRLSEAN-YY-   86 (226)
T ss_pred             HHHHHHHHHHhhccCcCCCcHHHHHHHHHhhcCCccceeeeec-------------CCcccccChhhheeeccccc-cC-
Confidence            457889999999732   32223221     112244443322             34444445544444433221 10 


Q ss_pred             CCcCCcchhHHHHHHhhhhhcC
Q 037265          246 GTVKGGFDMQTVALHELGHVLG  267 (305)
Q Consensus       246 ~~~~~~~~l~~Va~HEiGHaLG  267 (305)
                         .....-..||+||.||++=
T Consensus        87 ---g~Sia~~aVAAHEVGHAiQ  105 (226)
T COG2738          87 ---GPSIAAIAVAAHEVGHAIQ  105 (226)
T ss_pred             ---CccHHHHHHHHHHhhHHHh
Confidence               1223447899999999964


No 57 
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=88.16  E-value=0.43  Score=44.81  Aligned_cols=36  Identities=22%  Similarity=0.421  Sum_probs=22.7

Q ss_pred             ecCCcceEEEccccccc-c----CCcCCcchhHHHHHHhhhhh
Q 037265          228 FSDPYAVVHFNGDVNWV-M----GTVKGGFDMQTVALHELGHV  265 (305)
Q Consensus       228 ~~P~~G~ihfd~~e~w~-~----~~~~~~~~l~~Va~HEiGHa  265 (305)
                      |-|.+..|.+|... |. +    +. ....-...|++||+||.
T Consensus       141 YCp~D~tIYlD~~f-~~~L~~~~ga-~G~~a~ayVlAHEyGHH  181 (292)
T PF04228_consen  141 YCPADQTIYLDLSF-FDELQQRFGA-SGDFAQAYVLAHEYGHH  181 (292)
T ss_pred             eCCCCCEEEechHH-HHHHHHHhCC-ccHHHHHHHHHHHHHHH
Confidence            34888899998652 11 1    11 12233467999999996


No 58 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=87.02  E-value=0.34  Score=44.83  Aligned_cols=20  Identities=35%  Similarity=0.742  Sum_probs=12.8

Q ss_pred             hhHHHHHHhhhhhcC-CCCCC
Q 037265          253 DMQTVALHELGHVLG-LSHSS  272 (305)
Q Consensus       253 ~l~~Va~HEiGHaLG-L~Hs~  272 (305)
                      ....|++||+||++| |+-.-
T Consensus       215 ~~~~v~vHE~GHsf~~LaDEY  235 (264)
T PF09471_consen  215 SFKQVVVHEFGHSFGGLADEY  235 (264)
T ss_dssp             THHHHHHHHHHHHTT------
T ss_pred             cccceeeeecccccccccccc
Confidence            578999999999665 55543


No 59 
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures]
Probab=86.60  E-value=0.42  Score=49.09  Aligned_cols=48  Identities=19%  Similarity=0.344  Sum_probs=35.2

Q ss_pred             hHHHHHHhhhhhcCCCCCCC----------CCCccccccCCCC---CCCCCHHHHHHHHHH
Q 037265          254 MQTVALHELGHVLGLSHSSV----------KAASMWPSTRAGT---TKGLNDDDIRRMKML  301 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~----------~~svM~p~~~~~~---~~~l~~dDi~~iq~L  301 (305)
                      ..-|++|||||..|=.|-++          -+=|||++-..++   .+++++.-+..|...
T Consensus       392 s~lt~AHEiGHNfGSpHDp~~ECsPg~~~~GnyiM~a~AtSGd~~NN~kFSpCS~ksI~~V  452 (764)
T KOG3658|consen  392 SDLTLAHEIGHNFGSPHDPDIECSPGESQGGNYIMYAYATSGDKPNNKKFSPCSLKSISKV  452 (764)
T ss_pred             hheeehhhhccccCCCCCCCCccCCCCCCCCcEEEEEecccCcCccCcccCcchHHHHHHH
Confidence            35689999999999999654          2348999876543   237888888777643


No 60 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=85.94  E-value=0.45  Score=37.30  Aligned_cols=16  Identities=31%  Similarity=0.731  Sum_probs=12.9

Q ss_pred             hHHHHHHhhhhhcCCC
Q 037265          254 MQTVALHELGHVLGLS  269 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~  269 (305)
                      +..|++|||||.+|++
T Consensus        73 I~~tlvhEiah~fG~~   88 (97)
T PF06262_consen   73 IRDTLVHEIAHHFGIS   88 (97)
T ss_dssp             HHHHHHHHHHHHTT--
T ss_pred             HHHHHHHHHHHHcCCC
Confidence            4789999999999985


No 61 
>PF05547 Peptidase_M6:  Immune inhibitor A peptidase M6;  InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M6 (immune inhibitor A family, clan MA(M)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  InhA of Bacillus thuringiensis (an entomopathogenic bacterium) specifically cleaves antibacterial peptides produced by insect hosts []. B. thuringiensis is highly resistant to the insect immune system due to its production of two factors, inhibitor A (InhA or InA) and inhibitor B (InhB or InB), which selectively block the humoral defence system developed by insects against Escherichia coli and Bacillus cereus []. B. thuringiensis is especially resistant to cecropins and attacins, which are the main classes of inducible antibacterial peptides in various lepidopterans and dipterans [], []. InhA has been shown to specifically hydrolyze cecropins and attacins in the immune hemolymph of Hyalophora cecropia (Cecropia moth) in vitro []. However, it has been suggested that the role of InhA in resistance to the humoral defence system is not consistent with the time course of InhA production []. B. thuringiensis has two proteins belonging to this group (InhA and InhA2), and it has been shown that InhA2 has a vital role in virulence when the host is infected via the oral route []. The B. cereus member has been found as an exosporium component from endospores []. B. thuringiensis InhA is induced at the onset of sporulation and is regulated by Spo0A and AbrB []. Vibrio cholerae PrtV is thought to be encoded in the pathogenicity island []. However, PrtV mutants did not exhibit a reduced virulence phenotype, and thus PrtV is not an indispensable virulence factor []. Annotation note: due to the presence of PKD repeats in some of the members of this group (e.g., V. cholerae VCA0223), spurious similarity hits may appear (involving unrelated proteins), which may lead to the erroneous transfer of functional annotations and protein names. Also, please note that related Bacillus subtilis Bacillopeptidase F (Bpr or Bpf) contains two different protease domains: N-terminal IPR000209 from INTERPRO (peptidase S8, subtilase, a subtilisin-like serine protease) and this C-terminal domain (peptidase M6), which may also complicate annotation.; GO: 0008233 peptidase activity, 0006508 proteolysis
Probab=85.44  E-value=0.15  Score=52.67  Aligned_cols=18  Identities=44%  Similarity=0.519  Sum_probs=15.0

Q ss_pred             hHHHHHHhhhhhcCCCCC
Q 037265          254 MQTVALHELGHVLGLSHS  271 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs  271 (305)
                      -..|++||+||.|||.--
T Consensus       221 giGVfaHEfGH~LGLPDl  238 (645)
T PF05547_consen  221 GIGVFAHEFGHDLGLPDL  238 (645)
T ss_pred             ceEEEEeeccccCCCCCc
Confidence            367999999999999643


No 62 
>KOG4525 consensus Jacalin-like lectin domain-containing protein [General function prediction only]
Probab=85.39  E-value=0.55  Score=45.98  Aligned_cols=26  Identities=38%  Similarity=0.524  Sum_probs=20.2

Q ss_pred             HHHHHHhhhhhcCCCCCCCCCCcccccc
Q 037265          255 QTVALHELGHVLGLSHSSVKAASMWPST  282 (305)
Q Consensus       255 ~~Va~HEiGHaLGL~Hs~~~~svM~p~~  282 (305)
                      ...++|||||.||+.|-+  .-||--.|
T Consensus       302 lGA~~HElGH~lgcpHq~--~GvMlrgy  327 (614)
T KOG4525|consen  302 LGAVCHELGHCLGCPHQS--EGVMLRGY  327 (614)
T ss_pred             HHHHHHHhhhccCCCCCC--CceEecCc
Confidence            567899999999999976  46784333


No 63 
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=85.20  E-value=0.48  Score=46.97  Aligned_cols=35  Identities=26%  Similarity=0.313  Sum_probs=22.4

