Query         037451
Match_columns 220
No_of_seqs    132 out of 814
Neff          7.8 
Searched_HMMs 46136
Date          Fri Mar 29 12:24:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037451.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037451hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03160 uncharacterized prote 100.0 1.2E-37 2.7E-42  258.7  25.6  187   27-220    26-217 (219)
  2 PF03168 LEA_2:  Late embryogen  99.5 2.9E-13 6.2E-18   98.4   8.4   83   98-186     1-84  (101)
  3 smart00769 WHy Water Stress an  98.8 1.4E-07 3.1E-12   69.0  11.2   85   89-179    11-97  (100)
  4 PF07092 DUF1356:  Protein of u  98.3 9.8E-05 2.1E-09   61.8  17.5   83   66-149    96-180 (238)
  5 PF12751 Vac7:  Vacuolar segreg  97.7 0.00044 9.5E-09   61.5  11.3   36   91-127   346-381 (387)
  6 COG5608 LEA14-like dessication  97.2   0.077 1.7E-06   41.5  17.8   93   69-171    31-124 (161)
  7 PLN03160 uncharacterized prote  88.5      13 0.00029   30.9  12.3  112   20-143    24-147 (219)
  8 PF06072 Herpes_US9:  Alphaherp  84.5    0.22 4.9E-06   32.5  -0.6    8   57-64     52-59  (60)
  9 TIGR02588 conserved hypothetic  81.6     3.9 8.5E-05   30.9   5.0   49   51-106    12-62  (122)
 10 PF14927 Neurensin:  Neurensin   80.8     3.3 7.2E-05   32.1   4.5   19   45-63     47-65  (140)
 11 PF09624 DUF2393:  Protein of u  72.4      33 0.00071   26.4   8.2   62   60-130    35-98  (149)
 12 PF11906 DUF3426:  Protein of u  71.1      16 0.00035   27.9   6.2   75   74-149    49-135 (149)
 13 KOG3950 Gamma/delta sarcoglyca  70.2       8 0.00017   32.8   4.4   22   90-111   105-126 (292)
 14 PF14155 DUF4307:  Domain of un  69.8     6.7 0.00015   29.1   3.6   79   59-150    19-100 (112)
 15 COG4698 Uncharacterized protei  59.3      34 0.00074   27.7   5.9   29   59-87     27-58  (197)
 16 PF11837 DUF3357:  Domain of un  58.3     3.3 7.1E-05   30.5   0.0   10   38-47     29-38  (106)
 17 PRK10893 lipopolysaccharide ex  58.3   1E+02  0.0022   25.1   9.3   21   67-87     37-57  (192)
 18 PRK05529 cell division protein  56.7      21 0.00045   30.4   4.6   44   70-114    58-128 (255)
 19 PF08113 CoxIIa:  Cytochrome c   55.2     5.9 0.00013   22.8   0.7   15   50-64     10-24  (34)
 20 PF10907 DUF2749:  Protein of u  52.0      20 0.00042   24.0   2.9   16   54-69     13-28  (66)
 21 PF12505 DUF3712:  Protein of u  50.7      47   0.001   24.7   5.3   26   92-118    99-124 (125)
 22 PF05473 Herpes_UL45:  UL45 pro  49.7      22 0.00048   29.2   3.6   14   35-48     44-57  (200)
 23 PF04573 SPC22:  Signal peptida  49.4      64  0.0014   25.9   6.1   36   39-76      7-42  (175)
 24 PF04790 Sarcoglycan_1:  Sarcog  48.0 1.8E+02  0.0039   25.0  13.0   18   90-107    83-100 (264)
 25 PF05478 Prominin:  Prominin;    45.9      23  0.0005   35.3   3.7   33   28-60    128-160 (806)
 26 PF15361 RIC3:  Resistance to i  45.3      13 0.00028   29.2   1.5   18   50-67     86-103 (152)
 27 PF08999 SP_C-Propep:  Surfacta  45.0      25 0.00054   24.6   2.7   17   20-36     11-27  (93)
 28 PRK13183 psbN photosystem II r  44.6      33 0.00072   21.3   2.9   22   48-69     12-33  (46)
 29 PF00927 Transglut_C:  Transglu  43.4      53  0.0012   23.5   4.5   59   91-149    13-75  (107)
 30 PRK06531 yajC preprotein trans  42.4      13 0.00029   27.7   1.1   13   58-70     12-24  (113)
 31 PRK07718 fliL flagellar basal   40.3      45 0.00097   25.7   3.8   15  111-125    63-77  (142)
 32 PF02468 PsbN:  Photosystem II   40.3      31 0.00067   21.2   2.3   21   48-68      9-29  (43)
 33 TIGR01732 tiny_TM_bacill conse  39.1      37  0.0008   18.4   2.2   14   50-63     12-25  (26)
 34 PF09865 DUF2092:  Predicted pe  38.9 2.3E+02  0.0049   23.5   8.4   39   89-128    35-75  (214)
 35 CHL00020 psbN photosystem II p  38.6      42  0.0009   20.6   2.6   22   48-69      9-30  (43)
 36 PF09680 Tiny_TM_bacill:  Prote  38.5      33 0.00071   18.3   1.9   11   52-62     12-22  (24)
 37 PF04478 Mid2:  Mid2 like cell   38.2      27 0.00058   27.5   2.3   21   52-72     61-81  (154)
 38 PTZ00116 signal peptidase; Pro  37.1 1.1E+02  0.0024   24.8   5.7   81   39-123     7-93  (185)
 39 PF15012 DUF4519:  Domain of un  36.8      40 0.00087   21.9   2.5   19   51-69     38-56  (56)
 40 PF06092 DUF943:  Enterobacteri  36.3      23 0.00049   28.1   1.6   18   52-69     12-29  (157)
 41 PF13396 PLDc_N:  Phospholipase  34.3      61  0.0013   19.5   3.0   19   51-69     28-46  (46)
 42 KOG0860 Synaptobrevin/VAMP-lik  34.1      27 0.00058   26.2   1.6   14   34-47     86-99  (116)
 43 PF05170 AsmA:  AsmA family;  I  34.1 1.8E+02  0.0039   27.5   7.7   67  110-181   468-534 (604)
 44 PF03100 CcmE:  CcmE;  InterPro  33.8      74  0.0016   24.1   4.1    8  116-123    83-90  (131)
 45 PF11322 DUF3124:  Protein of u  32.9 2.2E+02  0.0048   21.6   6.8   54   90-146    20-75  (125)
 46 PF07705 CARDB:  CARDB;  InterP  32.7 1.1E+02  0.0025   20.8   4.7   51   93-148    19-69  (101)
 47 PF06919 Phage_T4_Gp30_7:  Phag  31.2      76  0.0016   23.4   3.5   40  103-143    40-80  (121)
 48 PRK07021 fliL flagellar basal   31.0 2.6E+02  0.0056   21.8   7.4   18  109-126    77-94  (162)
 49 PF11770 GAPT:  GRB2-binding ad  30.9      68  0.0015   25.2   3.4   21   49-69     17-37  (158)
 50 COG1589 FtsQ Cell division sep  30.8      56  0.0012   27.9   3.3   32   51-82     38-69  (269)
 51 PF09911 DUF2140:  Uncharacteri  30.6      75  0.0016   25.7   3.8   21   51-71     11-31  (187)
 52 PF11239 DUF3040:  Protein of u  29.8      75  0.0016   21.9   3.2    7   52-58     55-61  (82)
 53 PF01102 Glycophorin_A:  Glycop  29.3      23  0.0005   26.8   0.6   24   54-77     77-101 (122)
 54 PF09604 Potass_KdpF:  F subuni  29.1      23 0.00049   19.1   0.4   19   51-69      5-23  (25)
 55 PF05545 FixQ:  Cbb3-type cytoc  29.1      21 0.00046   22.1   0.3   18   53-70     17-34  (49)
 56 PF06129 Chordopox_G3:  Chordop  28.9      64  0.0014   23.9   2.8   30   95-124    51-86  (109)
 57 PHA03029 hypothetical protein;  28.6      67  0.0015   22.1   2.7   37   33-70     48-84  (92)
 58 COG3121 FimC P pilus assembly   28.5 1.4E+02   0.003   25.1   5.2   40   98-143   166-205 (235)
 59 PF07423 DUF1510:  Protein of u  27.9      41 0.00088   28.1   1.8    7  161-167   153-159 (217)
 60 KOG3927 Na+/K+ ATPase, beta su  27.6      70  0.0015   28.1   3.3   49   36-86     41-92  (300)
 61 PF07787 DUF1625:  Protein of u  27.2      67  0.0014   27.0   3.1   13   56-68    236-248 (248)
 62 PF11797 DUF3324:  Protein of u  27.1 2.8E+02  0.0061   21.0  10.8   90   70-182    27-118 (140)
 63 cd01324 cbb3_Oxidase_CcoQ Cyto  26.4      29 0.00063   21.7   0.6   18   53-70     18-35  (48)
 64 PF06024 DUF912:  Nucleopolyhed  26.0      90   0.002   22.5   3.2   14   54-67     74-88  (101)
 65 PF02038 ATP1G1_PLM_MAT8:  ATP1  25.8 1.1E+02  0.0024   19.4   3.1   17   44-60     17-33  (50)
 66 COG4736 CcoQ Cbb3-type cytochr  25.1      28 0.00061   22.9   0.3   16   54-69     18-33  (60)
 67 PF14874 PapD-like:  Flagellar-  25.0 2.4E+02  0.0052   19.5   6.7   53   93-149    20-72  (102)
 68 PRK11677 hypothetical protein;  24.9      53  0.0011   25.3   1.8   18   46-63      3-20  (134)
 69 PF10177 DUF2371:  Uncharacteri  24.5 1.1E+02  0.0023   23.8   3.5   29   39-69     34-64  (141)
 70 PRK05751 preprotein translocas  24.0 3.6E+02  0.0079   21.2   6.8   18   70-87     10-27  (156)
 71 PF04906 Tweety:  Tweety;  Inte  23.9      88  0.0019   28.5   3.4    9   39-47     58-66  (406)
 72 PF14283 DUF4366:  Domain of un  23.9      69  0.0015   26.7   2.5   10   64-73    181-190 (218)
 73 PRK00523 hypothetical protein;  23.7      81  0.0018   21.6   2.4   18   45-62      7-24  (72)
 74 PF09307 MHC2-interact:  CLIP,   23.6      26 0.00057   26.2   0.0   29   38-67     29-57  (114)
 75 COG2332 CcmE Cytochrome c-type  23.6 3.5E+02  0.0075   21.3   6.1   33   99-131    76-109 (153)
 76 PF05399 EVI2A:  Ectropic viral  23.5      77  0.0017   26.4   2.6   18   43-60    131-148 (227)
 77 PRK13150 cytochrome c-type bio  23.4   3E+02  0.0064   21.8   5.9   28   96-123    79-106 (159)
 78 PF07423 DUF1510:  Protein of u  23.3      71  0.0015   26.7   2.5    6   43-48     15-20  (217)
 79 PRK01844 hypothetical protein;  23.1      86  0.0019   21.5   2.4   16   47-62      8-23  (72)
 80 COG3763 Uncharacterized protei  22.6      89  0.0019   21.3   2.4   15   46-60      7-21  (71)
 81 PRK13031 preprotein translocas  22.6 3.8E+02  0.0083   21.0   7.0   17   70-86      6-22  (149)
 82 PF11395 DUF2873:  Protein of u  22.5 1.2E+02  0.0025   18.0   2.6   11   56-66     22-32  (43)
 83 PF02009 Rifin_STEVOR:  Rifin/s  22.4      30 0.00066   30.3   0.1   17   51-67    264-280 (299)
 84 PF07184 CTV_P33:  Citrus trist  22.2      81  0.0018   26.0   2.5   24   39-62    279-302 (303)
 85 KOG3385 V-SNARE [Intracellular  22.0      98  0.0021   23.2   2.7   19   43-63     98-116 (118)
 86 COG3736 VirB8 Type IV secretor  21.9      77  0.0017   26.8   2.5   13   36-48     41-53  (239)
 87 PF11628 TCR_zetazeta:  T-cell   21.7      75  0.0016   18.3   1.6   21   44-64      4-24  (33)
 88 PF15145 DUF4577:  Domain of un  21.6      88  0.0019   23.3   2.4   21   49-69     69-89  (128)
 89 PHA02973 hypothetical protein;  21.2 2.6E+02  0.0057   20.4   4.7   53   59-122    13-66  (102)
 90 PF08956 DUF1869:  Domain of un  21.0 1.2E+02  0.0027   19.8   2.7   19   96-114     5-23  (60)
 91 PF03908 Sec20:  Sec20;  InterP  20.9      80  0.0017   22.2   2.0   12   52-63     78-89  (92)
 92 PHA03281 envelope glycoprotein  20.8 1.1E+02  0.0025   29.0   3.5   15    1-15    524-538 (642)
 93 TIGR01478 STEVOR variant surfa  20.8      32  0.0007   29.8  -0.0   17   50-66    266-282 (295)
 94 TIGR02115 potass_kdpF K+-trans  20.7      20 0.00044   19.5  -0.8   19   51-69      4-22  (26)
 95 PF12321 DUF3634:  Protein of u  20.4      37  0.0008   25.1   0.2   23   60-82     11-37  (108)
 96 PRK08455 fliL flagellar basal   20.2   1E+02  0.0022   24.8   2.8   16  110-125   102-117 (182)

