Citrus Sinensis ID: 037283

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------

MLFSTYYKTLSLLIRSNLNIFFSKQADVSIWTSSLLCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR

ccHHHHHHHHHHcHHcccccccHHHHHHHcccccEEcccccccHHHHHcccccccCCcccccccccCEEEEccccccccccccEEEcccccccccEEEHHHHHHcccccccccEEEcccccHHHHHHHHHcccccc

**FSTYYKTLSLLIRSNLNIFFSKQADVSIWTSSLLCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKK******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLFSTYYKTLSLLIRSNLNIFFSKQADVSIWTSSLLCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR

Annotation	Function Description	Confidence Level	Reference Protein
PHD finger-like domain-containing protein 5A	Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.	confident	P83870
PHD finger-like domain-containing protein 5A	Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.	confident	P83871
PHD finger-like domain-containing protein 5A		confident	P0DI19

No EC number assigned to the protein, probably not an enzyme!

Template: 2K0A, chain A
Confidence level:very confident
Coverage over the Query: 28-131
View the alignment between query and template
View the model in PyMOL