Q ss_pred             cceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCC
Q 037265          232 YAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSH  270 (305)
Q Consensus       232 ~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~H  270 (305)
                      +|.|.++..-.-+.   .+...+-.|++|||||+.| .|
T Consensus       111 Gg~v~vntGLll~a---e~esElagViAHEigHv~q-rH  145 (484)
T COG4783         111 GGYVVVNTGLLLTA---ENESELAGVIAHEIGHVAQ-RH  145 (484)
T ss_pred             CceEEEehHHHHhc---CCHHHHHHHHHHHHHHHhh-hh
Confidence            45555554332222   2345899999999999976 44


No 64 
>PF09374 PG_binding_3:  Predicted Peptidoglycan domain;  InterPro: IPR018537  This family contains a potential peptidoglycan binding domain. ; PDB: 2IKB_B 2IS5_A 2NR7_A.
Probab=84.50  E-value=0.84  Score=33.65  Aligned_cols=26  Identities=23%  Similarity=0.374  Sum_probs=20.5

Q ss_pred             HHHHHHHHhcC----CCccccCCHHhhhhh
Q 037265           90 SAIKTYQINFN----LNATGTLDLQTISTM  115 (305)
Q Consensus        90 ~Ai~~fQ~~~g----L~~TG~lD~~T~~~m  115 (305)
                      .|++.+|+..|    +.++|++.+.|+.++
T Consensus         1 rAik~LQ~alg~~~~v~~DG~iGp~Tl~Al   30 (72)
T PF09374_consen    1 RAIKFLQRALGLGADVAVDGIIGPKTLAAL   30 (72)
T ss_dssp             HHHHHHHHHHT----S--SS--SHHHHHHH
T ss_pred             CHHHHHHHHHccCCccCCCCCcCHHHHHHH
Confidence            38999999999    999999999999998


No 65 
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones]
Probab=84.31  E-value=1.1  Score=47.03  Aligned_cols=45  Identities=27%  Similarity=0.384  Sum_probs=28.2

Q ss_pred             hhHHHHHHhhhhhcCCCCCCC-------CCCccccccCCCC-CCCCCHHHHHHH
Q 037265          253 DMQTVALHELGHVLGLSHSSV-------KAASMWPSTRAGT-TKGLNDDDIRRM  298 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~-------~~svM~p~~~~~~-~~~l~~dDi~~i  298 (305)
                      ....|++|||||.||+.|-..       ..=|| +.+.... ...++..-++.+
T Consensus       322 ~~a~v~AhelgH~lGm~hD~~~c~C~~~~~CiM-~~~~~~~~~~~FS~CS~~~~  374 (716)
T KOG3607|consen  322 AFAVVLAHELGHNLGMIHDESSCSCPSSGLCIM-PEETGFYIPKKFSNCSYQDF  374 (716)
T ss_pred             hHHHHHHHHHHhhcCcccccccccCCCCCcccc-ccccCcCcccccccchHHHH
Confidence            456899999999999999762       23467 5554222 225554444433


No 66 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=78.53  E-value=1  Score=34.95  Aligned_cols=15  Identities=40%  Similarity=0.556  Sum_probs=12.4

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      .....+++|||||.+
T Consensus        40 ~~~~f~laHELgH~~   54 (122)
T PF06114_consen   40 ERQRFTLAHELGHIL   54 (122)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            355789999999985


No 67 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=78.48  E-value=1.1  Score=40.42  Aligned_cols=14  Identities=43%  Similarity=0.693  Sum_probs=12.2

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      .+..|+.||+||+|
T Consensus        91 ~~~~~l~HE~GHAl  104 (220)
T PF14247_consen   91 NVLFTLYHELGHAL  104 (220)
T ss_pred             HHHHHHHHHHHHHH
Confidence            56889999999985


No 68 
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=76.34  E-value=1.3  Score=39.05  Aligned_cols=16  Identities=44%  Similarity=0.796  Sum_probs=13.1

Q ss_pred             chhHHHHHHhhhhhcC
Q 037265          252 FDMQTVALHELGHVLG  267 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLG  267 (305)
                      ..+..|+.||+||++-
T Consensus        20 ~~~l~t~~HE~gHal~   35 (200)
T PF13398_consen   20 FRLLVTFVHELGHALA   35 (200)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3567899999999974


No 69 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=73.70  E-value=1.5  Score=39.36  Aligned_cols=32  Identities=28%  Similarity=0.346  Sum_probs=20.0

Q ss_pred             cceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCC
Q 037265          232 YAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       232 ~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      ...|+++...        ....-.-|++||+||+  |-|...
T Consensus        58 ~~~I~iN~n~--------~~~r~rFtlAHELGH~--llH~~~   89 (213)
T COG2856          58 KPVIYINANN--------SLERKRFTLAHELGHA--LLHTDL   89 (213)
T ss_pred             CceEEEeCCC--------CHHHHHHHHHHHHhHH--Hhcccc
Confidence            3566666532        1223457999999999  556554


No 70 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=73.22  E-value=1.9  Score=37.84  Aligned_cols=21  Identities=33%  Similarity=0.458  Sum_probs=16.4

Q ss_pred             cchhHHHHHHhhhhhcCCCCCC
Q 037265          251 GFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      ...+..|++||+||.. ..|..
T Consensus        86 ~~el~aVlaHElgH~~-~~h~~  106 (226)
T PF01435_consen   86 EDELAAVLAHELGHIK-HRHIL  106 (226)
T ss_dssp             HHHHHHHHHHHHHHHH-TTHCC
T ss_pred             HHHHHHHHHHHHHHHH-cCCcc
Confidence            3478999999999997 45543


No 71 
>PRK03982 heat shock protein HtpX; Provisional
Probab=70.67  E-value=2.3  Score=39.69  Aligned_cols=16  Identities=31%  Similarity=0.453  Sum_probs=13.6

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..++..|++||+||.-
T Consensus       122 ~~El~AVlAHElgHi~  137 (288)
T PRK03982        122 EDELEGVIAHELTHIK  137 (288)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3479999999999984


No 72 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=70.27  E-value=2.3  Score=39.19  Aligned_cols=16  Identities=38%  Similarity=0.659  Sum_probs=13.8

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ...+..|+.||+||..
T Consensus       154 ~dEl~aVlaHElgHi~  169 (302)
T COG0501         154 DDELEAVLAHELGHIK  169 (302)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3478999999999984


No 73 
>PRK03001 M48 family peptidase; Provisional
Probab=68.59  E-value=2.7  Score=39.11  Aligned_cols=16  Identities=38%  Similarity=0.511  Sum_probs=13.7

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..++..|++||+||.-
T Consensus       121 ~~El~aVlAHElgHi~  136 (283)
T PRK03001        121 EREIRGVMAHELAHVK  136 (283)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3578999999999974


No 74 
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=68.59  E-value=2.6  Score=36.74  Aligned_cols=12  Identities=50%  Similarity=0.825  Sum_probs=10.4

Q ss_pred             HHHHHHhhhhhc
Q 037265          255 QTVALHELGHVL  266 (305)
Q Consensus       255 ~~Va~HEiGHaL  266 (305)
                      ..|++||+||.+
T Consensus        10 ~~v~iHElGH~~   21 (182)
T cd06163          10 ILIFVHELGHFL   21 (182)
T ss_pred             HHHHHHHHHHHH
Confidence            579999999975


No 75 
>PRK03072 heat shock protein HtpX; Provisional
Probab=68.10  E-value=2.8  Score=39.22  Aligned_cols=17  Identities=35%  Similarity=0.462  Sum_probs=14.1

Q ss_pred             cchhHHHHHHhhhhhcC
Q 037265          251 GFDMQTVALHELGHVLG  267 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLG  267 (305)
                      ..++..|++||+||.-.
T Consensus       124 ~~El~aVlAHElgHi~~  140 (288)
T PRK03072        124 ERELRGVLGHELSHVYN  140 (288)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            35799999999999743


No 76 
>PF12725 DUF3810:  Protein of unknown function (DUF3810);  InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=67.92  E-value=3.6  Score=39.07  Aligned_cols=38  Identities=21%  Similarity=0.354  Sum_probs=27.9

Q ss_pred             ecCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCC
Q 037265          228 FSDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       228 ~~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      +.|-.|+.+.|.+-        ....+-.|++||++|-+|......
T Consensus       178 y~PFT~EA~vN~~~--------p~~~~P~T~~HElAHq~G~a~E~E  215 (318)
T PF12725_consen  178 YNPFTGEANVNTDL--------PPYSLPFTICHELAHQLGFASEDE  215 (318)
T ss_pred             EcCCcceeecCCCC--------CcccccHHHHHHHHHHhCCCCHHH
Confidence            45666777766543        235678899999999999998653


