Query         037366
Match_columns 74
No_of_seqs    22 out of 24
Neff          1.9 
Searched_HMMs 46136
Date          Fri Mar 29 11:30:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037366.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037366hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2288 Galactosyltransferases  98.2 8.1E-07 1.8E-11   68.6   2.8   38   36-73    236-273 (274)
  2 PLN03193 beta-1,3-galactosyltr  97.8 9.5E-06 2.1E-10   64.8   1.9   28   37-67    373-400 (408)
  3 PF10829 DUF2554:  Protein of u  57.4       7 0.00015   26.0   1.4   17    7-23      6-22  (76)
  4 PF10559 Plug_translocon:  Plug  34.1      25 0.00054   19.3   1.1   16   24-39     10-25  (35)
  5 PF01205 UPF0029:  Uncharacteri  29.4      34 0.00073   22.8   1.3   22    2-24     61-94  (110)
  6 PF10497 zf-4CXXC_R1:  Zinc-fin  28.5      25 0.00053   23.1   0.5   14   37-50     60-73  (105)
  7 cd06197 FNR_like_2 FAD/NAD(P)   27.2      43 0.00093   22.9   1.6   17    3-19    195-211 (220)
  8 PF05458 Siva:  Cd27 binding pr  23.9      55  0.0012   23.4   1.7   20    1-20     27-50  (175)
  9 PF01700 Orbi_VP3:  Orbivirus V  21.0      29 0.00062   31.4  -0.3   23   23-45    241-273 (890)
 10 PF09899 DUF2126:  Putative ami  20.6      44 0.00096   29.9   0.7   16   12-27    470-485 (819)
 11 PHA02122 hypothetical protein   20.2      84  0.0018   20.3   1.8   23    3-27      8-30  (65)

No 1  
>KOG2288 consensus Galactosyltransferases [Carbohydrate transport and metabolism]
Probab=98.22  E-value=8.1e-07  Score=68.63  Aligned_cols=38  Identities=24%  Similarity=0.085  Sum_probs=35.1

Q ss_pred             cccccCCCccCCCChHHHHHHhhccccCCCCCCCCCCC
Q 037366           36 NFAARFPNICCLCNPAFRMKELHNISMCSKSPTLPPDD   73 (74)
Q Consensus        36 ~~~WDIPKCSGLCNPe~rm~ELH~~~~CSkSPTL~pdD   73 (74)
                      --+|++|||||+|++++||+++|..+.|++++++.+++
T Consensus       236 ~~~~~~~kcsglC~~~~rm~~~h~~~~~~~~~~~~~~~  273 (274)
T KOG2288|consen  236 CAASFDWKCSGLCKSEDRMLEVHKYDWEGKPATCCSRF  273 (274)
T ss_pred             eeeeecccccccCchHHHHhHHHHhhccCCCcccCccc
Confidence            35899999999999999999999999999999988764


No 2  
>PLN03193 beta-1,3-galactosyltransferase; Provisional
Probab=97.80  E-value=9.5e-06  Score=64.76  Aligned_cols=28  Identities=25%  Similarity=0.516  Sum_probs=23.6

Q ss_pred             ccccCCCccCCCChHHHHHHhhccccCCCCC
Q 037366           37 FAARFPNICCLCNPAFRMKELHNISMCSKSP   67 (74)
Q Consensus        37 ~~WDIPKCSGLCNPe~rm~ELH~~~~CSkSP   67 (74)
                      -.||+ ||||+|||+.||+|+|++  |....
T Consensus       373 ~~~~~-~csg~c~~~~~~~~~h~~--c~~~~  400 (408)
T PLN03193        373 ASFDW-SCSGICRSADRIKEVHRR--CGEGE  400 (408)
T ss_pred             EEecc-cCcccCCHHHHHHHHHHh--cCCCc
Confidence            56899 999999999999999974  65543


No 3  
>PF10829 DUF2554:  Protein of unknown function (DUF2554);  InterPro: IPR020117 This entry contains proteins with no known function.
Probab=57.43  E-value=7  Score=25.96  Aligned_cols=17  Identities=47%  Similarity=0.792  Sum_probs=13.1

Q ss_pred             hHHHHHHHHHhhccccc
Q 037366            7 INMLHVLSKLFSGQLLG   23 (74)
Q Consensus         7 ~~~~~~~~~~~~~~~~~   23 (74)
                      |..+-++.-|||||++.
T Consensus         6 lS~~lL~caLFSGqllA   22 (76)
T PF10829_consen    6 LSALLLICALFSGQLLA   22 (76)
T ss_pred             HHHHHHHHHHhcchHHh
Confidence            44566778999999985