No 1  
>PLN03160 uncharacterized protein; Provisional
Probab=100.00  E-value=1.2e-37  Score=258.71  Aligned_cols=187  Identities=13%  Similarity=0.189  Sum_probs=152.7

Q ss_pred             CCCCCCccccchhhhHHHHHHHHHHHHHHHHHhheeeeEEecCCCEEEecceeeeeEEcCC----CCeeeEEEEEEEEEe
Q 037451           27 HHPRPRQTNILIWCCATLCLIFSLILIFFGIATLIIFLVIRPRTPVFDTPNANLSTIYFDS----PEYFNGDFTFLANFS  102 (220)
Q Consensus        27 ~~~~~~r~~~~~~C~~~l~~~~~~l~l~lgi~~li~~lvl~P~~P~~~V~~~~v~~f~~~~----~~~l~~~~~~~l~v~  102 (220)
                      .+++++||+++++||+|++.+   ++++++++++++|++||||+|+|+|+++++++|++++    ...+|++++++++++
T Consensus        26 ~~~~~~~r~~~~~c~~~~~a~---~l~l~~v~~~l~~~vfrPk~P~~~v~~v~l~~~~~~~~~~~~~~~n~tl~~~v~v~  102 (219)
T PLN03160         26 NHLKKTRRRNCIKCCGCITAT---LLILATTILVLVFTVFRVKDPVIKMNGVTVTKLELINNTTLRPGTNITLIADVSVK  102 (219)
T ss_pred             cchhccccccceEEHHHHHHH---HHHHHHHHHheeeEEEEccCCeEEEEEEEEeeeeeccCCCCceeEEEEEEEEEEEE
Confidence            333333333444454444433   3344677778889999999999999999999999864    246788899999999


Q ss_pred             cCCCeeeEEEecEEEEEEECCEEeecccCCCeeecCCCceEEEEEEEeeeeecCHHHHHHHHHhhcCCeEEEEEEEEEEE
Q 037451          103 NPNRKIGARFEFLEIELLFFNRLISTQIVQPFSQQPREQRLESVHMISSLVFMPQDHAVELRKQVQNNRINYNIRASFKV  182 (220)
Q Consensus       103 NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~v~~~l~~~~v~l~~~~~~~l~~d~~~G~v~l~v~~~~~v  182 (220)
                      |||+ ++++|+++++.++|+|+.+|.+.+|+|+|++++++.+++++...+..+..  ..+|.+|+++|.++|++.+++++
T Consensus       103 NPN~-~~~~Y~~~~~~v~Y~g~~vG~a~~p~g~~~ar~T~~l~~tv~~~~~~~~~--~~~L~~D~~~G~v~l~~~~~v~g  179 (219)
T PLN03160        103 NPNV-ASFKYSNTTTTIYYGGTVVGEARTPPGKAKARRTMRMNVTVDIIPDKILS--VPGLLTDISSGLLNMNSYTRIGG  179 (219)
T ss_pred             CCCc-eeEEEcCeEEEEEECCEEEEEEEcCCcccCCCCeEEEEEEEEEEeceecc--chhHHHHhhCCeEEEEEEEEEEE
Confidence            9996 89999999999999999999999999999999999999998765544332  25799999999999999999999


Q ss_pred             EEEEeEEEE-eeEEeEEeEEEEcCCCCcceecCCcccCC
Q 037451          183 KATLGVIHF-SYWLHSRCQLEMTGPPTGVLVAHRCQTKR  220 (220)
Q Consensus       183 r~~~g~~~~-~~~~~v~C~l~v~~~~~g~i~~~~C~~k~  220 (220)
                      ++++|.+.. ++..+++|++.|+. .+.++.++.|+.|.
T Consensus       180 kVkv~~i~k~~v~~~v~C~v~V~~-~~~~i~~~~C~~~~  217 (219)
T PLN03160        180 KVKILKIIKKHVVVKMNCTMTVNI-TSQAIQGQKCKRHV  217 (219)
T ss_pred             EEEEEEEEEEEEEEEEEeEEEEEC-CCCEEeccEecccc
Confidence            999887755 79999999999984 66788899999873


No 2  
>PF03168 LEA_2:  Late embryogenesis abundant protein;  InterPro: IPR004864 Different types of LEA proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress [, ]. The function of these proteins is unknown. ; PDB: 3BUT_A 1XO8_A 1YYC_A.
Probab=99.46  E-value=2.9e-13  Score=98.42  Aligned_cols=83  Identities=14%  Similarity=0.288  Sum_probs=67.0

Q ss_pred             EEEEecCCCeeeEEEecEEEEEEECCEEee-cccCCCeeecCCCceEEEEEEEeeeeecCHHHHHHHHHhhcCCeEEEEE
Q 037451           98 LANFSNPNRKIGARFEFLEIELLFFNRLIS-TQIVQPFSQQPREQRLESVHMISSLVFMPQDHAVELRKQVQNNRINYNI  176 (220)
Q Consensus        98 ~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg-~~~vp~f~q~~~~t~~v~~~l~~~~v~l~~~~~~~l~~d~~~G~v~l~v  176 (220)
                      +|+++|||. ++++|+++++.++|+|..+| ....++|+|++++++.+.+.+..+...    ....+.++. +|...+++
T Consensus         1 ~l~v~NPN~-~~i~~~~~~~~v~~~g~~v~~~~~~~~~~i~~~~~~~v~~~v~~~~~~----l~~~l~~~~-~~~~~~~v   74 (101)
T PF03168_consen    1 TLSVRNPNS-FGIRYDSIEYDVYYNGQRVGTGGSLPPFTIPARSSTTVPVPVSVDYSD----LPRLLKDLL-AGRVPFDV   74 (101)
T ss_dssp             EEEEEESSS-S-EEEEEEEEEEEESSSEEEEEEECE-EEESSSCEEEEEEEEEEEHHH----HHHHHHHHH-HTTSCEEE
T ss_pred             CEEEECCCc-eeEEEeCEEEEEEECCEEEECccccCCeEECCCCcEEEEEEEEEcHHH----HHHHHHhhh-ccccceEE
Confidence            589999996 99999999999999999999 677899999999999998887765432    256677777 66777777


Q ss_pred             EEEEEEEEEE
Q 037451          177 RASFKVKATL  186 (220)
Q Consensus       177 ~~~~~vr~~~  186 (220)
                      .+++++++++
T Consensus        75 ~~~~~g~~~v   84 (101)
T PF03168_consen   75 TYRIRGTFKV   84 (101)
T ss_dssp             EEEEEEEEE-
T ss_pred             EEEEEEEEEE
Confidence            7777888884


No 3  
>smart00769 WHy Water Stress and Hypersensitive response.
Probab=98.77  E-value=1.4e-07  Score=68.97  Aligned_cols=85  Identities=13%  Similarity=0.119  Sum_probs=68.3

Q ss_pred             CeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccCC-CeeecCCCceEEEEEEEeeeeecCHHHHHHHHHhh
Q 037451           89 EYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQ-PFSQQPREQRLESVHMISSLVFMPQDHAVELRKQV  167 (220)
Q Consensus        89 ~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp-~f~q~~~~t~~v~~~l~~~~v~l~~~~~~~l~~d~  167 (220)
                      +.++.++.+.+.+.||| .+++.|+.++..++|+|..+|++..+ ++..++++++.+.+.+..+ .    .....+..++
T Consensus        11 ~~~~~~~~l~l~v~NPN-~~~l~~~~~~y~l~~~g~~v~~g~~~~~~~ipa~~~~~v~v~~~~~-~----~~~~~~~~~l   84 (100)
T smart00769       11 SGLEIEIVLKVKVQNPN-PFPIPVNGLSYDLYLNGVELGSGEIPDSGTLPGNGRTVLDVPVTVN-L----FLAEALIWHI   84 (100)
T ss_pred             cceEEEEEEEEEEECCC-CCccccccEEEEEEECCEEEEEEEcCCCcEECCCCcEEEEEEEEee-h----hHhHHHHHhh
Confidence            45778999999999999 89999999999999999999999985 7999999999999888763 2    2334555666


Q ss_pred             cCCe-EEEEEEEE
Q 037451          168 QNNR-INYNIRAS  179 (220)
Q Consensus       168 ~~G~-v~l~v~~~  179 (220)
                      .+|. ++++++++
T Consensus        85 ~~~~~~~y~l~g~   97 (100)
T smart00769       85 ANGEEIPYRLDGK   97 (100)
T ss_pred             ccCCCccEEEEEE
Confidence            6654 55555544


No 4  
>PF07092 DUF1356:  Protein of unknown function (DUF1356);  InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length. The function of this family is unknown.
Probab=98.32  E-value=9.8e-05  Score=61.77  Aligned_cols=83  Identities=18%  Similarity=0.230  Sum_probs=63.2

Q ss_pred             EecCCCEEEecceeeeeEEcCC-CCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccCCC-eeecCCCceE
Q 037451           66 IRPRTPVFDTPNANLSTIYFDS-PEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQP-FSQQPREQRL  143 (220)
Q Consensus        66 l~P~~P~~~V~~~~v~~f~~~~-~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~-f~q~~~~t~~  143 (220)
                      +-||.-.++-.++......++. .+.+..++.-.|.++||| +..+.-.++++++.|....+|.+.... ...++++.+.
T Consensus        96 LfPRsV~v~~~gv~s~~V~f~~~~~~v~l~itn~lNIsN~N-Fy~V~Vt~~s~qv~~~~~VVG~~~~~~~~~I~Prs~~q  174 (238)
T PF07092_consen   96 LFPRSVTVSPVGVKSVTVSFNPDKSTVQLNITNTLNISNPN-FYPVTVTNLSIQVLYMKTVVGKGKNSNITVIGPRSSKQ  174 (238)
T ss_pred             EeCcEEEEecCcEEEEEEEEeCCCCEEEEEEEEEEEccCCC-EEEEEEEeEEEEEEEEEeEEeeeEecceEEecccCCce
Confidence            3388666555555444444443 246888999999999999 999999999999999999999998754 4678888777


Q ss_pred             EEEEEE
Q 037451          144 ESVHMI  149 (220)
Q Consensus       144 v~~~l~  149 (220)
                      +..++.
T Consensus       175 ~~~tV~  180 (238)
T PF07092_consen  175 VNYTVK  180 (238)
T ss_pred             EEEEee
Confidence            766554


No 5  
>PF12751 Vac7:  Vacuolar segregation subunit 7;  InterPro: IPR024260 Vac7 is localised at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance []. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway []. The Fab1 lipid pathway is important for correct regulation of membrane trafficking events.
Probab=97.73  E-value=0.00044  Score=61.48  Aligned_cols=36  Identities=14%  Similarity=0.229  Sum_probs=29.6

Q ss_pred             eeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEee
Q 037451           91 FNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLIS  127 (220)
Q Consensus        91 l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg  127 (220)
                      -..-|++++.+.||| -+.|..+++++.+|-+..-++
T Consensus       346 qELmfdl~V~A~NPn-~~~V~I~d~dldIFAKS~yvg  381 (387)
T PF12751_consen  346 QELMFDLTVEAFNPN-WFTVTIDDMDLDIFAKSRYVG  381 (387)
T ss_pred             ceEEEeeEEEEECCC-eEEEEeccceeeeEecCCccC
Confidence            356789999999999 899999999999986554333


No 6  
>COG5608 LEA14-like dessication related protein [Defense mechanisms]
Probab=97.17  E-value=0.077  Score=41.53  Aligned_cols=93  Identities=11%  Similarity=0.080  Sum_probs=68.0