No 77 
>KOG3538 consensus Disintegrin metalloproteinases with thrombospondin repeats [Posttranslational modification, protein turnover, chaperones]
Probab=67.62  E-value=2.6  Score=45.24  Aligned_cols=35  Identities=29%  Similarity=0.392  Sum_probs=27.0

Q ss_pred             CcchhHHHHHHhhhhhcCCCCCCCCC------CccccccCC
Q 037265          250 GGFDMQTVALHELGHVLGLSHSSVKA------ASMWPSTRA  284 (305)
Q Consensus       250 ~~~~l~~Va~HEiGHaLGL~Hs~~~~------svM~p~~~~  284 (305)
                      .+.....+++||+||.+|+.|-...+      .||.|....
T Consensus       313 ~gl~~aftiahE~GH~~gm~hd~~~~~C~~~~~im~~~~~~  353 (845)
T KOG3538|consen  313 TGLPSAFTIAHELGHNFGMEHDGRGNSCGPTFHVMSSDTCG  353 (845)
T ss_pred             CCCccceeeeeccccccCcccCCcCCCCCCcccccCccccc
Confidence            34456689999999999999975543      589887764


No 78 
>PRK01345 heat shock protein HtpX; Provisional
Probab=67.53  E-value=2.9  Score=39.71  Aligned_cols=19  Identities=32%  Similarity=0.364  Sum_probs=15.4

Q ss_pred             chhHHHHHHhhhhhcCCCCC
Q 037265          252 FDMQTVALHELGHVLGLSHS  271 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~Hs  271 (305)
                      .++..|++|||||.- ..|.
T Consensus       122 dEL~aVlAHElgHi~-~~d~  140 (317)
T PRK01345        122 EEVAGVMAHELAHVK-NRDT  140 (317)
T ss_pred             HHHHHHHHHHHHHHH-cCCH
Confidence            478999999999986 3553


No 79 
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=66.29  E-value=3.1  Score=36.92  Aligned_cols=16  Identities=50%  Similarity=0.615  Sum_probs=12.7

Q ss_pred             hhHHHHHHhhhhhcCC
Q 037265          253 DMQTVALHELGHVLGL  268 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL  268 (305)
                      -+..|+.||+||++=-
T Consensus        37 l~~~v~iHElgH~~~A   52 (208)
T cd06161          37 LFLSVLLHELGHALVA   52 (208)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3568999999998643


No 80 
>PRK04897 heat shock protein HtpX; Provisional
Probab=64.10  E-value=3.7  Score=38.56  Aligned_cols=16  Identities=25%  Similarity=0.399  Sum_probs=13.7

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..++..|++||+||.-
T Consensus       134 ~~El~aVlAHElgHi~  149 (298)
T PRK04897        134 REELEGVIGHEISHIR  149 (298)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3578999999999974


No 81 
>PRK05457 heat shock protein HtpX; Provisional
Probab=63.83  E-value=3.4  Score=38.53  Aligned_cols=15  Identities=27%  Similarity=0.534  Sum_probs=13.2

Q ss_pred             cchhHHHHHHhhhhh
Q 037265          251 GFDMQTVALHELGHV  265 (305)
Q Consensus       251 ~~~l~~Va~HEiGHa  265 (305)
                      ..++..|++||+||.
T Consensus       131 ~~El~aVlAHElgHi  145 (284)
T PRK05457        131 RDEVEAVLAHEISHI  145 (284)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            357899999999996


No 82 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=63.63  E-value=5.4  Score=31.05  Aligned_cols=15  Identities=33%  Similarity=0.284  Sum_probs=12.6

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      ..+..|++||++|.+
T Consensus        23 ~~~~~~l~HE~~H~~   37 (128)
T PF13485_consen   23 DWLDRVLAHELAHQW   37 (128)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            346799999999996


No 83 
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=63.00  E-value=7.7  Score=37.01  Aligned_cols=16  Identities=38%  Similarity=0.702  Sum_probs=12.9

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..+-..++.||+||++
T Consensus       151 ~~~~v~tl~HE~GHa~  166 (365)
T cd06258         151 GHDDINTLFHEFGHAV  166 (365)
T ss_pred             CHHHHHHHHHHHhHHH
Confidence            3445688999999998


No 84 
>PRK02870 heat shock protein HtpX; Provisional
Probab=62.42  E-value=4.1  Score=39.04  Aligned_cols=15  Identities=40%  Similarity=0.620  Sum_probs=13.3

Q ss_pred             cchhHHHHHHhhhhh
Q 037265          251 GFDMQTVALHELGHV  265 (305)
Q Consensus       251 ~~~l~~Va~HEiGHa  265 (305)
                      ..++..|++||+||.
T Consensus       170 ~dEL~aVlAHELgHi  184 (336)
T PRK02870        170 RDELQAVMAHELSHI  184 (336)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            357899999999998


No 85 
>PRK02391 heat shock protein HtpX; Provisional
Probab=62.34  E-value=4.1  Score=38.24  Aligned_cols=15  Identities=40%  Similarity=0.581  Sum_probs=13.1

Q ss_pred             cchhHHHHHHhhhhh
Q 037265          251 GFDMQTVALHELGHV  265 (305)
Q Consensus       251 ~~~l~~Va~HEiGHa  265 (305)
                      ..++..|++||+||.
T Consensus       130 ~~El~aVlaHElgHi  144 (296)
T PRK02391        130 PDELEAVLAHELSHV  144 (296)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            357899999999996


No 86 
>PRK01265 heat shock protein HtpX; Provisional
Probab=62.15  E-value=4.2  Score=38.79  Aligned_cols=15  Identities=47%  Similarity=0.693  Sum_probs=13.0

Q ss_pred             cchhHHHHHHhhhhh
Q 037265          251 GFDMQTVALHELGHV  265 (305)
Q Consensus       251 ~~~l~~Va~HEiGHa  265 (305)
                      ..++..|++||+||.
T Consensus       137 ~~El~aVlAHElgHi  151 (324)
T PRK01265        137 RDEIKAVAGHELGHL  151 (324)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            357999999999995


No 87 
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=61.19  E-value=4.3  Score=36.58  Aligned_cols=16  Identities=50%  Similarity=0.700  Sum_probs=12.5

Q ss_pred             hHHHHHHhhhhhcCCC
Q 037265          254 MQTVALHELGHVLGLS  269 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~  269 (305)
                      +..|+.||+||++=-.
T Consensus        53 ~~~v~iHElgH~~~A~   68 (227)
T cd06164          53 FASVLLHELGHSLVAR   68 (227)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4689999999986433


No 88 
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=58.07  E-value=4.8  Score=39.06  Aligned_cols=15  Identities=40%  Similarity=0.576  Sum_probs=12.1

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      .+-..+++||+||++
T Consensus       220 ~~~v~tl~HE~GHa~  234 (427)
T cd06459         220 LDDVFTLAHELGHAF  234 (427)
T ss_pred             hhhHHHHHHHhhHHH
Confidence            344688999999985


No 89 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=57.71  E-value=9.3  Score=28.62  Aligned_cols=36  Identities=22%  Similarity=0.241  Sum_probs=21.8

Q ss_pred             eeeecCCcceEEEccccccccCCcCCcchhHHHHHHhhhhhc
Q 037265          225 GHAFSDPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVL  266 (305)
Q Consensus       225 aha~~P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaL  266 (305)
                      |.||. .+.+|+|..... .    .....-..+++||+.|++
T Consensus        38 A~A~T-~G~~I~f~~g~~-~----~~s~~~~~llaHEl~Hv~   73 (79)
T PF13699_consen   38 ARAFT-VGNDIYFAPGKY-N----PDSPEGRALLAHELAHVV   73 (79)
T ss_pred             CeEEE-ECCEEEEcCCCc-C----CCCCCcchhHhHHHHHHH
Confidence            44443 357888865431 1    122344688999999985


No 90 
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=57.49  E-value=4.9  Score=39.73  Aligned_cols=23  Identities=22%  Similarity=0.124  Sum_probs=15.9

Q ss_pred             HHHHHHHHHhhccCcceEEecCC
Q 037265          174 EPVRVALLLWSNWAPFTFEGSND  196 (305)
Q Consensus       174 ~~i~~A~~~Ws~~~~l~F~ev~~  196 (305)
                      ++++.-+...+.+-+|+|+++..
T Consensus       138 ~~~~g~~~l~~~lfgi~~~~~~~  160 (458)
T PF01432_consen  138 EVLEGLFELAERLFGIRFEEVPD  160 (458)
T ss_dssp             HHHHHHHHHHHHHHTEEEEECTC
T ss_pred             HHHHHHHHHHHHHhcEEEEeccc
Confidence            44555566777777888888764