No 4  
>PF10559 Plug_translocon:  Plug domain of Sec61p;  InterPro: IPR019561  The Sec61/SecY translocon mediates translocation of proteins across the membrane and integration of membrane proteins into the lipid bilayer. The structure of the translocon revealed a plug domain blocking the pore on the lumenal side. The plug is unlikely to be important for sealing the translocation pore in yeast but it plays a role in stabilising Sec61p during translocon formation. The domain runs from residues 52-74 []. ; PDB: 2YXR_A 1RHZ_A 3KCR_A 3DKN_A 2YXQ_A 1RH5_A 3BO1_A 3BO0_A 2WWA_A 2WW9_A ....
Probab=34.06  E-value=25  Score=19.35  Aligned_cols=16  Identities=31%  Similarity=0.555  Sum_probs=13.3

Q ss_pred             cccccccCCCCccccc
Q 037366           24 PLLDIESSDADDNFAA   39 (74)
Q Consensus        24 ~~~~~~~~~~~~~~~W   39 (74)
                      ||.-+.+++..|.|.|
T Consensus        10 pLyG~~~~~~~D~f~~   25 (35)
T PF10559_consen   10 PLYGLQSASSSDPFYW   25 (35)
T ss_dssp             B-STSTTTTSSCCHTT
T ss_pred             ccccccCCCcCCHHHH
Confidence            8888888899999988


No 5  
>PF01205 UPF0029:  Uncharacterized protein family UPF0029;  InterPro: IPR001498  The Impact protein is a translational regulator that ensures constant high levels of translation under amino acid starvation. It acts by interacting with Gcn1/Gcn1L1, thereby preventing activation of Gcn2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis. It is evolutionary conserved from eukaryotes to archaea [].  This entry represents the N-terminal domain of the Impact proteins.; PDB: 1VI7_A 2CVE_A.
Probab=29.45  E-value=34  Score=22.76  Aligned_cols=22  Identities=50%  Similarity=0.856  Sum_probs=12.5

Q ss_pred             CcccchHHHHHHHH------------Hhhcccccc
Q 037366            2 GTCGPINMLHVLSK------------LFSGQLLGP   24 (74)
Q Consensus         2 ~~~~~~~~~~~~~~------------~~~~~~~~~   24 (74)
                      ||.| .-||++|.+            .|.|.+|||
T Consensus        61 gtAG-~piL~~L~~~~l~nv~VVV~RyfGGi~LG~   94 (110)
T PF01205_consen   61 GTAG-KPILEVLEHNGLTNVLVVVTRYFGGIKLGP   94 (110)
T ss_dssp             TSSC-HHHHHHHHHCTB-SEEEEEEEE--SS--HH
T ss_pred             CCcc-HHHHHHHHhCCcCCEEEEEEEEeCCeeecc
Confidence            4555 357888876            488999887


No 6  
>PF10497 zf-4CXXC_R1:  Zinc-finger domain of monoamine-oxidase A repressor R1;  InterPro: IPR018866  R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type []. 
Probab=28.54  E-value=25  Score=23.11  Aligned_cols=14  Identities=21%  Similarity=0.294  Sum_probs=12.0

Q ss_pred             ccccCCCccCCCCh
Q 037366           37 FAARFPNICCLCNP   50 (74)
Q Consensus        37 ~~WDIPKCSGLCNP   50 (74)
                      -.|--|+|-|+||=
T Consensus        60 ~~W~CP~CrgiCnC   73 (105)
T PF10497_consen   60 PNWKCPKCRGICNC   73 (105)
T ss_pred             CceECCCCCCeeCC
Confidence            45999999999983


No 7  
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of  ferredoxin reductase-like proteins. Ferredoxin reductase (FNR) was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and have a variety of physiological  functions in a variety of organisms including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which varies in orientation with respect  to the NAD(P) binding domain. The N-terminal moeity 
Probab=27.17  E-value=43  Score=22.93  Aligned_cols=17  Identities=24%  Similarity=0.612  Sum_probs=14.6

Q ss_pred             cccchHHHHHHHHHhhc
Q 037366            3 TCGPINMLHVLSKLFSG   19 (74)
Q Consensus         3 ~~~~~~~~~~~~~~~~~   19 (74)
                      .|||-.|++.+.+.+..
T Consensus       195 ~CGP~~m~~~~~~~~~~  211 (220)
T cd06197         195 LCGPPALEKAVLEWLEG  211 (220)
T ss_pred             EECcHHHHHHHHHHhhh
Confidence            59999999999887654