Q ss_pred             CCCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccC-CCeeecCCCceEEEEE
Q 037451           69 RTPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIV-QPFSQQPREQRLESVH  147 (220)
Q Consensus        69 ~~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~v-p~f~q~~~~t~~v~~~  147 (220)
                      +.|.+.--.+..-...     .....+-.++.++||| -+.+-...++..++-+|..+|.+.. .++..++++...+.+.
T Consensus        31 ~~p~ve~~ka~wGkvt-----~s~~EiV~t~KiyNPN-~fPipVtgl~y~vymN~Iki~eG~~~k~~~v~p~S~~tvdv~  104 (161)
T COG5608          31 KKPGVESMKAKWGKVT-----NSETEIVGTLKIYNPN-PFPIPVTGLQYAVYMNDIKIGEGEILKGTTVPPNSRETVDVP  104 (161)
T ss_pred             CCCCceEEEEEEEEEe-----ccceEEEEEEEecCCC-CcceeeeceEEEEEEcceEeeccccccceEECCCCeEEEEEE
Confidence            4455554444444432     2345788899999999 8999999999999999999999975 6799999999999888


Q ss_pred             EEeeeeecCHHHHHHHHHhhcCCe
Q 037451          148 MISSLVFMPQDHAVELRKQVQNNR  171 (220)
Q Consensus       148 l~~~~v~l~~~~~~~l~~d~~~G~  171 (220)
                      +..+.-.+    -+-+...+++|.
T Consensus       105 l~~d~~~~----ke~w~~hi~ngE  124 (161)
T COG5608         105 LRLDNSKI----KEWWVTHIENGE  124 (161)
T ss_pred             EEEehHHH----HHHHHHHhhccC
Confidence            76543222    234455667764


No 7  
>PLN03160 uncharacterized protein; Provisional
Probab=88.47  E-value=13  Score=30.86  Aligned_cols=112  Identities=10%  Similarity=-0.003  Sum_probs=54.0

Q ss_pred             CCCCCCCCCCCCCccccchhhhHHHHHHHHHHHHHHHHHhheeeeEEecC--CCEEEecceeee-------eEEcC--CC
Q 037451           20 PRKPPVLHHPRPRQTNILIWCCATLCLIFSLILIFFGIATLIIFLVIRPR--TPVFDTPNANLS-------TIYFD--SP   88 (220)
Q Consensus        20 ~~~~~~~~~~~~~r~~~~~~C~~~l~~~~~~l~l~lgi~~li~~lvl~P~--~P~~~V~~~~v~-------~f~~~--~~   88 (220)
                      +.+..+..  |+|++.+|+.|+|.+..+++  +++++++.++++ --.|+  .-.++++++.+.       .++++  ..
T Consensus        24 ~~~~~~~~--~r~~~~~c~~~~~a~~l~l~--~v~~~l~~~vfr-Pk~P~~~v~~v~l~~~~~~~~~~~~~~~n~tl~~~   98 (219)
T PLN03160         24 ATNHLKKT--RRRNCIKCCGCITATLLILA--TTILVLVFTVFR-VKDPVIKMNGVTVTKLELINNTTLRPGTNITLIAD   98 (219)
T ss_pred             cCcchhcc--ccccceEEHHHHHHHHHHHH--HHHHheeeEEEE-ccCCeEEEEEEEEeeeeeccCCCCceeEEEEEEEE
Confidence            34455543  34455556666666555542  222333344443 45554  344555554432       12221  00


Q ss_pred             -CeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccCCCeeecCCCceE
Q 037451           89 -EYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQPFSQQPREQRL  143 (220)
Q Consensus        89 -~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~  143 (220)
                       ..=|.|. +.+...  |..+.++|+...+.-    ..+..+..+++.+..-+.+.
T Consensus        99 v~v~NPN~-~~~~Y~--~~~~~v~Y~g~~vG~----a~~p~g~~~ar~T~~l~~tv  147 (219)
T PLN03160         99 VSVKNPNV-ASFKYS--NTTTTIYYGGTVVGE----ARTPPGKAKARRTMRMNVTV  147 (219)
T ss_pred             EEEECCCc-eeEEEc--CeEEEEEECCEEEEE----EEcCCcccCCCCeEEEEEEE
Confidence             0112333 334443  346889998754432    34556666766666666553


No 8  
>PF06072 Herpes_US9:  Alphaherpesvirus tegument protein US9;  InterPro: IPR009278 This family consists of several US9 and related proteins from the Alphaherpesviruses. The function of the US9 protein is unknown although in Bovine herpesvirus 5 Us9 is essential for the anterograde spread of the virus from the olfactory mucosa to the bulb [].; GO: 0019033 viral tegument
Probab=84.45  E-value=0.22  Score=32.55  Aligned_cols=8  Identities=13%  Similarity=0.497  Sum_probs=3.5

Q ss_pred             HHhheeee
Q 037451           57 IATLIIFL   64 (220)
Q Consensus        57 i~~li~~l   64 (220)
                      +-+++.|+
T Consensus        52 lG~~~~~~   59 (60)
T PF06072_consen   52 LGALVAWH   59 (60)
T ss_pred             HHHHhhcc
Confidence            33444443


No 9  
>TIGR02588 conserved hypothetical protein TIGR02588. The function of this protein is unknown. It is always found as part of a two-gene operon with TIGR02587, a protein that appears to span the membrane seven times. It is found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Sinorhizobium meliloti, and Gloeobacter violaceus, so far, all of which are bacterial.
Probab=81.57  E-value=3.9  Score=30.90  Aligned_cols=49  Identities=14%  Similarity=0.218  Sum_probs=32.7

Q ss_pred             HHHHHHHHhheeee--EEecCCCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCC
Q 037451           51 ILIFFGIATLIIFL--VIRPRTPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNR  106 (220)
Q Consensus        51 l~l~lgi~~li~~l--vl~P~~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~  106 (220)
                      ++++++++.+++|.  .-+++.|.+.+......+       +....+.+-++++|--.
T Consensus        12 ~~ill~viglv~y~~l~~~~~pp~l~v~~~~~~r-------~~~gqyyVpF~V~N~gg   62 (122)
T TIGR02588        12 TLILAAMFGLVAYDWLRYSNKAAVLEVAPAEVER-------MQTGQYYVPFAIHNLGG   62 (122)
T ss_pred             HHHHHHHHHHHHHHhhccCCCCCeEEEeehheeE-------EeCCEEEEEEEEEeCCC
Confidence            44556666677765  455678999888776655       23345777788888663


No 10 
>PF14927 Neurensin:  Neurensin
Probab=80.76  E-value=3.3  Score=32.11  Aligned_cols=19  Identities=32%  Similarity=0.558  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHhheee
Q 037451           45 CLIFSLILIFFGIATLIIF   63 (220)
Q Consensus        45 ~~~~~~l~l~lgi~~li~~   63 (220)
                      ++++-++++++|++++++-
T Consensus        47 ~~i~g~l~Ll~Gi~~l~vg   65 (140)
T PF14927_consen   47 GFISGLLLLLLGIVALTVG   65 (140)
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            4454566778888876553


No 11 
>PF09624 DUF2393:  Protein of unknown function (DUF2393);  InterPro: IPR013417  The function of this protein is unknown. It is always found as part of a two-gene operon with IPR013416 from INTERPRO, a protein that appears to span the membrane seven times. It has so far been found in the bacteria Anabaena sp. (strain PCC 7120), Agrobacterium tumefaciens, Rhizobium meliloti, and Gloeobacter violaceus.
Probab=72.41  E-value=33  Score=26.36  Aligned_cols=62  Identities=6%  Similarity=0.124  Sum_probs=39.8

Q ss_pred             heeeeEEec--CCCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeeccc
Q 037451           60 LIIFLVIRP--RTPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQI  130 (220)
Q Consensus        60 li~~lvl~P--~~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~  130 (220)
                      +++|.++..  +.+..++.+.+  .+..      +-.+.+..+++|-. +..+..=.+++.+...+...++..
T Consensus        35 ~~~~~~l~~~~~~~~~~~~~~~--~l~~------~~~~~v~g~V~N~g-~~~i~~c~i~~~l~~~~~~~~n~~   98 (149)
T PF09624_consen   35 FFGYYWLDKYLKKIELTLTSQK--RLQY------SESFYVDGTVTNTG-KFTIKKCKITVKLYNDKQVSGNKF   98 (149)
T ss_pred             HHHHHHHhhhcCCceEEEeeee--eeee------ccEEEEEEEEEECC-CCEeeEEEEEEEEEeCCCccCchh
Confidence            344444444  45666666543  2332      34577788999988 678888788899988776555543


No 12 
>PF11906 DUF3426:  Protein of unknown function (DUF3426);  InterPro: IPR021834  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 262 to 463 amino acids in length. 
Probab=71.14  E-value=16  Score=27.94  Aligned_cols=75  Identities=12%  Similarity=0.100  Sum_probs=46.4

Q ss_pred             EecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEE-ECCEEeecccC-C----------CeeecCCCc
Q 037451           74 DTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELL-FFNRLISTQIV-Q----------PFSQQPREQ  141 (220)
Q Consensus        74 ~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~-Y~g~~lg~~~v-p----------~f~q~~~~t  141 (220)
                      .++.+++++..+.....-.-.+.++.+++|.. .....|-.++++++ -+|+.+++-.+ |          .-..+++.+
T Consensus        49 ~~~~l~i~~~~~~~~~~~~~~l~v~g~i~N~~-~~~~~~P~l~l~L~D~~g~~l~~r~~~P~~yl~~~~~~~~~l~pg~~  127 (149)
T PF11906_consen   49 DIDALKIESSDLRPVPDGPGVLVVSGTIRNRA-DFPQALPALELSLLDAQGQPLARRVFTPADYLPPGLAAQAGLPPGES  127 (149)
T ss_pred             CcceEEEeeeeEEeecCCCCEEEEEEEEEeCC-CCcccCceEEEEEECCCCCEEEEEEEChHHhcccccccccccCCCCe
Confidence            44444444433322112245678888999988 67888888999988 67777776554 3          234555565


Q ss_pred             eEEEEEEE
Q 037451          142 RLESVHMI  149 (220)
Q Consensus       142 ~~v~~~l~  149 (220)
                      ..+.+.+.
T Consensus       128 ~~~~~~~~  135 (149)
T PF11906_consen  128 VPFRLRLE  135 (149)
T ss_pred             EEEEEEee
Confidence            55555543


No 13 
>KOG3950 consensus Gamma/delta sarcoglycan [Cytoskeleton]
Probab=70.18  E-value=8  Score=32.79  Aligned_cols=22  Identities=27%  Similarity=0.448  Sum_probs=17.1

Q ss_pred             eeeEEEEEEEEEecCCCeeeEE
Q 037451           90 YFNGDFTFLANFSNPNRKIGAR  111 (220)
Q Consensus        90 ~l~~~~~~~l~v~NPN~~~~i~  111 (220)
                      .+...=++++.++|||.++.=+
T Consensus       105 ~~~S~rnvtvnarn~~g~v~~~  126 (292)
T KOG3950|consen  105 YLQSARNVTVNARNPNGKVTGQ  126 (292)
T ss_pred             EEEeccCeeEEccCCCCceeee
Confidence            5667778999999999775443


No 14 
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=69.77  E-value=6.7  Score=29.10  Aligned_cols=79  Identities=13%  Similarity=0.124  Sum_probs=35.3

Q ss_pred             hheeeeEEe-cCCCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeeccc--CCCee
Q 037451           59 TLIIFLVIR-PRTPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQI--VQPFS  135 (220)
Q Consensus        59 ~li~~lvl~-P~~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~--vp~f~  135 (220)
                      +++.|+.++ -..+.+   +.+..+|++.+++.+..+|+  ++- +|.+.  .+-  .--...|++..+|.-.  +|+  
T Consensus        19 ~~~~w~~~~~~~~~~v---~~~~~gf~vv~d~~v~v~f~--Vtr-~~~~~--a~C--~VrA~~~d~aeVGrreV~vp~--   86 (112)
T PF14155_consen   19 AVVAWFGYSQFGSPPV---SAEVIGFEVVDDSTVEVTFD--VTR-DPGRP--AVC--IVRALDYDGAEVGRREVLVPP--   86 (112)
T ss_pred             HHHhHhhhhhccCCCc---eEEEEEEEECCCCEEEEEEE--EEE-CCCCC--EEE--EEEEEeCCCCEEEEEEEEECC--
Confidence            344444444 334444   33445566655444333333  222 25532  111  1122346777777654  455  


Q ss_pred             ecCCCceEEEEEEEe
Q 037451          136 QQPREQRLESVHMIS  150 (220)
Q Consensus       136 q~~~~t~~v~~~l~~  150 (220)
                       +...+..+++.+..
T Consensus        87 -~~~~~~~~~v~v~T  100 (112)
T PF14155_consen   87 -SGERTVRVTVTVRT  100 (112)
T ss_pred             -CCCcEEEEEEEEEe
Confidence             33444445555543