No 91 
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=57.28  E-value=5.5  Score=37.13  Aligned_cols=14  Identities=29%  Similarity=0.596  Sum_probs=11.7

Q ss_pred             hHHHHHHhhhhhcC
Q 037265          254 MQTVALHELGHVLG  267 (305)
Q Consensus       254 l~~Va~HEiGHaLG  267 (305)
                      +..|++||+||++=
T Consensus       135 ~isvvvHElgHal~  148 (277)
T cd06162         135 LISGVVHEMGHGVA  148 (277)
T ss_pred             HHHHHHHHHHHHHH
Confidence            46899999999963


No 92 
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=57.12  E-value=5.6  Score=36.80  Aligned_cols=16  Identities=31%  Similarity=0.376  Sum_probs=12.4

Q ss_pred             hHHHHHHhhhhhcCCC
Q 037265          254 MQTVALHELGHVLGLS  269 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~  269 (305)
                      ...|++||+||++=-.
T Consensus       118 ~isv~iHElgHa~~Ar  133 (263)
T cd06159         118 VVGVVVHELSHGILAR  133 (263)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4679999999996443


No 93 
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits.  TOP has been shown to degrade peptides released by the proteasom
Probab=55.44  E-value=5.5  Score=39.80  Aligned_cols=14  Identities=43%  Similarity=0.743  Sum_probs=11.8

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      +-..|+.||+||+|
T Consensus       262 ~~V~TLfHEfGHal  275 (472)
T cd06455         262 DEVETFFHEFGHVI  275 (472)
T ss_pred             HHHHHHHHHHHHHH
Confidence            44678999999998


No 94 
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=55.21  E-value=7.8  Score=39.73  Aligned_cols=15  Identities=33%  Similarity=0.550  Sum_probs=12.4

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      .+-..|++||+||++
T Consensus       376 ~~dv~TLaHElGHa~  390 (591)
T TIGR00181       376 LNSVFTLAHELGHSM  390 (591)
T ss_pred             cchHHHHHHHhhhHH
Confidence            355789999999996


No 95 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=55.09  E-value=11  Score=38.45  Aligned_cols=15  Identities=33%  Similarity=0.366  Sum_probs=12.4

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      .+=..|++||+||++
T Consensus       335 ~~dv~TL~HElGHa~  349 (549)
T TIGR02289       335 SGDIDVLTHEAGHAF  349 (549)
T ss_pred             hhHHHHHHHHhhHHH
Confidence            345689999999997


No 96 
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=54.40  E-value=6.7  Score=34.21  Aligned_cols=21  Identities=33%  Similarity=0.659  Sum_probs=15.3

Q ss_pred             hHHHHHHhhhhhcCCCCCCCC
Q 037265          254 MQTVALHELGHVLGLSHSSVK  274 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~Hs~~~  274 (305)
                      +..+..||+||++--..-.++
T Consensus        41 ~~~l~iHElgH~~~A~~~G~~   61 (183)
T cd06160          41 LAILGIHEMGHYLAARRHGVK   61 (183)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC
Confidence            467889999999866544443


No 97 
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M3 family of metallopeptidases contains several distinct clades. Oligoendopeptidase F as characterized in Lactococcus, the functionally equivalent oligoendopeptidase B of group B Streptococcus, and closely related sequences are described by TIGR00181. The present family is quite similar but forms a distinct clade, and a number of species have one member of each. A greater sequence difference separates members of TIGR02289, probable oligoendopeptidases of the M3 family that probably should not be designated PepF.
Probab=52.99  E-value=5.9  Score=40.66  Aligned_cols=14  Identities=36%  Similarity=0.491  Sum_probs=11.8

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      +-..|++||+||++
T Consensus       374 ~~v~TL~HE~GHa~  387 (587)
T TIGR02290       374 RDVSTLAHELGHAY  387 (587)
T ss_pred             hhHHHHHHHhhHHH
Confidence            44678999999998


No 98 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=52.77  E-value=6.5  Score=33.22  Aligned_cols=12  Identities=42%  Similarity=0.493  Sum_probs=10.3

Q ss_pred             HHHHHHhhhhhc
Q 037265          255 QTVALHELGHVL  266 (305)
Q Consensus       255 ~~Va~HEiGHaL  266 (305)
                      .-|++|||+|.+
T Consensus       136 lDVvaHEltHGV  147 (150)
T PF01447_consen  136 LDVVAHELTHGV  147 (150)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             cceeeecccccc
Confidence            569999999974


No 99 
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=51.96  E-value=7.8  Score=34.43  Aligned_cols=16  Identities=31%  Similarity=0.549  Sum_probs=13.4

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..+...+|.||.||+|
T Consensus        25 ~~~~~~~A~HEAGhAv   40 (213)
T PF01434_consen   25 EEEKRRIAYHEAGHAV   40 (213)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3467899999999996


No 100
>PLN02791 Nudix hydrolase homolog
Probab=51.36  E-value=7.6  Score=41.26  Aligned_cols=21  Identities=19%  Similarity=0.183  Sum_probs=17.6

Q ss_pred             hhHHHHHHhhhhhcCCCCCCC
Q 037265          253 DMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      .+..|++||+||-+|=.+.-.
T Consensus       584 f~~~v~lHElgHGsG~~~~~~  604 (770)
T PLN02791        584 FFTHTICHECCHGIGPHTITL  604 (770)
T ss_pred             HHHHHHHHHhhccccccceec
Confidence            457999999999999977544


No 101
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3.4.24.59) belongs to the widespread subfamily M3A, that show similarity to the Thimet oligopeptidase (TOP). It is one of three peptidases responsible for the proteolytic processing of both, nuclear and mitochondrial encoded precursor polypeptides targeted to the various subcompartments of the mitochondria. It cleaves intermediate-size proteins initially processed by mitochondrial processing peptidase (MPP) to yield a processing intermediate with a typical N-terminal octapeptide that is sequentially cleaved by MIP to mature-size protein.  MIP cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tri-carboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism. It has been suggested that the human MIP (HMIP polypeptide; gene symbo
Probab=51.29  E-value=7  Score=38.92  Aligned_cols=31  Identities=10%  Similarity=-0.053  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhhccCcceEEecCC----CCCccEEE
Q 037265          174 EPVRVALLLWSNWAPFTFEGSND----YENADIKI  204 (305)
Q Consensus       174 ~~i~~A~~~Ws~~~~l~F~ev~~----~~~adI~I  204 (305)
                      ..++.-|..-+..-+|+|+++..    .-.+|++.
T Consensus       134 ~vl~gl~~~~~~lfgi~~~~~~~~~~~~Wh~dV~~  168 (458)
T cd06457         134 TVMEGLSRLFSRLYGIRLVPVPLAPGEVWHPDVRK  168 (458)
T ss_pred             HHHHHHHHHHHHHhCeEEEecCCCCCCCcCccceE
Confidence            33466667777888999999753    23456554


No 102
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70) enzyme. DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from E. coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called  peptidyl dipeptidase A). Oligopeptidase A (OpdA) may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala.
Probab=50.07  E-value=7.9  Score=38.18  Aligned_cols=15  Identities=47%  Similarity=0.727  Sum_probs=12.2

Q ss_pred             chhHHHHHHhhhhhc
Q 037265          252 FDMQTVALHELGHVL  266 (305)
Q Consensus       252 ~~l~~Va~HEiGHaL  266 (305)
                      .+-..++.||+||+|
T Consensus       206 ~~~v~tLfHEfGHal  220 (422)
T cd06456         206 HDEVTTLFHEFGHAL  220 (422)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344678999999998


No 103
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones]
Probab=49.29  E-value=8.2  Score=37.65  Aligned_cols=16  Identities=50%  Similarity=0.796  Sum_probs=12.5

Q ss_pred             hHHHHHHhhhhhcCCC
Q 037265          254 MQTVALHELGHVLGLS  269 (305)
Q Consensus       254 l~~Va~HEiGHaLGL~  269 (305)
                      +..+..||+||+|--.
T Consensus       131 vi~~vvHElGHalAA~  146 (484)
T KOG2921|consen  131 VITVVVHELGHALAAA  146 (484)
T ss_pred             HHHHHHHHhhHHHHHH
Confidence            4678899999997543


No 104
>PF08434 CLCA_N:  Calcium-activated chloride channel;  InterPro: IPR013642 The CLCA family of calcium-activated chloride channels has been identified in many epithelial and endothelial cell types as well as in smooth muscle cells [] and has four or five putative transmembrane regions. Additionally to their role as chloride channels some CLCA proteins function as adhesion molecules and may also have roles as tumour suppressors []. The domain described here is found at the N terminus of CLCAs. 
Probab=48.84  E-value=12  Score=34.50  Aligned_cols=63  Identities=25%  Similarity=0.440  Sum_probs=30.4

