Citrus Sinensis ID: 037421

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MAVLTKNTATRLPLLLSQRAACLHTTVPSLSSASGSSSSSSSQPTSYARPPPPSTTSPGGISKTAEFVISKLDDVVNYIRRGSIWPMSFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDVMVVAGTLTNKMAPALR
ccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccEEEEccccccccccccc
***********LPLLLSQRAACLH***************************************TAEFVISKLDDVVNYIRRGSIWPMSFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDVMVVAGTLTNKMAPALR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVLTKNTATRLPLLLSQRAACLHTTVPSLSSASGSSSSSSSQPTSYARPPPPSTTSPGGISKTAEFVISKLDDVVNYIRRGSIWPMSFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDVMVVAGTLTNKMAPALR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.probableQ42577
NADH-quinone oxidoreductase subunit B NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.probableQ1LPW2
NADH-quinone oxidoreductase subunit B 1 NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.probableA2S458

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 6
Confidence level:very confident
Coverage over the Query: 64-104,120-140
View the alignment between query and template
View the model in PyMOL