No 15 
>COG4698 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.31  E-value=34  Score=27.71  Aligned_cols=29  Identities=21%  Similarity=0.342  Sum_probs=18.7

Q ss_pred             hheeeeEEecCCCEEEecceee---eeEEcCC
Q 037451           59 TLIIFLVIRPRTPVFDTPNANL---STIYFDS   87 (220)
Q Consensus        59 ~li~~lvl~P~~P~~~V~~~~v---~~f~~~~   87 (220)
                      ++++-+++.|+.+...+.+++=   ..|++++
T Consensus        27 ~~i~~~vlsp~ee~t~~~~a~~~~~~~fqitt   58 (197)
T COG4698          27 VLIALFVLSPREEPTHLEDASEKSEKSFQITT   58 (197)
T ss_pred             HHhheeeccCCCCCchhhccCcccceeEEEEc
Confidence            5555668899997777776543   3355543


No 16 
>PF11837 DUF3357:  Domain of unknown function (DUF3357);  InterPro: IPR021792  This entry represents the N-terminal domain of beta-fructofuranosidase, whcih is involved in the hydrolysis of terminal non-reducing beta-D-fructofuranoside residues in beta-D-fructofuranosides. ; GO: 0004564 beta-fructofuranosidase activity, 0004575 sucrose alpha-glucosidase activity; PDB: 3UGG_A 3UGH_B 3UGF_B.
Probab=58.28  E-value=3.3  Score=30.49  Aligned_cols=10  Identities=10%  Similarity=0.019  Sum_probs=0.0

Q ss_pred             hhhhHHHHHH
Q 037451           38 IWCCATLCLI   47 (220)
Q Consensus        38 ~~C~~~l~~~   47 (220)
                      .++..+++.+
T Consensus        29 k~~~~i~~s~   38 (106)
T PF11837_consen   29 KCLAAIFSSL   38 (106)
T ss_dssp             ----------
T ss_pred             hhHHHHHHHH
Confidence            4344444444


No 17 
>PRK10893 lipopolysaccharide exporter periplasmic protein; Provisional
Probab=58.27  E-value=1e+02  Score=25.08  Aligned_cols=21  Identities=5%  Similarity=0.216  Sum_probs=16.6

Q ss_pred             ecCCCEEEecceeeeeEEcCC
Q 037451           67 RPRTPVFDTPNANLSTIYFDS   87 (220)
Q Consensus        67 ~P~~P~~~V~~~~v~~f~~~~   87 (220)
                      .++.|.|.+++++...|+-++
T Consensus        37 ~~~~Pdy~~~~~~~~~yd~~G   57 (192)
T PRK10893         37 NNNDPTYQSQHTDTVVYNPEG   57 (192)
T ss_pred             CCCCCCEEEeccEEEEECCCC
Confidence            356799999999988887653


No 18 
>PRK05529 cell division protein FtsQ; Provisional
Probab=56.72  E-value=21  Score=30.40  Aligned_cols=44  Identities=11%  Similarity=0.036  Sum_probs=27.3

Q ss_pred             CCEEEecceeeeeEEcCC------------C-C--------------eeeEEEEEEEEEecCCCeeeEEEec
Q 037451           70 TPVFDTPNANLSTIYFDS------------P-E--------------YFNGDFTFLANFSNPNRKIGARFEF  114 (220)
Q Consensus        70 ~P~~~V~~~~v~~f~~~~------------~-~--------------~l~~~~~~~l~v~NPN~~~~i~Y~~  114 (220)
                      .|.|.|+++.|++-..-+            + +              .+-.-=+++++-+.|| .+.|...+
T Consensus        58 Sp~~~v~~I~V~Gn~~vs~~eI~~~~~~~~g~~l~~vd~~~~~~~l~~~P~V~sa~V~r~~P~-tl~I~V~E  128 (255)
T PRK05529         58 SPLLALRSIEVAGNMRVKPQDIVAALRDQFGKPLPLVDPETVRKKLAAFPLIRSYSVESKPPG-TIVVRVVE  128 (255)
T ss_pred             CCceEEEEEEEECCccCCHHHHHHHhcccCCCcceeECHHHHHHHHhcCCCEeEEEEEEeCCC-EEEEEEEE
Confidence            488999999887654321            0 1              1112235667788999 67777754


No 19 
>PF08113 CoxIIa:  Cytochrome c oxidase subunit IIa family;  InterPro: IPR012538 This family consists of the cytochrome c oxidase subunit IIa family. The bax-type cytochrome c oxidase from Thermus thermophilus is known as a two subunit enzyme. From its crystal structure, it was discovered that an additional transmembrane helix, subunit IIa, spans the membrane. This subunit consists of 34 residues forming one helix across the membrane. The presence of this subunit seems to be important for the function of cytochrome c oxidases [].; PDB: 2QPD_C 3QJR_C 3EH5_C 3BVD_C 3S39_C 3QJU_C 3QJS_C 4EV3_C 3QJT_C 4FA7_C ....
Probab=55.17  E-value=5.9  Score=22.82  Aligned_cols=15  Identities=7%  Similarity=0.332  Sum_probs=10.0

Q ss_pred             HHHHHHHHHhheeee
Q 037451           50 LILIFFGIATLIIFL   64 (220)
Q Consensus        50 ~l~l~lgi~~li~~l   64 (220)
                      .++.+++++++++|+
T Consensus        10 ~vv~iLt~~ILvFWf   24 (34)
T PF08113_consen   10 GVVMILTAFILVFWF   24 (34)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             eeHHHHHHHHHHHHH
Confidence            345566777777775


No 20 
>PF10907 DUF2749:  Protein of unknown function (DUF2749);  InterPro: IPR024475 This bacterial family of proteins represent the TrbJ and TrbK genes of the Ti plasmid conjugative transfer operon [].
Probab=51.96  E-value=20  Score=24.01  Aligned_cols=16  Identities=19%  Similarity=0.451  Sum_probs=11.8

Q ss_pred             HHHHHhheeeeEEecC
Q 037451           54 FFGIATLIIFLVIRPR   69 (220)
Q Consensus        54 ~lgi~~li~~lvl~P~   69 (220)
                      +.+.+..+.|++++|+
T Consensus        13 vaa~a~~atwviVq~~   28 (66)
T PF10907_consen   13 VAAAAGAATWVIVQPR   28 (66)
T ss_pred             HHhhhceeEEEEECCC
Confidence            3444567889999998


No 21 
>PF12505 DUF3712:  Protein of unknown function (DUF3712);  InterPro: IPR022185  This domain family is found in eukaryotes, and is approximately 130 amino acids in length. 
Probab=50.70  E-value=47  Score=24.74  Aligned_cols=26  Identities=8%  Similarity=0.204  Sum_probs=19.4

Q ss_pred             eEEEEEEEEEecCCCeeeEEEecEEEE
Q 037451           92 NGDFTFLANFSNPNRKIGARFEFLEIE  118 (220)
Q Consensus        92 ~~~~~~~l~v~NPN~~~~i~Y~~~~~~  118 (220)
                      ..++..++.+.||. .+++....+.+.
T Consensus        99 g~~~~~~~~l~NPS-~~ti~lG~v~~~  124 (125)
T PF12505_consen   99 GINLNATVTLPNPS-PLTIDLGNVTLN  124 (125)
T ss_pred             cEEEEEEEEEcCCC-eEEEEeccEEEe
Confidence            56788888999999 677766665543


No 22 
>PF05473 Herpes_UL45:  UL45 protein;  InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family. The herpes simplex virus UL45 gene encodes an 18 kDa virion envelope protein whose function remains unknown. It has been suggested that the 18 kDa UL45 gene product is required for efficient growth in the central nervous system at low doses and may play an important role under the conditions of a naturally acquired infection []. The Equine herpesvirus 1 UL45 protein represents a type II membrane glycoprotein which has found to be non-essential for EHV-1 growth in vitro but deletion reduces the viruses' replication efficiency [].
Probab=49.74  E-value=22  Score=29.17  Aligned_cols=14  Identities=14%  Similarity=0.137  Sum_probs=6.1

Q ss_pred             ccchhhhHHHHHHH
Q 037451           35 NILIWCCATLCLIF   48 (220)
Q Consensus        35 ~~~~~C~~~l~~~~   48 (220)
                      +++.|++..+|+++
T Consensus        44 s~~~~~~~~~~~~~   57 (200)
T PF05473_consen   44 SPCACFLFIICGIL   57 (200)
T ss_pred             CCcccHHHHHHHHH
Confidence            44333344455554


No 23 
>PF04573 SPC22:  Signal peptidase subunit;  InterPro: IPR007653 Translocation of polypeptide chains across the endoplasmic reticulum membrane is triggered by signal sequences. During translocation of the nascent chain through the membrane, the signal sequence of most secretory and membrane proteins is cleaved off. Cleavage occurs by the signal peptidase complex (SPC), which consists of four subunits in yeast and five in mammals. This family is is described as similar to microsomal signal peptidase 23 kDa subunit. Found in eukaryotes [, ].; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=49.37  E-value=64  Score=25.90  Aligned_cols=36  Identities=11%  Similarity=0.289  Sum_probs=16.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhheeeeEEecCCCEEEec
Q 037451           39 WCCATLCLIFSLILIFFGIATLIIFLVIRPRTPVFDTP   76 (220)
Q Consensus        39 ~C~~~l~~~~~~l~l~lgi~~li~~lvl~P~~P~~~V~   76 (220)
                      +...++++.+.+++++++++.+-.+  +.+..|..++.
T Consensus         7 R~N~vfs~~~~vl~~l~~~~~~s~~--~~~~~~~~~i~   42 (175)
T PF04573_consen    7 RLNAVFSFALTVLAFLAALIFLSSY--FHPPSPSVSIS   42 (175)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh--ccCCCCceEEE
Confidence            4555565555444343333333333  55555554443


No 24 
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=47.97  E-value=1.8e+02  Score=24.98  Aligned_cols=18  Identities=17%  Similarity=0.075  Sum_probs=12.7

Q ss_pred             eeeEEEEEEEEEecCCCe
Q 037451           90 YFNGDFTFLANFSNPNRK  107 (220)
Q Consensus        90 ~l~~~~~~~l~v~NPN~~  107 (220)
                      .+..+=+++++++|.|..
T Consensus        83 ~i~s~~~v~~~~r~~~g~  100 (264)
T PF04790_consen   83 VIQSSRNVTLNARNENGS  100 (264)
T ss_pred             EEEecCceEEEEecCCCc
Confidence            455555677888888865


No 25 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=45.91  E-value=23  Score=35.25  Aligned_cols=33  Identities=21%  Similarity=0.507  Sum_probs=16.7

Q ss_pred             CCCCCccccchhhhHHHHHHHHHHHHHHHHHhh
Q 037451           28 HPRPRQTNILIWCCATLCLIFSLILIFFGIATL   60 (220)
Q Consensus        28 ~~~~~r~~~~~~C~~~l~~~~~~l~l~lgi~~l   60 (220)
                      +++.+|+..|.++|+-++.+++++++++|++..
T Consensus       128 ~~~~~~~~~c~R~~l~~~L~~~~~~il~g~i~a  160 (806)
T PF05478_consen  128 HQRDKKNDACRRGCLGILLLLLTLIILFGVICA  160 (806)
T ss_pred             ccccccccccchHHHHHHHHHHHHHHHHHHHHH
Confidence            344444434444444444455556666676653


No 26 
>PF15361 RIC3:  Resistance to inhibitors of cholinesterase homologue 3
Probab=45.30  E-value=13  Score=29.22  Aligned_cols=18  Identities=22%  Similarity=0.552  Sum_probs=14.3

Q ss_pred             HHHHHHHHHhheeeeEEe
Q 037451           50 LILIFFGIATLIIFLVIR   67 (220)
Q Consensus        50 ~l~l~lgi~~li~~lvl~   67 (220)
                      +=+-.+||+++++|.+++
T Consensus        86 mPlYtiGI~~f~lY~l~K  103 (152)
T PF15361_consen   86 MPLYTIGIVLFILYTLFK  103 (152)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            455788999999998776


No 27 
>PF08999 SP_C-Propep:  Surfactant protein C, N terminal propeptide;  InterPro: IPR015091 The N-terminal propeptide of surfactant protein C adopts an alpha-helical structure, with turn and extended regions. Its main function is the stabilisation of metastable surfactant protein C (SP-C), since the latter can irreversibly transform from its native alpha-helical structure to beta-sheet aggregates and form amyloid-like fibrils. The correct intracellular trafficking of proSP-C has also been reported to depend on the propeptide []. ; PDB: 1SPF_A 2YAD_F.
Probab=44.97  E-value=25  Score=24.62  Aligned_cols=17  Identities=29%  Similarity=0.237  Sum_probs=0.5