Q ss_pred             CCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcc-eEEEccccccccCCcC--CcchhHHHHHHhhhhh-cCC
Q 037265          197 YENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYA-VVHFNGDVNWVMGTVK--GGFDMQTVALHELGHV-LGL  268 (305)
Q Consensus       197 ~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G-~ihfd~~e~w~~~~~~--~~~~l~~Va~HEiGHa-LGL  268 (305)
                      ...|||+|.-....+||. ||.-..|-     --..| .|||..+..  ++...  .| ..-.|++||-+|. =|+
T Consensus        98 ~~~Adv~V~~~~~~~~d~-PyT~q~g~-----CGe~G~yIhltp~fl--~~~~~~~yG-~~grv~VhEWAhlRWGV  164 (262)
T PF08434_consen   98 YETADVRVASPNPKYGDE-PYTLQYGG-----CGEPGEYIHLTPDFL--LGDNLSQYG-PRGRVFVHEWAHLRWGV  164 (262)
T ss_pred             hcCCCEEEeCCCCCCCCC-CceecCCC-----CCCCCeeEEechhhh--cCCchhhcC-Ccceeeeehhhhhcccc
Confidence            468999996544334442 22111110     01123 477765432  21110  11 2357899999995 344


No 105
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=48.33  E-value=12  Score=32.39  Aligned_cols=43  Identities=23%  Similarity=0.213  Sum_probs=29.4

Q ss_pred             CCcceEEEccccccccCCcCCcchhHHHHHHhhhhhcCCCCCCCCCCc
Q 037265          230 DPYAVVHFNGDVNWVMGTVKGGFDMQTVALHELGHVLGLSHSSVKAAS  277 (305)
Q Consensus       230 P~~G~ihfd~~e~w~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~sv  277 (305)
                      +..|.|.||    |.+-. ....-+..|++||+-|..-..||..=-+.
T Consensus       145 ~~~~~I~ln----~~L~~-~P~~~idYVvvHEL~Hl~~~nHs~~Fw~~  187 (205)
T PF01863_consen  145 SSKGNITLN----WRLVM-APPEVIDYVVVHELCHLRHPNHSKRFWAL  187 (205)
T ss_pred             CCCCcEEee----ccccc-CCccHHHHHHHHHHHHhccCCCCHHHHHH
Confidence            346788887    33321 12345789999999999999999753333


No 106
>COG4227 Antirestriction protein [DNA replication, recombination, and repair]
Probab=47.89  E-value=12  Score=34.55  Aligned_cols=24  Identities=29%  Similarity=0.369  Sum_probs=18.4

Q ss_pred             CcchhHHHHHHhhhhhcCCCCCCC
Q 037265          250 GGFDMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       250 ~~~~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      +..+...++.||+||.-|=.+--+
T Consensus       199 da~~yyaTl~HElghwtgh~~rl~  222 (316)
T COG4227         199 DAINYYATLLHELGHWTGHEARLD  222 (316)
T ss_pred             chHhHHHHHHHHhccccCchhhhh
Confidence            456789999999999988655433


No 107
>PRK10779 zinc metallopeptidase RseP; Provisional
Probab=46.88  E-value=8.6  Score=38.18  Aligned_cols=12  Identities=33%  Similarity=0.731  Sum_probs=9.8

Q ss_pred             HHHHHHhhhhhc
Q 037265          255 QTVALHELGHVL  266 (305)
Q Consensus       255 ~~Va~HEiGHaL  266 (305)
                      .-|+.||+||.|
T Consensus        16 ~li~vHElGHfl   27 (449)
T PRK10779         16 VLITVHEFGHFW   27 (449)
T ss_pred             HHHHHHHHHHHH
Confidence            468999999963


No 108
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.
Probab=46.86  E-value=10  Score=32.85  Aligned_cols=13  Identities=31%  Similarity=0.710  Sum_probs=11.5

Q ss_pred             hHHHHHHhhhhhc
Q 037265          254 MQTVALHELGHVL  266 (305)
Q Consensus       254 l~~Va~HEiGHaL  266 (305)
                      +..+.+||+||++
T Consensus         9 ~~~i~~HE~aHa~   21 (181)
T cd06158           9 LLAITLHEFAHAY   21 (181)
T ss_pred             HHHHHHHHHHHHH
Confidence            4678999999998


No 109
>KOG2719 consensus Metalloprotease [General function prediction only]
Probab=45.72  E-value=11  Score=37.25  Aligned_cols=21  Identities=38%  Similarity=0.515  Sum_probs=15.8

Q ss_pred             cchhHHHHHHhhhhhcCCCCCC
Q 037265          251 GFDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      ...+.+|+.||+||. =++|.-
T Consensus       277 ~eel~AVl~HELGHW-~~~H~~  297 (428)
T KOG2719|consen  277 NEELVAVLAHELGHW-KLNHVL  297 (428)
T ss_pred             cHHHHHHHHHHhhHH-HHhhHH
Confidence            347899999999998 355543


No 110
>TIGR00054 RIP metalloprotease RseP. A model that detects fragments as well matches a number of members of the PEPTIDASE FAMILY S2C. The region of match appears not to overlap the active site domain.
Probab=44.81  E-value=9.5  Score=37.54  Aligned_cols=12  Identities=50%  Similarity=0.836  Sum_probs=10.3

Q ss_pred             HHHHHHhhhhhc
Q 037265          255 QTVALHELGHVL  266 (305)
Q Consensus       255 ~~Va~HEiGHaL  266 (305)
                      ..|+.||+||.|
T Consensus        15 ~~v~~HE~gH~~   26 (420)
T TIGR00054        15 VLIFVHELGHFL   26 (420)
T ss_pred             HHHHHHhHHHHH
Confidence            579999999974


No 111
>COG1164 Oligoendopeptidase F [Amino acid transport and metabolism]
Probab=42.74  E-value=11  Score=39.06  Aligned_cols=14  Identities=36%  Similarity=0.420  Sum_probs=11.6

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      +=..|++||+||++
T Consensus       379 ~dV~TLaHElGHs~  392 (598)
T COG1164         379 RDVFTLAHELGHSV  392 (598)
T ss_pred             hHHHHHHHHccHHH
Confidence            34689999999995


No 112
>cd06460 M32_Taq Peptidase family M32 is a subclass of metallocarboxypeptidases which are distributed mainly in bacteria and archaea, and contain a HEXXH motif that coordinates a divalent cation such as Zn2+ or Co2+, so far only observed in the active site of neutral metallopeptidases but not in carboxypeptidases. M32 includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). Novel peptidases from protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, are the first eukaryotic M32 enzymes identified so far, thus making these enzymes an attractive potential target for drug development against these o
Probab=41.98  E-value=11  Score=36.88  Aligned_cols=12  Identities=42%  Similarity=0.656  Sum_probs=10.1

Q ss_pred             HHHHHHhhhhhc
Q 037265          255 QTVALHELGHVL  266 (305)
Q Consensus       255 ~~Va~HEiGHaL  266 (305)
                      ..+++||+||+|
T Consensus       160 l~t~iHE~GHal  171 (396)
T cd06460         160 LFSTIHETGHAL  171 (396)
T ss_pred             HHHHHHHhhHHH
Confidence            467899999986


No 113
>COG4103 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.15  E-value=40  Score=28.31  Aligned_cols=53  Identities=21%  Similarity=0.226  Sum_probs=40.1

Q ss_pred             HHHHHHHHhhcccccCCCCCchhhHhhhhhCCCCCCchhcHHHHHHHHHhcCCCCC
Q 037265            6 LQLLLMHALASDASNNKRKPSALEFFEQFRGSQKGDKVKGIHQLRKYLQSLGYVNQ   61 (305)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~yL~~~GYl~~   61 (305)
                      ..+||++...+...   ..++.+..|+.+..-..|-++..+..+-.|++.+||-..
T Consensus        31 a~~Llf~Vm~ADG~---v~~~E~~a~r~il~~~f~i~~~~l~ali~~~e~~~~Ea~   83 (148)
T COG4103          31 AAALLFHVMEADGT---VSESEREAFRAILKENFGIDGEELDALIEAGEEAGYEAI   83 (148)
T ss_pred             HHHHHHHHHhcccC---cCHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhhHHHH
Confidence            34466666666666   345777778777777778889999999999999999554


