BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037345
(357 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2NX2|A Chain A, Crystal Structure Of Protein Ypsa From Bacillus Subtilis,
Pfam Duf1273
Length = 181
Score = 29.3 bits (64), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 14/35 (40%), Positives = 18/35 (51%)
Query: 303 LEFWKNGSFFIESNTNQLLLYDPNTRALRDVGLGT 337
L+F + FFI+ + LLLYDP LGT
Sbjct: 118 LQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGT 152
>pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
Mutant C128v
pdb|1BD3|C Chain C, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
Mutant C128v
pdb|1BD3|B Chain B, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
Mutant C128v
pdb|1BD3|A Chain A, Structure Of The Apo Uracil Phosphoribosyltransferase, 2
Mutant C128v
pdb|1BD4|D Chain D, Uprt-Uracil Complex
pdb|1BD4|C Chain C, Uprt-Uracil Complex
pdb|1BD4|B Chain B, Uprt-Uracil Complex
pdb|1BD4|A Chain A, Uprt-Uracil Complex
pdb|1JLS|B Chain B, Structure Of The Uracil Phosphoribosyltransferase
UracilCPR 2 MUTANT C128V
pdb|1JLS|A Chain A, Structure Of The Uracil Phosphoribosyltransferase
UracilCPR 2 MUTANT C128V
pdb|1JLS|D Chain D, Structure Of The Uracil Phosphoribosyltransferase
UracilCPR 2 MUTANT C128V
pdb|1JLS|C Chain C, Structure Of The Uracil Phosphoribosyltransferase
UracilCPR 2 MUTANT C128V
pdb|1JLR|A Chain A, Structure Of The Uracil Phosphoribosyltransferase Gtp
Complex 2 Mutant C128v
pdb|1JLR|B Chain B, Structure Of The Uracil Phosphoribosyltransferase Gtp
Complex 2 Mutant C128v
pdb|1JLR|D Chain D, Structure Of The Uracil Phosphoribosyltransferase Gtp
Complex 2 Mutant C128v
pdb|1JLR|C Chain C, Structure Of The Uracil Phosphoribosyltransferase Gtp
Complex 2 Mutant C128v
Length = 243
Score = 27.7 bits (60), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 16/60 (26%), Positives = 28/60 (46%)
Query: 3 SNDDFSEDLLIEILSRLPVKSLMRYKFVCRFWCALIKSPRFVSRHIINYNDDNTRLVVEK 62
S +D E +L +I++R P LM+ R +I+ + Y D RL++E+
Sbjct: 16 STNDQEESILQDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEE 75
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.139 0.450
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,899,730
Number of Sequences: 62578
Number of extensions: 514909
Number of successful extensions: 855
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 853
Number of HSP's gapped (non-prelim): 4
length of query: 357
length of database: 14,973,337
effective HSP length: 100
effective length of query: 257
effective length of database: 8,715,537
effective search space: 2239893009
effective search space used: 2239893009
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)