BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037345
         (357 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2NX2|A Chain A, Crystal Structure Of Protein Ypsa From Bacillus Subtilis,
           Pfam Duf1273
          Length = 181

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 303 LEFWKNGSFFIESNTNQLLLYDPNTRALRDVGLGT 337
           L+F +   FFI+ +   LLLYDP         LGT
Sbjct: 118 LQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGT 152


>pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
          Mutant C128v
 pdb|1BD3|C Chain C, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
          Mutant C128v
 pdb|1BD3|B Chain B, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
          Mutant C128v
 pdb|1BD3|A Chain A, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
          Mutant C128v
 pdb|1BD4|D Chain D, Uprt-Uracil Complex
 pdb|1BD4|C Chain C, Uprt-Uracil Complex
 pdb|1BD4|B Chain B, Uprt-Uracil Complex
 pdb|1BD4|A Chain A, Uprt-Uracil Complex
 pdb|1JLS|B Chain B, Structure Of The Uracil Phosphoribosyltransferase
          UracilCPR 2 MUTANT C128V
 pdb|1JLS|A Chain A, Structure Of The Uracil Phosphoribosyltransferase
          UracilCPR 2 MUTANT C128V
 pdb|1JLS|D Chain D, Structure Of The Uracil Phosphoribosyltransferase
          UracilCPR 2 MUTANT C128V
 pdb|1JLS|C Chain C, Structure Of The Uracil Phosphoribosyltransferase
          UracilCPR 2 MUTANT C128V
 pdb|1JLR|A Chain A, Structure Of The Uracil Phosphoribosyltransferase Gtp
          Complex 2 Mutant C128v
 pdb|1JLR|B Chain B, Structure Of The Uracil Phosphoribosyltransferase Gtp
          Complex 2 Mutant C128v
 pdb|1JLR|D Chain D, Structure Of The Uracil Phosphoribosyltransferase Gtp
          Complex 2 Mutant C128v
 pdb|1JLR|C Chain C, Structure Of The Uracil Phosphoribosyltransferase Gtp
          Complex 2 Mutant C128v
          Length = 243

 Score = 27.7 bits (60), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%)

Query: 3  SNDDFSEDLLIEILSRLPVKSLMRYKFVCRFWCALIKSPRFVSRHIINYNDDNTRLVVEK 62
          S +D  E +L +I++R P   LM+     R    +I+         + Y D   RL++E+
Sbjct: 16 STNDQEESILQDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEE 75


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.139    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,899,730
Number of Sequences: 62578
Number of extensions: 514909
Number of successful extensions: 855
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 853
Number of HSP's gapped (non-prelim): 4
length of query: 357
length of database: 14,973,337
effective HSP length: 100
effective length of query: 257
effective length of database: 8,715,537
effective search space: 2239893009
effective search space used: 2239893009
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)