No 114
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=39.98  E-value=18  Score=34.81  Aligned_cols=16  Identities=38%  Similarity=0.634  Sum_probs=13.8

Q ss_pred             cchhHHHHHHhhhhhc
Q 037265          251 GFDMQTVALHELGHVL  266 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaL  266 (305)
                      ..++..|+.||+||+.
T Consensus       121 ~sEvAAVl~HEmgHVt  136 (479)
T COG4784         121 SSEVAAVLAHEMGHVT  136 (479)
T ss_pred             HHHHHHHHHhhhhhee
Confidence            4578999999999984


No 115
>COG2321 Predicted metalloprotease [General function prediction only]
Probab=39.97  E-value=15  Score=34.21  Aligned_cols=38  Identities=26%  Similarity=0.347  Sum_probs=23.1

Q ss_pred             ecCCcceEEEcccccccc----CCcCCcchhHHHHHHhhhhhc
Q 037265          228 FSDPYAVVHFNGDVNWVM----GTVKGGFDMQTVALHELGHVL  266 (305)
Q Consensus       228 ~~P~~G~ihfd~~e~w~~----~~~~~~~~l~~Va~HEiGHaL  266 (305)
                      |.|.+..+.||....-.+    +. .+.+--..|++||+||.+
T Consensus       138 YCP~D~kvYlDlsFf~~m~~~fga-~GdfAqaYViAHEVGHHV  179 (295)
T COG2321         138 YCPADTKVYLDLSFFDEMKTKFGA-SGDFAQAYVIAHEVGHHV  179 (295)
T ss_pred             ecCCCceEEEehhHHHHHHHHhcC-CccHHHHHHHHhhhhHHH
Confidence            347888888886421111    11 122334679999999964


No 116
>PRK10911 oligopeptidase A; Provisional
Probab=37.81  E-value=15  Score=38.63  Aligned_cols=14  Identities=43%  Similarity=0.627  Sum_probs=11.6

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      +=..|+.||+||+|
T Consensus       462 ~~v~tlfHEfGHal  475 (680)
T PRK10911        462 DEVITLFHEFGHGL  475 (680)
T ss_pred             HHHHHHHHHHhHHH
Confidence            33578999999998


No 117
>PF14891 Peptidase_M91:  Effector protein
Probab=37.65  E-value=33  Score=29.41  Aligned_cols=17  Identities=29%  Similarity=0.206  Sum_probs=13.3

Q ss_pred             hhHHHHHHhhhhhcCCC
Q 037265          253 DMQTVALHELGHVLGLS  269 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~  269 (305)
                      .-+.|+.||+.||.-..
T Consensus       102 ~p~v~L~HEL~HA~~~~  118 (174)
T PF14891_consen  102 PPFVVLYHELIHAYDYM  118 (174)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45789999999996443


No 118
>PF03571 Peptidase_M49:  Peptidase family M49;  InterPro: IPR005317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M49 (dipeptidyl-peptidase III family, clan M-). The predicted active site residues occur in the motif HEXXXH which is unlike that in any other family. The dipeptidyl peptidase III aminopeptidases cleave dipeptides from the N-terminal of peptides consisting of four or more amino acids and have a broad specificity.; GO: 0008239 dipeptidyl-peptidase activity, 0006508 proteolysis, 0005737 cytoplasm; PDB: 3T6B_A 3FVY_A 3T6J_A 3CSK_A.
Probab=36.26  E-value=16  Score=37.30  Aligned_cols=15  Identities=53%  Similarity=0.740  Sum_probs=11.4

Q ss_pred             hHHHHHHhh-hhhcCC
Q 037265          254 MQTVALHEL-GHVLGL  268 (305)
Q Consensus       254 l~~Va~HEi-GHaLGL  268 (305)
                      ...|++||+ ||..|=
T Consensus       293 ~~~v~lHEllGHGsGk  308 (549)
T PF03571_consen  293 FVQVGLHELLGHGSGK  308 (549)
T ss_dssp             HHHHHHHHHCCCCS--
T ss_pred             hhhhhHHhhccCcCcc
Confidence            468999998 999884


No 119
>KOG2661 consensus Peptidase family M48 [Posttranslational modification, protein turnover, chaperones]
Probab=35.90  E-value=31  Score=33.13  Aligned_cols=20  Identities=30%  Similarity=0.436  Sum_probs=15.7

Q ss_pred             chhHHHHHHhhhhhcCCCCCC
Q 037265          252 FDMQTVALHELGHVLGLSHSS  272 (305)
Q Consensus       252 ~~l~~Va~HEiGHaLGL~Hs~  272 (305)
                      ..+..|+.||+||++ +.|+.
T Consensus       273 dglAtvLgHE~aHaV-arH~A  292 (424)
T KOG2661|consen  273 DGLATVLGHEIAHAV-ARHAA  292 (424)
T ss_pred             HHHHHHHHHHHHHHH-HHHHH
Confidence            357899999999996 46654


No 120
>PF02102 Peptidase_M35:  Deuterolysin metalloprotease (M35) family;  InterPro: IPR001384 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M35 (deuterolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Deuterolysin is a microbial zinc-containing metalloprotease that shows some similarity to thermolysin []. The protein is expressed with a possible 19-residue signal sequence, a 155-residue propeptide, and an active peptide of 177 residues []. The latter contains an HEXXH motif towards the C terminus, but the other zinc ligands are as yet undetermined [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 1EB6_A.
Probab=33.55  E-value=29  Score=33.60  Aligned_cols=46  Identities=15%  Similarity=0.104  Sum_probs=25.0

Q ss_pred             CCcceeeecCCcceEEEcccccc-ccC---CcCCcchhHHHHHHhhhhhcCC
Q 037265          221 WHTLGHAFSDPYAVVHFNGDVNW-VMG---TVKGGFDMQTVALHELGHVLGL  268 (305)
Q Consensus       221 gg~laha~~P~~G~ihfd~~e~w-~~~---~~~~~~~l~~Va~HEiGHaLGL  268 (305)
                      .|++|.+. |..+.|.+- +-.| .+.   ....+.|.-.+.+||+-|+.+.
T Consensus       262 ~~vlAYT~-p~~~~I~~C-p~ff~~lp~~~~~C~~qDqatt~LHE~TH~~~V  311 (359)
T PF02102_consen  262 SGVLAYTL-PSQNQIVNC-PIFFSDLPALSNRCHAQDQATTTLHEMTHAPAV  311 (359)
T ss_dssp             TT--EEEE-GGGTEEEE--HHHHHH--SS--STT---HHHHHHHHHHT-TTT
T ss_pred             CCeEEEEE-cCCCeEEEC-chhhccCCCccccccCCCccchhhhhhhccccc
Confidence            46888885 555666554 3334 232   2335567889999999999886


No 121
>PF06167 Peptidase_M90:  Glucose-regulated metallo-peptidase M90;  InterPro: IPR010384  MtfA (earlier known as YeeI) is a transcription factor that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (PtsG) system, the major glucose transporter in Escherichia coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity []. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in E. coli. ; PDB: 3DL1_A 3KHI_A.
Probab=32.54  E-value=21  Score=32.86  Aligned_cols=21  Identities=29%  Similarity=0.458  Sum_probs=14.8

Q ss_pred             cchhHHHHHHhhhhhcCCCCC
Q 037265          251 GFDMQTVALHELGHVLGLSHS  271 (305)
Q Consensus       251 ~~~l~~Va~HEiGHaLGL~Hs  271 (305)
                      ..+-.+|++||+.|.|=+..-
T Consensus       151 ~~dg~NVviHEfAH~LD~~~g  171 (253)
T PF06167_consen  151 PNDGHNVVIHEFAHKLDMEDG  171 (253)
T ss_dssp             SSSS--HHHHHHHHHHHCTTS
T ss_pred             CCCCcchHHHHHHHHHHhhcC
Confidence            446689999999999966543


No 122
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins.  Smubp-2_like proteins also contain a helicase_like and an AN1-like Zinc finger domain and have been shown to bind single-stranded DNA. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA.
Probab=28.30  E-value=39  Score=23.80  Aligned_cols=21  Identities=38%  Similarity=0.599  Sum_probs=17.5

Q ss_pred             hhHHHHHHhhhhhcCCCCCCC
Q 037265          253 DMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      ....-++||+.+.+||.|.+.
T Consensus        28 ~~eR~~vH~lA~~~gL~s~S~   48 (60)
T cd02641          28 SHDRLLVHELAEELGLRHEST   48 (60)
T ss_pred             HHHHHHHHHHHHHcCCceEee
Confidence            456789999999999998653