No 8  
>PF05458 Siva:  Cd27 binding protein (Siva);  InterPro: IPR022773  Siva binds to the CD27 cytoplasmic tail. It has a DD homology region, a box-B-like ring finger, and a zinc finger-like domain. Overexpression of Siva in various cell lines induces apoptosis, suggesting an important role for Siva in the CD27-transduced apoptotic pathway []. Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Indeed, the unique amphipathic helical region (SAH) present in Siva-1 is required for its binding to BCL-X(L) and sensitising cells to UV radiation. Natural complexes of Siva-1/BCL-X(L) are detected in HUT78 and murine thymocyte, suggesting a potential role for Siva-1 in regulating T cell homeostasis []. This family contains both Siva-1 and the shorter Siva-2 lacking the sequence coded by exon 2. It has been suggested that Siva-2 could regulate the function of Siva-1 []. 
Probab=23.92  E-value=55  Score=23.36  Aligned_cols=20  Identities=45%  Similarity=0.747  Sum_probs=16.1

Q ss_pred             CCcccchHHHHHHHH----Hhhcc
Q 037366            1 MGTCGPINMLHVLSK----LFSGQ   20 (74)
Q Consensus         1 ~~~~~~~~~~~~~~~----~~~~~   20 (74)
                      .|.||+-+|-+|..|    ||.|.
T Consensus        27 ~GV~~~~~mkeVyEKTkqLLF~GA   50 (175)
T PF05458_consen   27 NGVCGERYMKEVYEKTKQLLFRGA   50 (175)
T ss_pred             cccchHHHHHHHHHHHHHHHHHHH
Confidence            388999999998776    77774


No 9  
>PF01700 Orbi_VP3:  Orbivirus VP3 (T2) protein;  InterPro: IPR002614 This entry represents the inner layer core protein VP3 from Orbiviruses, a family of Reoviruses that have dsRNA genomes of 10-12 linear segments []. Orbiviruses include Broadhaven virus (BRD), Epizootic hemorrhagic disease virus and Bluetongue virus (BTV) []. The Orbivirus VP3 protein is part of the virus core and makes a 'subcore' shell made up of 120 copies of the 100K protein []. VP3 particles can also bind RNA and are fundamental in the early stages of viral core formation []. The structural core protein VP2 from BRD is similar to VP3 from BTV.; GO: 0005198 structural molecule activity; PDB: 2BTV_A.
Probab=21.01  E-value=29  Score=31.35  Aligned_cols=23  Identities=22%  Similarity=0.260  Sum_probs=16.5

Q ss_pred             ccccccccCC----------CCccccccCCCcc
Q 037366           23 GPLLDIESSD----------ADDNFAARFPNIC   45 (74)
Q Consensus        23 ~~~~~~~~~~----------~~~~~~WDIPKCS   45 (74)
                      ++|.|+-++|          ++.|+.|+.|+|+
T Consensus       241 ~~LtD~~~~dtI~il~~~lP~np~vIW~VPRc~  273 (890)
T PF01700_consen  241 EFLTDFRRPDTIYILSYQLPPNPNVIWEVPRCS  273 (890)
T ss_dssp             CCC--SGGCCEEEE--C-SS--HHHHHHSTTTH
T ss_pred             cccccccCCCeEEEEeccCCCCCcceeeCcccc
Confidence            4788888877          5789999999998


No 10 
>PF09899 DUF2126:  Putative amidoligase enzyme (DUF2126);  InterPro: IPR018667  This domain is found in bacterial transglutaminase and transglutaminase-like proteins. Their exact function is, as yet, unknown. 
Probab=20.55  E-value=44  Score=29.88  Aligned_cols=16  Identities=50%  Similarity=0.787  Sum_probs=13.4

Q ss_pred             HHHHHhhccccccccc
Q 037366           12 VLSKLFSGQLLGPLLD   27 (74)
Q Consensus        12 ~~~~~~~~~~~~~~~~   27 (74)
                      -||=||||+.+||--.
T Consensus       470 sLSYLFSG~FIGPTSQ  485 (819)
T PF09899_consen  470 SLSYLFSGLFIGPTSQ  485 (819)
T ss_pred             hHhHhhccccccCccC
Confidence            4899999999999543


No 11 
>PHA02122 hypothetical protein
Probab=20.22  E-value=84  Score=20.32  Aligned_cols=23  Identities=39%  Similarity=0.642  Sum_probs=15.7

Q ss_pred             cccchHHHHHHHHHhhccccccccc
Q 037366            3 TCGPINMLHVLSKLFSGQLLGPLLD   27 (74)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~   27 (74)
                      .|||+ |-.|..-.|-| |+||=+|
T Consensus         8 ~~gpv-m~~vfe~afi~-l~g~~~~   30 (65)
T PHA02122          8 KPGPV-MNRVFEEAFIG-LLGDGCE   30 (65)
T ss_pred             CCchH-HHHHHHHHHHH-hhCCCCC
Confidence            58986 66666666665 6787665


Done!