Q ss_pred             CCCCCCCCCCCCCcccc
Q 037451           20 PRKPPVLHHPRPRQTNI   36 (220)
Q Consensus        20 ~~~~~~~~~~~~~r~~~   36 (220)
                      -++|-|...|+.|-+=|
T Consensus        11 e~pp~ysa~p~~r~~iP   27 (93)
T PF08999_consen   11 ERPPDYSAAPRGRFGIP   27 (93)
T ss_dssp             ----------------S
T ss_pred             cCCCccccCCCCccCCC
Confidence            34667777777654444


No 28 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=44.56  E-value=33  Score=21.29  Aligned_cols=22  Identities=14%  Similarity=0.452  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHhheeeeEEecC
Q 037451           48 FSLILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        48 ~~~l~l~lgi~~li~~lvl~P~   69 (220)
                      +++..+++|+....+|..|-|-
T Consensus        12 i~i~~lL~~~TgyaiYtaFGpp   33 (46)
T PRK13183         12 ITILAILLALTGFGIYTAFGPP   33 (46)
T ss_pred             HHHHHHHHHHhhheeeeccCCc
Confidence            3456678899999999999873


No 29 
>PF00927 Transglut_C:  Transglutaminase family, C-terminal ig like domain;  InterPro: IPR008958 Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase  Transglutaminases catalyse the post-translational modification of proteins at glutamine residues, with formation of isopeptide bonds. Members of the transglutaminase family usually have three domains: N-terminal (IPR001102 from INTERPRO), middle (IPR013808 from INTERPRO) and C-terminal. The middle domain is usually well conserved, but family members can display major differences in their N- and C-terminal domains, although their overall structure is conserved []. This entry represents the C-terminal domain found in transglutaminases, which consists of an immunoglobulin-like beta-sandwich consisting of seven strands in two sheets with a Greek key topology. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. Protein-glutamine gamma-glutamyltransferases (2.3.2.13 from EC) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [, ].; GO: 0003810 protein-glutamine gamma-glutamyltransferase activity, 0018149 peptide cross-linking; PDB: 2XZZ_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B 1L9N_B ....
Probab=43.45  E-value=53  Score=23.49  Aligned_cols=59  Identities=15%  Similarity=0.222  Sum_probs=34.4

Q ss_pred             eeEEEEEEEEEecCCCee--eEEEecEEEEEEECCEEeecc--cCCCeeecCCCceEEEEEEE
Q 037451           91 FNGDFTFLANFSNPNRKI--GARFEFLEIELLFFNRLISTQ--IVQPFSQQPREQRLESVHMI  149 (220)
Q Consensus        91 l~~~~~~~l~v~NPN~~~--~i~Y~~~~~~v~Y~g~~lg~~--~vp~f~q~~~~t~~v~~~l~  149 (220)
                      +.-++++.+++.||....  .+...=....+.|.|......  .......+++++..+.+.+.
T Consensus        13 vG~d~~v~v~~~N~~~~~l~~v~~~l~~~~v~ytG~~~~~~~~~~~~~~l~p~~~~~~~~~i~   75 (107)
T PF00927_consen   13 VGQDFTVSVSFTNPSSEPLRNVSLNLCAFTVEYTGLTRDQFKKEKFEVTLKPGETKSVEVTIT   75 (107)
T ss_dssp             TTSEEEEEEEEEE-SSS-EECEEEEEEEEEEECTTTEEEEEEEEEEEEEE-TTEEEEEEEEE-
T ss_pred             CCCCEEEEEEEEeCCcCccccceeEEEEEEEEECCcccccEeEEEcceeeCCCCEEEEEEEEE
Confidence            445799999999987321  111111345668888754322  34566778888887776664


No 30 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=42.39  E-value=13  Score=27.71  Aligned_cols=13  Identities=23%  Similarity=0.391  Sum_probs=8.0

Q ss_pred             HhheeeeEEecCC
Q 037451           58 ATLIIFLVIRPRT   70 (220)
Q Consensus        58 ~~li~~lvl~P~~   70 (220)
                      +++++||.+||..
T Consensus        12 ~~~i~yf~iRPQk   24 (113)
T PRK06531         12 MLGLIFFMQRQQK   24 (113)
T ss_pred             HHHHHHheechHH
Confidence            3344566799963


No 31 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=40.31  E-value=45  Score=25.68  Aligned_cols=15  Identities=7%  Similarity=0.067  Sum_probs=10.0

Q ss_pred             EEecEEEEEEECCEE
Q 037451          111 RFEFLEIELLFFNRL  125 (220)
Q Consensus       111 ~Y~~~~~~v~Y~g~~  125 (220)
                      +|=..++.+.+++..
T Consensus        63 ~ylk~~i~l~~~~~~   77 (142)
T PRK07718         63 NFIRIQFKIETDSKK   77 (142)
T ss_pred             CEEEEEEEEEECCHH
Confidence            466677777777654


No 32 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=40.30  E-value=31  Score=21.16  Aligned_cols=21  Identities=14%  Similarity=0.338  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHhheeeeEEec
Q 037451           48 FSLILIFFGIATLIIFLVIRP   68 (220)
Q Consensus        48 ~~~l~l~lgi~~li~~lvl~P   68 (220)
                      +++..+++|+....+|..|-|
T Consensus         9 i~i~~~lv~~Tgy~iYtaFGp   29 (43)
T PF02468_consen    9 IFISCLLVSITGYAIYTAFGP   29 (43)
T ss_pred             HHHHHHHHHHHhhhhhheeCC
Confidence            345667788889999999987


No 33 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=39.14  E-value=37  Score=18.44  Aligned_cols=14  Identities=14%  Similarity=0.282  Sum_probs=6.2

Q ss_pred             HHHHHHHHHhheee
Q 037451           50 LILIFFGIATLIIF   63 (220)
Q Consensus        50 ~l~l~lgi~~li~~   63 (220)
                      ++++++-+++...|
T Consensus        12 vVLFILLIIiga~~   25 (26)
T TIGR01732        12 VVLFILLVIVGAAF   25 (26)
T ss_pred             HHHHHHHHHhheee
Confidence            33444444444444


No 34 
>PF09865 DUF2092:  Predicted periplasmic protein (DUF2092);  InterPro: IPR019207  This entry represents various hypothetical prokaryotic proteins of unknown function. 
Probab=38.89  E-value=2.3e+02  Score=23.52  Aligned_cols=39  Identities=8%  Similarity=0.045  Sum_probs=31.7

Q ss_pred             CeeeEEEEEEEEEecCCCeeeEEEec--EEEEEEECCEEeec
Q 037451           89 EYFNGDFTFLANFSNPNRKIGARFEF--LEIELLFFNRLIST  128 (220)
Q Consensus        89 ~~l~~~~~~~l~v~NPN~~~~i~Y~~--~~~~v~Y~g~~lg~  128 (220)
                      ..+...-+.++.++=|| ++.+.+..  .+..++|+|..+.-
T Consensus        35 qklq~~~~~~v~v~RPd-klr~~~~gd~~~~~~~yDGkt~Tl   75 (214)
T PF09865_consen   35 QKLQFSSSGTVTVQRPD-KLRIDRRGDGADREFYYDGKTFTL   75 (214)
T ss_pred             ceEEEEEEEEEEEeCCC-eEEEEEEcCCcceEEEECCCEEEE
Confidence            45777778899999999 89999954  67889999987654


No 35 
>CHL00020 psbN photosystem II protein N
Probab=38.62  E-value=42  Score=20.58  Aligned_cols=22  Identities=0%  Similarity=0.084  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHhheeeeEEecC
Q 037451           48 FSLILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        48 ~~~l~l~lgi~~li~~lvl~P~   69 (220)
                      +++..+++|+....+|..|-|-
T Consensus         9 i~i~~ll~~~Tgy~iYtaFGpp   30 (43)
T CHL00020          9 IFISGLLVSFTGYALYTAFGQP   30 (43)
T ss_pred             HHHHHHHHHhhheeeeeccCCc
Confidence            3456677899999999998873


No 36 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=38.52  E-value=33  Score=18.25  Aligned_cols=11  Identities=18%  Similarity=-0.004  Sum_probs=4.4

Q ss_pred             HHHHHHHhhee
Q 037451           52 LIFFGIATLII   62 (220)
Q Consensus        52 ~l~lgi~~li~   62 (220)
                      ++++-+++.+.
T Consensus        12 LFILLiIvG~s   22 (24)
T PF09680_consen   12 LFILLIIVGAS   22 (24)
T ss_pred             HHHHHHHhcce
Confidence            33344444443


No 37 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=38.25  E-value=27  Score=27.49  Aligned_cols=21  Identities=29%  Similarity=0.550  Sum_probs=14.8

Q ss_pred             HHHHHHHhheeeeEEecCCCE
Q 037451           52 LIFFGIATLIIFLVIRPRTPV   72 (220)
Q Consensus        52 ~l~lgi~~li~~lvl~P~~P~   72 (220)
                      .++++++++++|+..|.+.=.
T Consensus        61 ~ill~il~lvf~~c~r~kktd   81 (154)
T PF04478_consen   61 PILLGILALVFIFCIRRKKTD   81 (154)
T ss_pred             HHHHHHHHhheeEEEecccCc
Confidence            344567788888888987533


No 38 
>PTZ00116 signal peptidase; Provisional
Probab=37.10  E-value=1.1e+02  Score=24.85  Aligned_cols=81  Identities=9%  Similarity=0.000  Sum_probs=38.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhheeeeEEecCCCEEEecceeeeeEEcCCC-----CeeeEEEEEEEEE-ecCCCeeeEEE
Q 037451           39 WCCATLCLIFSLILIFFGIATLIIFLVIRPRTPVFDTPNANLSTIYFDSP-----EYFNGDFTFLANF-SNPNRKIGARF  112 (220)
Q Consensus        39 ~C~~~l~~~~~~l~l~lgi~~li~~lvl~P~~P~~~V~~~~v~~f~~~~~-----~~l~~~~~~~l~v-~NPN~~~~i~Y  112 (220)
                      +-..++|+.+++++++.++..+.-.+.+....|..+++-.+|.+|...+.     ..++.++++.|+- -|=|.|.-+-|
T Consensus         7 R~Nal~~f~~~vLa~l~~~~~~s~~f~~~~~~~~~~i~v~~V~~~~~~~~~~~D~a~i~fdl~~DL~~lfnWNtKqlFvy   86 (185)
T PTZ00116          7 RLNVLSYSMALCFLILCLFNYGTSFYLFDEKEMSTNIKVKSVKRLVYNRHIKGDEAVLSLDLSYDMSKAFNWNLKQLFLY   86 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCceeeEEEeecccccccCCCCceeEEEEEeeccCchhcCCccccEEEEE
Confidence            34456666654433333222222222222345656666556667764332     2444444444442 46666655544


Q ss_pred             ecEEEEEEECC
Q 037451          113 EFLEIELLFFN  123 (220)
Q Consensus       113 ~~~~~~v~Y~g  123 (220)
                          +.+.|.+
T Consensus        87 ----v~a~Y~t   93 (185)
T PTZ00116         87 ----VLVTYET   93 (185)
T ss_pred             ----EEEEEcC
Confidence                4455654


No 39 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=36.83  E-value=40  Score=21.86  Aligned_cols=19  Identities=26%  Similarity=0.586  Sum_probs=12.0

Q ss_pred             HHHHHHHHhheeeeEEecC
Q 037451           51 ILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~   69 (220)
                      ++.++.++++++|+.-||+
T Consensus        38 l~~~~~~Ivv~vy~kTRP~   56 (56)
T PF15012_consen   38 LAAVFLFIVVFVYLKTRPR   56 (56)
T ss_pred             HHHHHHHHhheeEEeccCC
Confidence            3444455567778888874


No 40 
>PF06092 DUF943:  Enterobacterial putative membrane protein (DUF943);  InterPro: IPR010351 This family consists of several hypothetical proteins from Escherichia coli, Yersinia pestis and Salmonella typhi.
Probab=36.30  E-value=23  Score=28.05  Aligned_cols=18  Identities=22%  Similarity=0.571  Sum_probs=12.1

Q ss_pred             HHHHHHHhheeeeEEecC
Q 037451           52 LIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        52 ~l~lgi~~li~~lvl~P~   69 (220)
                      ++++|+++.++|+.+||-
T Consensus        12 l~l~~~~~y~~W~~~rpV   29 (157)
T PF06092_consen   12 LFLLACILYFLWLTLRPV   29 (157)
T ss_pred             HHHHHHHHHhhhhccCCe
Confidence            344454558888889984