No 123
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=27.72  E-value=36  Score=26.50  Aligned_cols=8  Identities=25%  Similarity=0.090  Sum_probs=3.0

Q ss_pred             HHHhhccc
Q 037265           11 MHALASDA   18 (305)
Q Consensus        11 ~~~~~~~~   18 (305)
                      +++|.|++
T Consensus        15 ~lLlisSe   22 (95)
T PF07172_consen   15 ALLLISSE   22 (95)
T ss_pred             HHHHHHhh
Confidence            33333333


No 124
>PRK10280 dipeptidyl carboxypeptidase II; Provisional
Probab=26.92  E-value=28  Score=36.63  Aligned_cols=27  Identities=11%  Similarity=0.105  Sum_probs=18.2

Q ss_pred             HHHHHhhccCcceEEecCC--CCCccEEE
Q 037265          178 VALLLWSNWAPFTFEGSND--YENADIKI  204 (305)
Q Consensus       178 ~A~~~Ws~~~~l~F~ev~~--~~~adI~I  204 (305)
                      -.|..-+..-+|+|+++..  .-.+|++.
T Consensus       369 Glf~l~~~LfGi~f~~~~~~~vWh~dV~~  397 (681)
T PRK10280        369 GVFWTANQLFGIKFVERFDIPVYHPDVRV  397 (681)
T ss_pred             hHHHHHHHHcCeEEEECCCCCCCCCCeeE
Confidence            5666777788899998653  23556654


No 125
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=26.44  E-value=43  Score=23.79  Aligned_cols=23  Identities=30%  Similarity=0.348  Sum_probs=18.8

Q ss_pred             hhHHHHHHhhhhhcCCCCCCCCC
Q 037265          253 DMQTVALHELGHVLGLSHSSVKA  275 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~Hs~~~~  275 (305)
                      .-..-++|.+-|-|||.|.++..
T Consensus        28 ~~eRriih~la~~lGL~~~s~G~   50 (60)
T cd02639          28 PAERRIVHLLASRLGLNHVSDGT   50 (60)
T ss_pred             HHHHHHHHHHHHHcCCceEEeCC
Confidence            44677899999999999987654


No 126
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=25.87  E-value=34  Score=35.67  Aligned_cols=14  Identities=36%  Similarity=0.691  Sum_probs=12.2

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      ....|+.||+||+|
T Consensus       407 ~~~~~a~he~gha~  420 (644)
T PRK10733        407 QKESTAYHEAGHAI  420 (644)
T ss_pred             HHHHHHHHHHHHHH
Confidence            45789999999997


No 127
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=25.85  E-value=1.6e+02  Score=26.11  Aligned_cols=38  Identities=18%  Similarity=0.112  Sum_probs=24.0

Q ss_pred             CCcceEEEccccccccCC-cCCcchhHHHHHHhhhhhcC
Q 037265          230 DPYAVVHFNGDVNWVMGT-VKGGFDMQTVALHELGHVLG  267 (305)
Q Consensus       230 P~~G~ihfd~~e~w~~~~-~~~~~~l~~Va~HEiGHaLG  267 (305)
                      +....|||.....-.... .....++..|+.||+-|+.=
T Consensus        71 ~~~~~I~~S~~~i~~~~~~~~~~~Ei~Gvl~HE~~H~~Q  109 (205)
T PF04450_consen   71 DDHKEIHFSARYIAKYPADGDVRDEIIGVLYHEMVHCWQ  109 (205)
T ss_pred             CCccEEEEeHHHHhhcccccchHHHHHHHHHHHHHHHhh
Confidence            445789998753211111 11235688999999999954


No 128
>PF02074 Peptidase_M32:  Carboxypeptidase Taq (M32) metallopeptidase;  InterPro: IPR001333 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M32 (carboxypeptidase Taq family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  Carboxypeptidase Taq is a zinc-containing thermostable metallopeptidase. It was originally discovered and purified from Thermus aquaticus; optimal enzymatic activity occurs at 80 celcius. Although very little is known about this enzyme, it is thought either to be associated with a membrane or to be particle bound.; GO: 0004181 metallocarboxypeptidase activity, 0006508 proteolysis; PDB: 1K9X_A 1KA4_A 1KA2_A 3DWC_A 1WGZ_A 3HQ2_A 3HOA_B.
Probab=24.66  E-value=35  Score=34.49  Aligned_cols=16  Identities=44%  Similarity=0.698  Sum_probs=11.2

Q ss_pred             HHHHHHhhhhhc---CCCC
Q 037265          255 QTVALHELGHVL---GLSH  270 (305)
Q Consensus       255 ~~Va~HEiGHaL---GL~H  270 (305)
                      ..-++||.||+|   ||..
T Consensus       260 l~s~iHE~GHalYEq~~~~  278 (494)
T PF02074_consen  260 LFSTIHETGHALYEQGLPP  278 (494)
T ss_dssp             HHHHHHHHHHHHHHHTS-G
T ss_pred             HHHHHHHHHHHHHHcCCCh
Confidence            445679999996   6643


No 129
>CHL00176 ftsH cell division protein; Validated
Probab=24.08  E-value=37  Score=35.43  Aligned_cols=14  Identities=36%  Similarity=0.795  Sum_probs=12.4

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      ....||.||.||||
T Consensus       437 ~~~~vA~hEaGhA~  450 (638)
T CHL00176        437 NKRLIAYHEVGHAI  450 (638)
T ss_pred             HHHHHHHHhhhhHH
Confidence            46789999999998


No 130
>COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair]
Probab=24.07  E-value=82  Score=28.21  Aligned_cols=53  Identities=13%  Similarity=0.275  Sum_probs=38.1

Q ss_pred             hhcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHhhhhhccCccc
Q 037265           43 VKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQTISTMAQPRCG  121 (305)
Q Consensus        43 ~~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T~~~m~~PRCg  121 (305)
                      .-+.+++++|++.-|++..                 .     ...+.+.-+.+.+.||    |.+...-.+++..|=-|
T Consensus        66 ~a~~~~l~~~I~~iGlyr~-----------------K-----Ak~I~~~~~~l~e~~~----g~vP~~~~eL~~LPGVG  118 (211)
T COG0177          66 NADEEELEELIKSIGLYRN-----------------K-----AKNIKELARILLEKFG----GEVPDTREELLSLPGVG  118 (211)
T ss_pred             cCCHHHHHHHHHhcCCcHH-----------------H-----HHHHHHHHHHHHHHcC----CCCCchHHHHHhCCCcc
Confidence            4467789999999999876                 1     3567777778888887    66666666666655433


No 131
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=22.95  E-value=42  Score=30.00  Aligned_cols=14  Identities=29%  Similarity=0.290  Sum_probs=11.4

Q ss_pred             hhHHHHHHhhhhhc
Q 037265          253 DMQTVALHELGHVL  266 (305)
Q Consensus       253 ~l~~Va~HEiGHaL  266 (305)
                      -.-+|++||++||-
T Consensus        92 l~gsiLAHE~mHa~  105 (212)
T PF12315_consen   92 LTGSILAHELMHAW  105 (212)
T ss_pred             HHhhHHHHHHHHHH
Confidence            34689999999984


No 132
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=22.94  E-value=43  Score=33.72  Aligned_cols=16  Identities=25%  Similarity=0.372  Sum_probs=12.6

Q ss_pred             hhHHHHHHhhhhhcCC
Q 037265          253 DMQTVALHELGHVLGL  268 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL  268 (305)
                      +=+.|+.||+||+...
T Consensus       246 ~D~~t~~HE~GH~~yy  261 (477)
T cd06461         246 EDFVTVHHEMGHIQYY  261 (477)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3367899999999853


No 133
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=22.80  E-value=25  Score=36.03  Aligned_cols=13  Identities=38%  Similarity=0.616  Sum_probs=11.0

Q ss_pred             hHHHHHHhhhhhc
Q 037265          254 MQTVALHELGHVL  266 (305)
Q Consensus       254 l~~Va~HEiGHaL  266 (305)
                      +-.|+.|||||..
T Consensus       487 IGaVIgHEI~HgF  499 (654)
T COG3590         487 IGAVIGHEIGHGF  499 (654)
T ss_pred             ccceehhhhcccc
Confidence            4689999999974


No 134
>PF01726 LexA_DNA_bind:  LexA DNA binding domain;  InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria. The aligned region contains a variant form of the helix-turn-helix DNA binding motif []. This domain usually at the N terminus is found associated with IPR006198 from INTERPRO the auto-proteolytic domain of LexA 3.4.21.88 from EC.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1LEA_A 1JHH_A 3JSP_A 1JHF_A 3JSO_B 1LEB_A 3K2Z_A.
Probab=22.67  E-value=72  Score=22.82  Aligned_cols=36  Identities=19%  Similarity=0.431  Sum_probs=23.2

