BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037339
(297 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LQ1|A Chain A, Crystal Structure Of
2-Succinyl-6-Hydroxy-2,4-Cyclohexadiene 1-Carboxylic
Acid Synthase2-Oxoglutarate Decarboxylase From Listeria
Monocytogenes Str. 4b F2365
pdb|3LQ1|B Chain B, Crystal Structure Of
2-Succinyl-6-Hydroxy-2,4-Cyclohexadiene 1-Carboxylic
Acid Synthase2-Oxoglutarate Decarboxylase From Listeria
Monocytogenes Str. 4b F2365
Length = 578
Score = 28.1 bits (61), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 3/57 (5%)
Query: 219 LASPKLAHRIVGYLEEEAVNSYTEFLKDLENGSFENAPAPAIAIDYWRMPPDSTLRD 275
LA P R G L+E ++ Y FLK+ E + P + I + MP L++
Sbjct: 254 LADPLSGLRSYGALDEVVIDQYDAFLKEAE---IIDKLTPEVVIRFGSMPVSKPLKN 307
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,916,128
Number of Sequences: 62578
Number of extensions: 348879
Number of successful extensions: 650
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 650
Number of HSP's gapped (non-prelim): 1
length of query: 297
length of database: 14,973,337
effective HSP length: 98
effective length of query: 199
effective length of database: 8,840,693
effective search space: 1759297907
effective search space used: 1759297907
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 51 (24.3 bits)