No 41 
>PF13396 PLDc_N:  Phospholipase_D-nuclease N-terminal
Probab=34.31  E-value=61  Score=19.47  Aligned_cols=19  Identities=26%  Similarity=0.731  Sum_probs=12.6

Q ss_pred             HHHHHHHHhheeeeEEecC
Q 037451           51 ILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~   69 (220)
                      +++++-++..++|+.+..+
T Consensus        28 ~i~~~P~iG~i~Yl~~gr~   46 (46)
T PF13396_consen   28 VILFFPIIGPILYLIFGRK   46 (46)
T ss_pred             HHHHHHHHHHhheEEEeCC
Confidence            3445667777888877653


No 42 
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=34.11  E-value=27  Score=26.17  Aligned_cols=14  Identities=14%  Similarity=-0.028  Sum_probs=5.7

Q ss_pred             cccchhhhHHHHHH
Q 037451           34 TNILIWCCATLCLI   47 (220)
Q Consensus        34 ~~~~~~C~~~l~~~   47 (220)
                      ..||.-|-=..|..
T Consensus        86 k~wWkn~Km~~il~   99 (116)
T KOG0860|consen   86 KMWWKNCKMRIILG   99 (116)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444444333433


No 43 
>PF05170 AsmA:  AsmA family;  InterPro: IPR007844 The AsmA protein is involved in the assembly of outer membrane proteins in Escherichia coli []. AsmA mutations were isolated as extragenic suppressors of an OmpF assembly mutant []. AsmA may have a role in LPS biogenesis [].
Probab=34.09  E-value=1.8e+02  Score=27.52  Aligned_cols=67  Identities=9%  Similarity=-0.016  Sum_probs=32.6

Q ss_pred             EEEecEEEEEEECCEEeecccCCCeeecCCCceEEEEEEEeeeeecCHHHHHHHHHhhcCCeEEEEEEEEEE
Q 037451          110 ARFEFLEIELLFFNRLISTQIVQPFSQQPREQRLESVHMISSLVFMPQDHAVELRKQVQNNRINYNIRASFK  181 (220)
Q Consensus       110 i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~v~~~l~~~~v~l~~~~~~~l~~d~~~G~v~l~v~~~~~  181 (220)
                      +..+++++.+ |+|..=+.+.+..    ......+++....+++++.+-.......+.-.|...+++.+++.
T Consensus       468 l~l~~l~~~l-~~G~~~~~~~ld~----~~~~~~~~~~~~~~~v~l~~Ll~~~~~~~~l~G~~~~~~~l~g~  534 (604)
T PF05170_consen  468 LTLDPLSAKL-YGGSLSGSASLDA----RQDPPQYSLNLNLRGVQLQPLLQDLALPDPLSGTGDLNLDLTGQ  534 (604)
T ss_pred             EEEeeeeEec-CCcEEEEEEEEec----cCCCccEEEeeeeCCcchHHHHhhhccccCceEEEEEEEEEEeC
Confidence            4445566666 7777666666542    22233455556666666532111111112234555555555443


No 44 
>PF03100 CcmE:  CcmE;  InterPro: IPR004329 CcmE is the product of one of a cluster of Ccm genes that are necessary for cytochrome c biosynthesis in eubacteria. Expression of these proteins is induced when the organisms are grown under anaerobic conditions with nitrate or nitrite as the final electron acceptor.; GO: 0017003 protein-heme linkage, 0017004 cytochrome complex assembly, 0005886 plasma membrane; PDB: 1SR3_A 2KCT_A 1J6Q_A 1LM0_A.
Probab=33.76  E-value=74  Score=24.07  Aligned_cols=8  Identities=25%  Similarity=0.584  Sum_probs=4.3

Q ss_pred             EEEEEECC
Q 037451          116 EIELLFFN  123 (220)
Q Consensus       116 ~~~v~Y~g  123 (220)
                      ++.|.|.|
T Consensus        83 ~i~V~Y~G   90 (131)
T PF03100_consen   83 EIPVVYTG   90 (131)
T ss_dssp             EEEEEEES
T ss_pred             EEEEEECC
Confidence            45555555


No 45 
>PF11322 DUF3124:  Protein of unknown function (DUF3124);  InterPro: IPR021471  This bacterial family of proteins has no known function. 
Probab=32.89  E-value=2.2e+02  Score=21.63  Aligned_cols=54  Identities=11%  Similarity=0.072  Sum_probs=36.7

Q ss_pred             eeeEEEEEEEEEecCCCeeeEEEecEEEEEEE--CCEEeecccCCCeeecCCCceEEEE
Q 037451           90 YFNGDFTFLANFSNPNRKIGARFEFLEIELLF--FNRLISTQIVQPFSQQPREQRLESV  146 (220)
Q Consensus        90 ~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y--~g~~lg~~~vp~f~q~~~~t~~v~~  146 (220)
                      ....+|+++|++||-+.+-.++-.+.+   +|  .|..+-+.--.|.+.++-.+..+-+
T Consensus        20 ~~~~~Lt~tLSiRNtd~~~~i~i~~v~---Yydt~G~lvr~yl~~Pi~L~Pl~t~~~vV   75 (125)
T PF11322_consen   20 HRPFNLTATLSIRNTDPTDPIYITSVD---YYDTDGKLVRSYLDKPIYLKPLATTEFVV   75 (125)
T ss_pred             CceEeEEEEEEEEcCCCCCCEEEEEEE---EECCCCeEhHHhcCCCeEcCCCceEEEEE
Confidence            456789999999999887777664432   33  3555555444677888887776543


No 46 
>PF07705 CARDB:  CARDB;  InterPro: IPR011635 The APHP (acidic peptide-dependent hydrolases/peptidase) domain is found in a variety of different proteins.; PDB: 2KUT_A 2L0D_A 3IDU_A 2KL6_A.
Probab=32.71  E-value=1.1e+02  Score=20.75  Aligned_cols=51  Identities=16%  Similarity=0.184  Sum_probs=29.9

Q ss_pred             EEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccCCCeeecCCCceEEEEEE
Q 037451           93 GDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQPFSQQPREQRLESVHM  148 (220)
Q Consensus        93 ~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~v~~~l  148 (220)
                      -.+.+++.++|--.. .  -..+.+.++..|..++...++.+.  ++.+..+...+
T Consensus        19 ~~~~i~~~V~N~G~~-~--~~~~~v~~~~~~~~~~~~~i~~L~--~g~~~~v~~~~   69 (101)
T PF07705_consen   19 EPVTITVTVKNNGTA-D--AENVTVRLYLDGNSVSTVTIPSLA--PGESETVTFTW   69 (101)
T ss_dssp             SEEEEEEEEEE-SSS----BEEEEEEEEETTEEEEEEEESEB---TTEEEEEEEEE
T ss_pred             CEEEEEEEEEECCCC-C--CCCEEEEEEECCceeccEEECCcC--CCcEEEEEEEE
Confidence            467777889996532 1  345678888888888666664433  34444444433


No 47 
>PF06919 Phage_T4_Gp30_7:  Phage Gp30.7 protein;  InterPro: IPR009690 This family consists of several phage Gp30.7 proteins of 121 residues in length. Family members seem to be exclusively from the T4-like viruses. The function of this family is unknown.
Probab=31.22  E-value=76  Score=23.38  Aligned_cols=40  Identities=13%  Similarity=0.233  Sum_probs=30.4

Q ss_pred             cCCCeeeEEEec-EEEEEEECCEEeecccCCCeeecCCCceE
Q 037451          103 NPNRKIGARFEF-LEIELLFFNRLISTQIVQPFSQQPREQRL  143 (220)
Q Consensus       103 NPN~~~~i~Y~~-~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~  143 (220)
                      ||| ++=+.|++ +.+++.|.|..+.-+.-..|.+..-.|..
T Consensus        40 ~pN-Yvf~~FEnG~tvsv~~~gs~~kI~~~Dd~r~RDLgTHP   80 (121)
T PF06919_consen   40 TPN-YVFMRFENGITVSVTYNGSIFKIGLDDDHRERDLGTHP   80 (121)
T ss_pred             CCC-EEEEEecCCCEEEEEecCcEEEEEecCchhhcccCCCc
Confidence            999 99999987 79999999987766665666655544433


No 48 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=30.99  E-value=2.6e+02  Score=21.84  Aligned_cols=18  Identities=11%  Similarity=0.220  Sum_probs=13.0

Q ss_pred             eEEEecEEEEEEECCEEe
Q 037451          109 GARFEFLEIELLFFNRLI  126 (220)
Q Consensus       109 ~i~Y~~~~~~v~Y~g~~l  126 (220)
                      +.+|=.+++.+.+.+...
T Consensus        77 ~~rylkv~i~L~~~~~~~   94 (162)
T PRK07021         77 ADRVLYVGLTLRLPDEAT   94 (162)
T ss_pred             CceEEEEEEEEEECCHHH
Confidence            467878888888876544


No 49 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=30.88  E-value=68  Score=25.21  Aligned_cols=21  Identities=14%  Similarity=0.132  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHhheeeeEEecC
Q 037451           49 SLILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        49 ~~l~l~lgi~~li~~lvl~P~   69 (220)
                      ++|++++.++++++|-+=+..
T Consensus        17 ~Ll~lLl~cgiGcvwhwkhr~   37 (158)
T PF11770_consen   17 SLLLLLLLCGIGCVWHWKHRD   37 (158)
T ss_pred             HHHHHHHHHhcceEEEeeccC
Confidence            344555666678888765543


No 50 
>COG1589 FtsQ Cell division septal protein [Cell envelope biogenesis, outer membrane]
Probab=30.78  E-value=56  Score=27.86  Aligned_cols=32  Identities=16%  Similarity=0.381  Sum_probs=24.2

Q ss_pred             HHHHHHHHhheeeeEEecCCCEEEecceeeee
Q 037451           51 ILIFFGIATLIIFLVIRPRTPVFDTPNANLST   82 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~~P~~~V~~~~v~~   82 (220)
                      .++++++.++++|....++.|-|.+..+++++
T Consensus        38 ~~~~~~~~~~~~~~~~~~~~~~~~i~~v~v~G   69 (269)
T COG1589          38 YLVLLLLVLVVLWVLILLSLPYFPIRKVSVSG   69 (269)
T ss_pred             HHHHHHHHHHHHheehhhhcCCccceEEEEec
Confidence            34455666777788888888888888888876


No 51 
>PF09911 DUF2140:  Uncharacterized protein conserved in bacteria (DUF2140);  InterPro: IPR018672  This family of conserved hypothetical proteins has no known function. 
Probab=30.60  E-value=75  Score=25.70  Aligned_cols=21  Identities=14%  Similarity=0.543  Sum_probs=14.6

Q ss_pred             HHHHHHHHhheeeeEEecCCC
Q 037451           51 ILIFFGIATLIIFLVIRPRTP   71 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~~P   71 (220)
                      +.+++++++++++.+++|..+
T Consensus        11 la~~l~~~~~~~~~~~~~~~~   31 (187)
T PF09911_consen   11 LALNLAFVIVVFFRLFQPSEP   31 (187)
T ss_pred             HHHHHHHHhheeeEEEccCCC
Confidence            344556667777788999866


No 52 
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=29.78  E-value=75  Score=21.90  Aligned_cols=7  Identities=29%  Similarity=0.686  Sum_probs=2.8

Q ss_pred             HHHHHHH
Q 037451           52 LIFFGIA   58 (220)
Q Consensus        52 ~l~lgi~   58 (220)
                      ++++|++
T Consensus        55 llv~G~~   61 (82)
T PF11239_consen   55 LLVAGVV   61 (82)
T ss_pred             HHHHHHH
Confidence            3344443


No 53 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=29.26  E-value=23  Score=26.80  Aligned_cols=24  Identities=25%  Similarity=0.355  Sum_probs=8.5

Q ss_pred             HHHHHhheeeeEEec-CCCEEEecc
Q 037451           54 FFGIATLIIFLVIRP-RTPVFDTPN   77 (220)
Q Consensus        54 ~lgi~~li~~lvl~P-~~P~~~V~~   77 (220)
                      ++|++++|+|++-|= |.+...++.
T Consensus        77 vIg~Illi~y~irR~~Kk~~~~~~p  101 (122)
T PF01102_consen   77 VIGIILLISYCIRRLRKKSSSDVQP  101 (122)
T ss_dssp             HHHHHHHHHHHHHHHS---------
T ss_pred             HHHHHHHHHHHHHHHhccCCCCCCC
Confidence            455566666766432 334444443


