Citrus Sinensis ID: 037340

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------

MSFIGKAVLSASVELLIEKLASQGLELFKRHKKLKADFIKWKGMLEMIQAVLADAEDRQTREKSVKMWLDNLQNLAYDAEDVLDEFETEALRRELLRQEPAAAGQPSLSANTNKLRKLVHTRCTNLSPRSIQFESMMTSKIKGITARLQDIISTQKGLLDSKNVISVGKSRDVGQRLPTTSLVNEAKVYGREKDKEAIVELLLRDDLRADDGFPVISINGMGGVGKTTLAQLVYNDDRVQRHFQIKAWTCVSEDFDVSRVTKSILRSIADDQIKDDDDLNSLQVKLKKQLSGKKILLVLDDVWNENYENWSILSRPFGVGAPGSKIVVTTRNLGVAESMGVDPAYQLKELSNDDCLCVLTQISLGARDFNMHQSLKEVGEKIAMKCRGLPLAAKTLGGLLRGRDDPRDWEFVLNTDIWNLREESCNILPALRVSYHFLAPQLKQCFAYCSLVPKDYEFQEEEIILLWTAEGFLDQEYNGRKMEDLGREFVWELHSRSLFQQSSKDASRFVMHDLINDLARWAAGELYFRMEDALAGENGQEFSQSLRHFSYIRGGYDGKNRLESICGVKHLRTFLPMKLKYGGTFLAWSVLQMLLNLPRLRVFSLRGYCISKLPNEIGNLKHLRFLNLSGTSIQFLPDSINSLYNLYTILLEDCYWLKKLCQDMGNLTKLHHLINFNVLSLKEMPKGFGKLTCLLTLRRFVVGKDSGSSLRELRSLMHLQGTLQISMLENVKDVGDASEAQLNSKVNLKALLLEWSARPRRVCNLNQSEFQTCVLSILKPNQALQELTILGYGGTKFPVWLGDPSFSKLVLLRVLSCGMCTSLPPVGQLLFLKHLEISGMDGVKSVGPEFYGDSCSVPFPSLETLRFHDMQEWEEWIPRGAGQAVEGFPKLQMLSLVGCSELQGTLPERFPLLKKLVIVGCEQLLVTIQCLPVLSELHIDGCRRVVFSSLINFSSLKSIFLRDIANQVVLAGLFEQGLPKLENLQICYVHEQTYLWQSETRLLHDISSLNQLQISGCSQLLSLVTEEEHDQQQPELPCRLQFLELSDWEQDIRGSSSGCTCLTSFSSESELPATLEHLEIRVDGWPNLESFPEEGLPSTKLTELMIWSCENLKALPNSMHNLTSLLHLEIGRCPSLVSFPEDGFPTNLQSLEFEDLKISKPLFQWGLNRFNSLRKLKISGGFPDLVSSPRFPASLTELKISDMPSLERLSSIGENLTSLKFLDLDNCPKLKYFSKQGLPKSLLRLIIDECPLIEKRCRMDNAKYWPMITHIPCVRY

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEECcccccHHHHHHHHHHcHHHHcccccEEEEEEcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHccccccccccEEEEEcccHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHcccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEcHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEECccccccccccccccccccCEEEcccccccccccHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEEcccccccccccccccccccccccEEEEEEcccccccccccccHHHHHHHcccccccccccEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEECcccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccCEEEccccccccccccccccccEEEEcccccccccHHHHccccccccEEEEccccccccccHHHHHHccccccccEEEEcccccccccccccccccccccccccccCEECcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEECccccccccccccccccccEEEECccccccccccccccccccccEEEECcccccccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEEEccHHHHHHHccccccccccccccccccc