Q ss_pred             HHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHHHHHHhcCCCccccCCHHh
Q 037265           46 IHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIKTYQINFNLNATGTLDLQT  111 (305)
Q Consensus        46 v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~~fQ~~~gL~~TG~lD~~T  111 (305)
                      ++.+.+|.++.||-|.                              ++++++.+|+.-+..+..-.
T Consensus        12 L~~I~~~~~~~G~~Pt------------------------------~rEIa~~~g~~S~~tv~~~L   47 (65)
T PF01726_consen   12 LEFIREYIEENGYPPT------------------------------VREIAEALGLKSTSTVQRHL   47 (65)
T ss_dssp             HHHHHHHHHHHSS---------------------------------HHHHHHHHTSSSHHHHHHHH
T ss_pred             HHHHHHHHHHcCCCCC------------------------------HHHHHHHhCCCChHHHHHHH
Confidence            3567899999999764                              66677777777555544433


No 135
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=21.91  E-value=49  Score=28.69  Aligned_cols=18  Identities=22%  Similarity=0.283  Sum_probs=13.6

Q ss_pred             hhHHHHHHhhhhhcCCCC
Q 037265          253 DMQTVALHELGHVLGLSH  270 (305)
Q Consensus       253 ~l~~Va~HEiGHaLGL~H  270 (305)
                      .+-.|++|||+|++.-..
T Consensus        35 ~lG~ilahel~hafd~~g   52 (206)
T PF01431_consen   35 GLGFILAHELMHAFDPEG   52 (206)
T ss_dssp             THHHHHHHHHHHCTSTTG
T ss_pred             HHHHHHHHHHHHHHHHhH
Confidence            356899999999875533


No 136
>PF13670 PepSY_2:  Peptidase propeptide and YPEB domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. 
Probab=21.28  E-value=1.5e+02  Score=21.76  Aligned_cols=14  Identities=36%  Similarity=0.510  Sum_probs=12.2

Q ss_pred             cHHHHHHHHHhcCC
Q 037265           45 GIHQLRKYLQSLGY   58 (305)
Q Consensus        45 ~v~~~~~yL~~~GY   58 (305)
                      .+.++..-|+.-||
T Consensus        30 ~~~~~~~~l~~~G~   43 (83)
T PF13670_consen   30 SIEQAVAKLEAQGY   43 (83)
T ss_pred             CHHHHHHHHHhcCC
Confidence            56788899999999


No 137
>smart00099 btg1 tob/btg1 family. The tob/btg1 is a family of proteins that inhibit cell proliferation.
Probab=21.18  E-value=67  Score=25.68  Aligned_cols=33  Identities=15%  Similarity=0.283  Sum_probs=24.5

Q ss_pred             hcHHHHHHHHHhcCCCCCCCCCCCccCCCCCCCCCCCCccchHHHHHHHH
Q 037265           44 KGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIK   93 (305)
Q Consensus        44 ~~v~~~~~yL~~~GYl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ai~   93 (305)
                      ..|..+..||+++|-++.                 ..-+.|.++++++|.
T Consensus         7 ~av~Fl~~~l~~~~~l~~-----------------~~v~~F~~~L~~~L~   39 (108)
T smart00099        7 AAVNFITSLLRKHNKLSK-----------------RRVEIFAEKLTRLLK   39 (108)
T ss_pred             HHHHHHHHHHHHcCCCCH-----------------HHHHHHHHHHHHHHH
Confidence            346678899999999887                 224568888888775


No 138
>COG3926 zliS Lysozyme family protein [General function prediction only]
Probab=20.53  E-value=86  Score=28.45  Aligned_cols=28  Identities=21%  Similarity=0.306  Sum_probs=25.5

Q ss_pred             HHHHHHHHHhcC----CCccccCCHHhhhhhc
Q 037265           89 ESAIKTYQINFN----LNATGTLDLQTISTMA  116 (305)
Q Consensus        89 ~~Ai~~fQ~~~g----L~~TG~lD~~T~~~m~  116 (305)
                      -.|++-+|+..|    .+++|.+...|+..+.
T Consensus        94 ~rAa~~LQkal~~~~~v~~DGvIG~~TLaAl~  125 (252)
T COG3926          94 GRAAKWLQKALGPAYTVRVDGVIGAQTLAALK  125 (252)
T ss_pred             chHHHHHHHHhccCCcccccCcccHHHHHHHH
Confidence            458999999999    9999999999999874


No 139
>PLN00081 photosystem I reaction center subunit V (PsaG); Provisional
Probab=20.13  E-value=36  Score=27.74  Aligned_cols=39  Identities=21%  Similarity=0.326  Sum_probs=26.9

Q ss_pred             CcceEEEccc-----ccccc--CCcCCcchhHHHHHHh-hhhhcCCC
Q 037265          231 PYAVVHFNGD-----VNWVM--GTVKGGFDMQTVALHE-LGHVLGLS  269 (305)
Q Consensus       231 ~~G~ihfd~~-----e~w~~--~~~~~~~~l~~Va~HE-iGHaLGL~  269 (305)
                      .+|..||++.     |.|.+  .+.+-|+++..|++-- |||++|..
T Consensus        81 QNG~ThF~agd~ra~e~~~~l~tnDPaGF~ivDvlawGsiGH~vg~~  127 (141)
T PLN00081         81 QNGKTHFDAGDERAKEFAALLKSNDPVGFNLVDVLAWGSLGHIVAYY  127 (141)
T ss_pred             cCCcchhhhHHHHHHHHHHhhccCCCCccchhhhhhhhhhhhhhhhe
Confidence            5789999863     23333  2245678888777665 99999974


No 140
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=20.09  E-value=2.2e+02  Score=17.76  Aligned_cols=15  Identities=27%  Similarity=0.426  Sum_probs=13.3

Q ss_pred             HHHHHHHHhcCCCCC
Q 037265           47 HQLRKYLQSLGYVNQ   61 (305)
Q Consensus        47 ~~~~~yL~~~GYl~~   61 (305)
                      .+++.||+++|...+
T Consensus         7 ~~L~~wL~~~gi~~~   21 (38)
T PF10281_consen    7 SDLKSWLKSHGIPVP   21 (38)
T ss_pred             HHHHHHHHHcCCCCC
Confidence            578999999999877


No 141
>COG5504 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=20.05  E-value=1.9e+02  Score=26.81  Aligned_cols=77  Identities=13%  Similarity=0.160  Sum_probs=46.0

Q ss_pred             hHHHHHHHHHHhhc--cCcceEEecCCCCCccEEEEeecCCCCCCCCCCCCCCcceeeecCCcceEEEccccccccCCcC
Q 037265          172 IHEPVRVALLLWSN--WAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWVMGTVK  249 (305)
Q Consensus       172 ~~~~i~~A~~~Ws~--~~~l~F~ev~~~~~adI~I~f~~~~hgd~~~fdG~gg~laha~~P~~G~ihfd~~e~w~~~~~~  249 (305)
                      ..+.++++...|+.  |..+.|.-..  .++.|+..++..  |       -++      +  .|.|++     |-.. ..
T Consensus        81 ~ek~l~~~~~k~~~pnv~~v~f~V~~--~dp~irlqkg~k--g-------gg~------~--~~ki~l-----~l~p-~~  135 (280)
T COG5504          81 CEKYLPELIVKWYGPNVPIVDFPVTP--GDPQIRLQKGRK--G-------GGG------I--PGKIML-----WLVP-SS  135 (280)
T ss_pred             HHHHHHHHHHhhcCCCCceeeecccC--CCchHHHhhccc--C-------CCC------c--CceEEE-----EEec-CC
Confidence            44567888888976  4556664322  355566655442  2       122      2  255553     3221 12


Q ss_pred             CcchhHHHHHHhhhhhcCCCCCCC
Q 037265          250 GGFDMQTVALHELGHVLGLSHSSV  273 (305)
Q Consensus       250 ~~~~l~~Va~HEiGHaLGL~Hs~~  273 (305)
                      +-.+..+.++||+=|..-|.|-.-
T Consensus       136 ~~~~v~aliaHE~HH~~R~~~i~~  159 (280)
T COG5504         136 TITSVPALIAHEYHHNCRLRYIDY  159 (280)
T ss_pred             CccchHHHHHHHHHhhheeccccc
Confidence            334678999999999999988654


Done!