No 54 
>PF09604 Potass_KdpF:  F subunit of K+-transporting ATPase (Potass_KdpF);  InterPro: IPR011726 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the F subunit (KdpF) of a P-type K+-translocating ATPase (Kdp). KdpF is a very small integral membrane peptide. The kdpABC operon of Escherichia coli codes for the high affinity K+-translocating Kdp complex []. KdpF is found upstream of the KdpA subunit (IPR004623 from INTERPRO). Because of its very small size and highly hydrophobic character, it is sometimes missed in genome annotation. More information about this protein can be found at Protein of the Month: ATP Synthases [].
Probab=29.13  E-value=23  Score=19.11  Aligned_cols=19  Identities=11%  Similarity=0.443  Sum_probs=11.0

Q ss_pred             HHHHHHHHhheeeeEEecC
Q 037451           51 ILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~   69 (220)
                      +++.+++++..+|-.++|.
T Consensus         5 ~~v~~~L~~YL~~aLl~PE   23 (25)
T PF09604_consen    5 GIVAVALFVYLFYALLRPE   23 (25)
T ss_pred             HHHHHHHHHHHHHHHhCcc
Confidence            3444555555555567775


No 55 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=29.10  E-value=21  Score=22.11  Aligned_cols=18  Identities=33%  Similarity=0.584  Sum_probs=9.2

Q ss_pred             HHHHHHhheeeeEEecCC
Q 037451           53 IFFGIATLIIFLVIRPRT   70 (220)
Q Consensus        53 l~lgi~~li~~lvl~P~~   70 (220)
                      +++++.++++|.+++|+.
T Consensus        17 ~~~~~F~gi~~w~~~~~~   34 (49)
T PF05545_consen   17 LFFVFFIGIVIWAYRPRN   34 (49)
T ss_pred             HHHHHHHHHHHHHHcccc
Confidence            333444444444677863


No 56 
>PF06129 Chordopox_G3:  Chordopoxvirus G3 protein;  InterPro: IPR010367 This family consists of several poxvirus specific G3 proteins. The function of this family is unknown.
Probab=28.87  E-value=64  Score=23.91  Aligned_cols=30  Identities=13%  Similarity=0.269  Sum_probs=16.4

Q ss_pred             EEEEEEEecCCC----eeeEEEec--EEEEEEECCE
Q 037451           95 FTFLANFSNPNR----KIGARFEF--LEIELLFFNR  124 (220)
Q Consensus        95 ~~~~l~v~NPN~----~~~i~Y~~--~~~~v~Y~g~  124 (220)
                      .--++-+.|||+    .+.++|++  ..+.+.|+|.
T Consensus        51 ~~~t~lF~~~~~~~~~~v~l~Yds~~~~Vtv~~~~~   86 (109)
T PF06129_consen   51 LLNTVLFLNPDKPVSSQVILYYDSRSGTVTVAYKNK   86 (109)
T ss_pred             ceeeEEecCCCcccccceEEEEccCCCeEEEEECCc
Confidence            334566778873    35566654  3345555543


No 57 
>PHA03029 hypothetical protein; Provisional
Probab=28.57  E-value=67  Score=22.14  Aligned_cols=37  Identities=14%  Similarity=0.324  Sum_probs=25.1

Q ss_pred             ccccchhhhHHHHHHHHHHHHHHHHHhheeeeEEecCC
Q 037451           33 QTNILIWCCATLCLIFSLILIFFGIATLIIFLVIRPRT   70 (220)
Q Consensus        33 r~~~~~~C~~~l~~~~~~l~l~lgi~~li~~lvl~P~~   70 (220)
                      ||+++-|..-++++++ -+.+.+|.-.+-.|.+..|..
T Consensus        48 rrkg~ywflnf~fwll-p~al~a~fyffsiw~imnpqa   84 (92)
T PHA03029         48 RRKGLYWFLNFLFWLL-PFALAAAFYFFSIWFIMNPQA   84 (92)
T ss_pred             HhhhHHHHHHHHHHHH-HHHHHHHHHHHHhhheecccc
Confidence            4556678888888774 344555555667788888864


No 58 
>COG3121 FimC P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=28.55  E-value=1.4e+02  Score=25.06  Aligned_cols=40  Identities=18%  Similarity=0.182  Sum_probs=23.5

Q ss_pred             EEEEecCCCeeeEEEecEEEEEEECCEEeecccCCCeeecCCCceE
Q 037451           98 LANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQPFSQQPREQRL  143 (220)
Q Consensus        98 ~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~  143 (220)
                      .|+++||- -.-+.+...++..  +|..++   ....++.++++..
T Consensus       166 ~l~v~Npt-py~vtl~~~~l~~--~~~~~~---~~~~mv~P~s~~~  205 (235)
T COG3121         166 LLTVKNPT-PYYVTLANLTLNV--GGRKLG---LNSGMVAPFSTRQ  205 (235)
T ss_pred             EEEEECCC-CcEEEEEEEEEee--CceecC---CCcceECCCccce
Confidence            58899999 4556665555555  666665   3334444444443


No 59 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=27.88  E-value=41  Score=28.08  Aligned_cols=7  Identities=29%  Similarity=0.387  Sum_probs=3.2

Q ss_pred             HHHHHhh
Q 037451          161 VELRKQV  167 (220)
Q Consensus       161 ~~l~~d~  167 (220)
                      .+|.+.+
T Consensus       153 ~Em~~Ai  159 (217)
T PF07423_consen  153 NEMLKAI  159 (217)
T ss_pred             HHHHHHH
Confidence            4444444


No 60 
>KOG3927 consensus Na+/K+ ATPase, beta subunit [Inorganic ion transport and metabolism]
Probab=27.58  E-value=70  Score=28.05  Aligned_cols=49  Identities=14%  Similarity=0.290  Sum_probs=26.6

Q ss_pred             cchhhhHHHHHHHHHHHHHHHHHhheeee---EEecCCCEEEecceeeeeEEcC
Q 037451           36 ILIWCCATLCLIFSLILIFFGIATLIIFL---VIRPRTPVFDTPNANLSTIYFD   86 (220)
Q Consensus        36 ~~~~C~~~l~~~~~~l~l~lgi~~li~~l---vl~P~~P~~~V~~~~v~~f~~~   86 (220)
                      .+.|+--+++.++ +-+++++++++++|.   .+.|+.|++. ++..=.++.+.
T Consensus        41 ~~sW~~IllfYiv-FY~~la~lf~~~~~~~~~tidp~~P~~~-~~~~~PGl~~~   92 (300)
T KOG3927|consen   41 GSSWAKILLFYIV-FYGVLAALFAGCMWFMLQTIDPKVPKYK-DSGANPGLSFR   92 (300)
T ss_pred             cccHHHHHHHHHH-HHHHHHHHHHHHHHHHHHhcCCCCCccc-ccCCCCceeec
Confidence            3456665454443 223444444444454   4789999999 44332444443


No 61 
>PF07787 DUF1625:  Protein of unknown function (DUF1625);  InterPro: IPR012430 Sequences making up this family are derived from hypothetical proteins expressed by both prokaryotic and eukaryotic species. The region in question is approximately 250 residues long. 
Probab=27.21  E-value=67  Score=27.02  Aligned_cols=13  Identities=23%  Similarity=0.475  Sum_probs=9.0

Q ss_pred             HHHhheeeeEEec
Q 037451           56 GIATLIIFLVIRP   68 (220)
Q Consensus        56 gi~~li~~lvl~P   68 (220)
                      .+++.+.|+.+||
T Consensus       236 l~~Ia~aW~~yRP  248 (248)
T PF07787_consen  236 LLTIALAWLFYRP  248 (248)
T ss_pred             HHHHHHhheeeCc
Confidence            3445677888887


No 62 
>PF11797 DUF3324:  Protein of unknown function C-terminal (DUF3324);  InterPro: IPR021759  This family consists of several hypothetical bacterial proteins of unknown function. 
Probab=27.06  E-value=2.8e+02  Score=21.03  Aligned_cols=90  Identities=14%  Similarity=0.138  Sum_probs=57.2

Q ss_pred             CCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEECC--EEeecccCCCeeecCCCceEEEEE
Q 037451           70 TPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFFN--RLISTQIVQPFSQQPREQRLESVH  147 (220)
Q Consensus        70 ~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g--~~lg~~~vp~f~q~~~~t~~v~~~  147 (220)
                      .|.+.+.++.....        +..-.+.+.++||+. .-+.=-.+++.|+..|  ..+.......+...+.+.-.+.+.
T Consensus        27 ~p~L~l~~v~~~~~--------n~~~~i~~~l~N~~~-~~l~~~~v~a~V~~~~~~k~~~~~~~~~~~mAPNS~f~~~i~   97 (140)
T PF11797_consen   27 PPKLKLGKVKPGQI--------NGRNVIQANLQNPQP-AILKKLTVDAKVTKKGSKKVLYTFKKENMQMAPNSNFNFPIP   97 (140)
T ss_pred             CcccEEeeeeeeEE--------CCeeEEEEEEECCCc-hhhcCcEEEEEEEECCCCeEEEEeeccCCEECCCCeEEeEec
Confidence            56666666665543        445666788899882 2222224677777766  467777778888888886555433


Q ss_pred             EEeeeeecCHHHHHHHHHhhcCCeEEEEEEEEEEE
Q 037451          148 MISSLVFMPQDHAVELRKQVQNNRINYNIRASFKV  182 (220)
Q Consensus       148 l~~~~v~l~~~~~~~l~~d~~~G~v~l~v~~~~~v  182 (220)
                      +.+              +.+..|...+.+.++..-
T Consensus        98 ~~~--------------~~lk~G~Y~l~~~~~~~~  118 (140)
T PF11797_consen   98 LGG--------------KKLKPGKYTLKITAKSGK  118 (140)
T ss_pred             CCC--------------cCccCCEEEEEEEEEcCC
Confidence            321              135788888887776443


No 63 
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I.  Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center.  ccoQ, the fourth subunit, is a single transmembrane helix protein.  It has been shown to protect the core complex from proteolytic degradation by serine proteases.  See cd00919, cd01322
Probab=26.45  E-value=29  Score=21.67  Aligned_cols=18  Identities=11%  Similarity=0.102  Sum_probs=9.3

Q ss_pred             HHHHHHhheeeeEEecCC
Q 037451           53 IFFGIATLIIFLVIRPRT   70 (220)
Q Consensus        53 l~lgi~~li~~lvl~P~~   70 (220)
                      +++++.+++++-+++|+.
T Consensus        18 ~~~~~Figiv~wa~~p~~   35 (48)
T cd01324          18 YLALFFLGVVVWAFRPGR   35 (48)
T ss_pred             HHHHHHHHHHHHHhCCCc
Confidence            334444444444677863


No 64 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=26.01  E-value=90  Score=22.55  Aligned_cols=14  Identities=21%  Similarity=0.486  Sum_probs=6.3

Q ss_pred             HHHHHhheeee-EEe
Q 037451           54 FFGIATLIIFL-VIR   67 (220)
Q Consensus        54 ~lgi~~li~~l-vl~   67 (220)
                      ++.++.+|.|+ ++|
T Consensus        74 IlVily~IyYFVILR   88 (101)
T PF06024_consen   74 ILVILYAIYYFVILR   88 (101)
T ss_pred             HHHHHhhheEEEEEe
Confidence            33333445555 454


No 65 
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=25.79  E-value=1.1e+02  Score=19.37  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 037451           44 LCLIFSLILIFFGIATL   60 (220)
Q Consensus        44 l~~~~~~l~l~lgi~~l   60 (220)
                      -..++..+++++|++++
T Consensus        17 gGLi~A~vlfi~Gi~ii   33 (50)
T PF02038_consen   17 GGLIFAGVLFILGILII   33 (50)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHH
Confidence            34445556677776654


No 66 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=25.06  E-value=28  Score=22.93  Aligned_cols=16  Identities=25%  Similarity=0.463  Sum_probs=9.7

Q ss_pred             HHHHHhheeeeEEecC
Q 037451           54 FFGIATLIIFLVIRPR   69 (220)
Q Consensus        54 ~lgi~~li~~lvl~P~   69 (220)
                      +..+.++++|.+++|+
T Consensus        18 ~~l~fiavi~~ayr~~   33 (60)
T COG4736          18 FTLFFIAVIYFAYRPG   33 (60)
T ss_pred             HHHHHHHHHHHHhccc
Confidence            3344455666678886


No 67 
>PF14874 PapD-like:  Flagellar-associated PapD-like
Probab=25.00  E-value=2.4e+02  Score=19.55  Aligned_cols=53  Identities=19%  Similarity=0.147  Sum_probs=31.0