MSFIGKAVLSASVELLIEKLASQGLELFKRHKKLKADFIKWKGMLEMIQAVLADAEDRQTREKSVKMWLDNLQNLAYDAEDVLDEFETEALR***************LSANTNKLRKLVHTRCTNLSPRSIQFESMMTSKIKGITARLQDIISTQKGLLDS********************LVNEAKVYGREKDKEAIVELLLRDDLRADDGFPVISINGMGGVGKTTLAQLVYNDDRVQRHFQIKAWTCVSEDFDVSRVTKSILRSIADDQIKDDDDLNSLQVKLKKQLSGKKILLVLDDVWNENYENWSILSRPFGVGAPGSKIVVTTRNLGVAESMGVDPAYQLKELSNDDCLCVLTQISLGARDFNMHQSLKEVGEKIAMKCRGLPLAAKTLGGLLRGRDDPRDWEFVLNTDIWNLREESCNILPALRVSYHFLAPQLKQCFAYCSLVPKDYEFQEEEIILLWTAEGFLDQEYNGRKMEDLGREFVWELHSRSLFQQSSKDASRFVMHDLINDLARWAAGELYFRMEDALAGENGQEFSQSLRHFSYIRGGYDGKNRLESICGVKHLRTFLPMKLKYGGTFLAWSVLQMLLNLPRLRVFSLRGYCISKLPNEIGNLKHLRFLNLSGTSIQFLPDSINSLYNLYTILLEDCYWLKKLCQDMGNLTKLHHLINFNVLSLKEMPKGFGKLTCLLTLRRFVVGKDSGSSLRELRSLMHLQGTLQISMLENVKDVGDASEAQLNSKVNLKALLLEWSARPRRVCNLNQSEFQTCVLSILKPNQALQELTILGYGGTKFPVWLGDPSFSKLVLLRVLSCGMCTSLPPVGQLLFLKHLEISGMDGVKSVGPEFYGDSCSVPFPSLETLRFHDMQEWEEWIPRGAGQAVEGFPKLQMLSLVGCSELQGTLPERFPLLKKLVIVGCEQLLVTIQCLPVLSELHIDGCRRVVFSSLINFSSLKSIFLRDIANQVVLAGLFEQGLPKLENLQICYVHEQTYLWQSETRLLHDISSLNQLQISGCSQLLSLVTEEEH*QQQPELPCRLQFLELSDWEQDIRGSSSGCTCLTSFS***ELPATLEHLEIRVDGWPNLESFPEEGLPSTKLTELMIWSCENLKALPNSMHNLTSLLHLEIGRCPSLVSFPEDGFPTNLQSLEFEDLKISKPLFQWGLNRFNSLRKLKISGGFPDLVSSPRFPASLTELKISDMPSLERLSSIGENLTSLKFLDLDNCPKLKYFSKQGLPKSLLRLIIDECPLIEKRCRMDNAKYWPMITHIPCVRY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSFIGKAVLSASVELLIEKLASQGLELFKRHKKLKADFIKWKGMLEMIQAVLADAEDRQTREKSVKMWxxxxxxxxxxxxxxxxxxxxxALRRELLRQEPAAAGQPSLSANTNKLRKLVHTRCTNLSPRSIQFESMMTSKIKGITARLQDIISTQKGLLDSKNVISVGKSRDVGQRLPTTSLVNEAKVYGREKDKEAIVELLLRDDLRADDGFPVISINGMGGVGKTTLAQLVYNDDRVQRHFQIKAWTCVSEDFDVSRVTKSILRSIADDQIKDDDDLNSLQVKLKKQLSGKKILLVLDDVWNENYENWSILSRPFGVGAPGSKIVVTTRNLGVAESMGVDPAYQLKELSNDDCLCVLTQISLGARDFNMHQSLKEVGEKIAMKCRGLPLAAKTLGGLLRGRDDPRDWEFVLNTDIWNLREESCNILPALRVSYHFLAPQLKQCFAYCSLVPKDYEFQEEEIILLWTAEGFLDQEYNGRKMEDLGREFVWELHSRSLFQQSSKDASRFVMHDLINDLARWAAGELYFRMEDALAGENGQEFSQSLRHFSYIRGGYDGKNRLESICGVKHLRTFLPMKLKYGGTFLAWSVLQMLLNLPRLRVFSLRGYCISKLPNEIGNLKHLRFLNLSGTSIQFLPDSINSLYNLYTILLEDCYWLKKLCQDMGNLTKLHHLINFNVLSLKEMPKGFGKLTCLLTLRRFVVGKDSGSSLRELRSLMHLQGTLQISMLENVKDVGDASEAQLNSKVNLKALLLEWSARPRRVCNLNQSEFQTCVLSILKPNQALQELTILGYGGTKFPVWLGDPSFSKLVLLRVLSCGMCTSLPPVGQLLFLKHLEISGMDGVKSVGPEFYGDSCSVPFPSLETLRFHDMQEWEEWIPRGAGQAVEGFPKLQMLSLVGCSELQGTLPERFPLLKKLVIVGCEQLLVTIQCLPVLSELHIDGCRRVVFSSLINFSSLKSIFLRDIANQVVLAGLFEQGLPKLENLQICYVHEQTYLWQSETRLLHDISSLNQLQISGCSQLLSLVTEEEHDQQQPELPCRLQFLELSDWEQDIRGSSSGCTCLTSFSSESELPATLEHLEIRVDGWPNLESFPEEGLPSTKLTELMIWSCENLKALPNSMHNLTSLLHLEIGRCPSLVSFPEDGFPTNLQSLEFEDLKISKPLFQWGLNRFNSLRKLKISGGFPDLVSSPRFPASLTELKISDMPSLERLSSIGENLTSLKFLDLDNCPKLKYFSKQGLPKSLLRLIIDECPLIEKRCRMDNAKYWPMITHIPCVRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 1098-1230
View the alignment between query and template
View the model in PyMOL

Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 598-699
View the alignment between query and template
View the model in PyMOL

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 644-715,744-759,773-911,933-1024,1035-1049,1088-1183
View the alignment between query and template
View the model in PyMOL

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 596-692,775-908
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 569-700
View the alignment between query and template
View the model in PyMOL

Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 598-702,757-850,885-1049,1088-1262
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 598-706,736-758,771-841,873-912,923-1025,1091-1229
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 607-758,771-1052,1064-1261
View the alignment between query and template
View the model in PyMOL

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 184-470,483-526
View the alignment between query and template
View the model in PyMOL

Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 189-528
View the alignment between query and template
View the model in PyMOL

Template: 4EZG, chain A
Confidence level:confident
Coverage over the Query: 544-702
View the alignment between query and template
View the model in PyMOL

Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 12-90
View the alignment between query and template
View the model in PyMOL

Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 594-1018
View the alignment between query and template
View the model in PyMOL