Q ss_pred             EEEEEEEEEecCCCeeeEEEecEEEEEEECCEEeecccCCCeeecCCCceEEEEEEE
Q 037451           93 GDFTFLANFSNPNRKIGARFEFLEIELLFFNRLISTQIVQPFSQQPREQRLESVHMI  149 (220)
Q Consensus        93 ~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g~~lg~~~vp~f~q~~~~t~~v~~~l~  149 (220)
                      ......++++|-. ....+|.=....  ..+..+. ..-++....++.+..+++++.
T Consensus        20 ~~~~~~v~l~N~s-~~p~~f~v~~~~--~~~~~~~-v~~~~g~l~PG~~~~~~V~~~   72 (102)
T PF14874_consen   20 QTYSRTVTLTNTS-SIPARFRVRQPE--SLSSFFS-VEPPSGFLAPGESVELEVTFS   72 (102)
T ss_pred             CEEEEEEEEEECC-CCCEEEEEEeCC--cCCCCEE-EECCCCEECCCCEEEEEEEEE
Confidence            4567788999988 556666421100  0111121 123455688888888888887


No 68 
>PRK11677 hypothetical protein; Provisional
Probab=24.87  E-value=53  Score=25.28  Aligned_cols=18  Identities=22%  Similarity=0.265  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHhheee
Q 037451           46 LIFSLILIFFGIATLIIF   63 (220)
Q Consensus        46 ~~~~~l~l~lgi~~li~~   63 (220)
                      |++.++.+++|++++++.
T Consensus         3 W~~a~i~livG~iiG~~~   20 (134)
T PRK11677          3 WEYALIGLVVGIIIGAVA   20 (134)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344455666676666554


No 69 
>PF10177 DUF2371:  Uncharacterised conserved protein (DUF2371);  InterPro: IPR018787  This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. 
Probab=24.50  E-value=1.1e+02  Score=23.81  Aligned_cols=29  Identities=21%  Similarity=0.541  Sum_probs=15.7

Q ss_pred             hhhHHHHHHH--HHHHHHHHHHhheeeeEEecC
Q 037451           39 WCCATLCLIF--SLILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        39 ~C~~~l~~~~--~~l~l~lgi~~li~~lvl~P~   69 (220)
                      .||...|.++  =++++++|+++.++  -|.|+
T Consensus        34 rl~s~Sg~~l~lG~lvllvGiaMAv~--GYwp~   64 (141)
T PF10177_consen   34 RLCSPSGLFLLLGILVLLVGIAMAVL--GYWPK   64 (141)
T ss_pred             EEecHHHHHHHHHHHHHHHhhHhhee--ecccc
Confidence            4554444443  24566777766554  24566


No 70 
>PRK05751 preprotein translocase subunit SecB; Validated
Probab=23.98  E-value=3.6e+02  Score=21.23  Aligned_cols=18  Identities=17%  Similarity=0.401  Sum_probs=12.9

Q ss_pred             CCEEEecceeeeeEEcCC
Q 037451           70 TPVFDTPNANLSTIYFDS   87 (220)
Q Consensus        70 ~P~~~V~~~~v~~f~~~~   87 (220)
                      .|.|.+....+.++++-+
T Consensus        10 ~p~~~i~~~YiKDlSfE~   27 (156)
T PRK05751         10 QPQFQIQRIYTKDLSFEN   27 (156)
T ss_pred             CCcEEEEEEEEeeecccC
Confidence            477777777777777743


No 71 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=23.91  E-value=88  Score=28.52  Aligned_cols=9  Identities=22%  Similarity=0.704  Sum_probs=3.9

Q ss_pred             hhhHHHHHH
Q 037451           39 WCCATLCLI   47 (220)
Q Consensus        39 ~C~~~l~~~   47 (220)
                      .|||.-+.+
T Consensus        58 ~~~c~~~~~   66 (406)
T PF04906_consen   58 RCCCLTWSL   66 (406)
T ss_pred             CCcchHHHH
Confidence            344444444


No 72 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=23.89  E-value=69  Score=26.72  Aligned_cols=10  Identities=10%  Similarity=0.155  Sum_probs=6.5

Q ss_pred             eEEecCCCEE
Q 037451           64 LVIRPRTPVF   73 (220)
Q Consensus        64 lvl~P~~P~~   73 (220)
                      -+++||....
T Consensus       181 K~~K~K~~~~  190 (218)
T PF14283_consen  181 KFYKPKQEEK  190 (218)
T ss_pred             EEeccccccc
Confidence            3788875544


No 73 
>PRK00523 hypothetical protein; Provisional
Probab=23.66  E-value=81  Score=21.56  Aligned_cols=18  Identities=17%  Similarity=0.133  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHHhhee
Q 037451           45 CLIFSLILIFFGIATLII   62 (220)
Q Consensus        45 ~~~~~~l~l~lgi~~li~   62 (220)
                      ++++.++.+++|++++.+
T Consensus         7 ~I~l~i~~li~G~~~Gff   24 (72)
T PRK00523          7 ALGLGIPLLIVGGIIGYF   24 (72)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            334444556666665544


No 74 
>PF09307 MHC2-interact:  CLIP, MHC2 interacting;  InterPro: IPR015386 This domain is found in MHC class II-associated invariant chain (Ii), and in class II invariant chain-associated peptide (CLIP), and is required for association with class II major histocompatibility complex (MHC II) in the MHC II processing pathway []. Ii plays a critical role in the assembly of the MHC, as well as in MHC II antigen processing by stabilising peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place []. In antigen-presenting cells (APCs), loading of MHC II molecules with peptides is regulated by Ii, which blocks MHC II antigen-binding sites in pre-endosomal compartments []. Several factors modulate the surface expression of MHC II molecules via post-Golgi mechanisms, including CLIP. The Invariant chain contains a single transmembrane domain. Ii first assembles into a trimer and then associates with three class II alpha/beta MHC heterodimers. Although the membrane-proximal region of the Ii luminal domain is structurally disordered, the C-terminal segment of the luminal domain is largely alpha-helical and contains a major interaction site for the Ii trimer []. More information about these proteins can be found at Protein of the Month: MHC [].; GO: 0042289 MHC class II protein binding, 0006886 intracellular protein transport, 0006955 immune response, 0019882 antigen processing and presentation, 0016020 membrane; PDB: 1A6A_C 3QXD_F 3QXA_F 3PDO_C 1MUJ_C 3PGD_F 3PGC_F.
Probab=23.64  E-value=26  Score=26.15  Aligned_cols=29  Identities=17%  Similarity=0.170  Sum_probs=0.0

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHhheeeeEEe
Q 037451           38 IWCCATLCLIFSLILIFFGIATLIIFLVIR   67 (220)
Q Consensus        38 ~~C~~~l~~~~~~l~l~lgi~~li~~lvl~   67 (220)
                      .+++.+..+.+++.++++|-++.+ |++|.
T Consensus        29 sra~~vagltvLa~LLiAGQa~Ta-Yfv~~   57 (114)
T PF09307_consen   29 SRALKVAGLTVLACLLIAGQAVTA-YFVFQ   57 (114)
T ss_dssp             ------------------------------
T ss_pred             cchhHHHHHHHHHHHHHHhHHHHH-HHHHH
Confidence            345445555555556666655544 45665


No 75 
>COG2332 CcmE Cytochrome c-type biogenesis protein CcmE [Posttranslational modification, protein turnover, chaperones]
Probab=23.61  E-value=3.5e+02  Score=21.30  Aligned_cols=33  Identities=9%  Similarity=0.157  Sum_probs=19.8

Q ss_pred             EEEecCCCeeeEEEecEEEEEEECCE-EeecccC
Q 037451           99 ANFSNPNRKIGARFEFLEIELLFFNR-LISTQIV  131 (220)
Q Consensus        99 l~v~NPN~~~~i~Y~~~~~~v~Y~g~-~lg~~~v  131 (220)
                      +.+.--|..+.+.|+.+-=++|=.|+ .++.+.+
T Consensus        76 F~vtD~~~~v~V~Y~GiLPDLFREGQgVVa~G~~  109 (153)
T COG2332          76 FVVTDGNKSVTVSYEGILPDLFREGQGVVAEGQL  109 (153)
T ss_pred             EEEecCCceEEEEEeccCchhhhcCCeEEEEEEe
Confidence            34445566678888776666666665 3444444


No 76 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=23.49  E-value=77  Score=26.37  Aligned_cols=18  Identities=22%  Similarity=0.501  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 037451           43 TLCLIFSLILIFFGIATL   60 (220)
Q Consensus        43 ~l~~~~~~l~l~lgi~~l   60 (220)
                      +.|+|++.++++++.+++
T Consensus       131 LIClIIIAVLfLICT~Lf  148 (227)
T PF05399_consen  131 LICLIIIAVLFLICTLLF  148 (227)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566666555555554443


No 77 
>PRK13150 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=23.44  E-value=3e+02  Score=21.84  Aligned_cols=28  Identities=7%  Similarity=0.040  Sum_probs=13.8

Q ss_pred             EEEEEEecCCCeeeEEEecEEEEEEECC
Q 037451           96 TFLANFSNPNRKIGARFEFLEIELLFFN  123 (220)
Q Consensus        96 ~~~l~v~NPN~~~~i~Y~~~~~~v~Y~g  123 (220)
                      .+.+.+...+..+.+.|+.+-=++|=.|
T Consensus        79 ~v~F~vtD~~~~v~V~Y~GilPDlFrEG  106 (159)
T PRK13150         79 KVNFSLYDAEGSVTVSYEGILPDLFREG  106 (159)
T ss_pred             EEEEEEEcCCcEEEEEEeccCCccccCC
Confidence            3444555555455555555444444444


No 78 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=23.31  E-value=71  Score=26.66  Aligned_cols=6  Identities=17%  Similarity=0.257  Sum_probs=2.4

Q ss_pred             HHHHHH
Q 037451           43 TLCLIF   48 (220)
Q Consensus        43 ~l~~~~   48 (220)
                      +|=++|
T Consensus        15 iLNiaI   20 (217)
T PF07423_consen   15 ILNIAI   20 (217)
T ss_pred             hHHHHH
Confidence            444443


No 79 
>PRK01844 hypothetical protein; Provisional
Probab=23.08  E-value=86  Score=21.45  Aligned_cols=16  Identities=13%  Similarity=0.335  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHhhee
Q 037451           47 IFSLILIFFGIATLII   62 (220)
Q Consensus        47 ~~~~l~l~lgi~~li~   62 (220)
                      ++.++.+++|++++.+
T Consensus         8 ~l~I~~li~G~~~Gff   23 (72)
T PRK01844          8 LVGVVALVAGVALGFF   23 (72)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3344556666665544


No 80 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.59  E-value=89  Score=21.26  Aligned_cols=15  Identities=7%  Similarity=0.330  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 037451           46 LIFSLILIFFGIATL   60 (220)
Q Consensus        46 ~~~~~l~l~lgi~~l   60 (220)
                      ++++++.+++|++.+
T Consensus         7 il~ivl~ll~G~~~G   21 (71)
T COG3763           7 ILLIVLALLAGLIGG   21 (71)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344445566666665


No 81 
>PRK13031 preprotein translocase subunit SecB; Provisional
Probab=22.57  E-value=3.8e+02  Score=20.99  Aligned_cols=17  Identities=18%  Similarity=0.452  Sum_probs=10.8

Q ss_pred             CCEEEecceeeeeEEcC
Q 037451           70 TPVFDTPNANLSTIYFD   86 (220)
Q Consensus        70 ~P~~~V~~~~v~~f~~~   86 (220)
                      .|.|.++...+.++++.
T Consensus         6 ~p~f~I~~~YvKDlSFE   22 (149)
T PRK13031          6 QPQFQIQKVYVKDLSFS   22 (149)
T ss_pred             CCeeEeeeEEeeeeccc
Confidence            36666666666666664


No 82 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=22.47  E-value=1.2e+02  Score=18.00  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=5.5

Q ss_pred             HHHhheeeeEE
Q 037451           56 GIATLIIFLVI   66 (220)
Q Consensus        56 gi~~li~~lvl   66 (220)
                      -+..+|+|+++
T Consensus        22 ~imliif~f~l   32 (43)
T PF11395_consen   22 IIMLIIFWFSL   32 (43)
T ss_pred             HHHHHHHHHHH
Confidence            33445566544


No 83 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=22.38  E-value=30  Score=30.28  Aligned_cols=17  Identities=24%  Similarity=0.675  Sum_probs=10.8

Q ss_pred             HHHHHHHHhheeeeEEe
Q 037451           51 ILIFFGIATLIIFLVIR   67 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~   67 (220)
                      +++++.++++|+||++|
T Consensus       264 aIliIVLIMvIIYLILR  280 (299)
T PF02009_consen  264 AILIIVLIMVIIYLILR  280 (299)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34445556777788766


No 84 
>PF07184 CTV_P33:  Citrus tristeza virus P33 protein;  InterPro: IPR010803 This family consists of several Citrus tristeza virus (CTV) P33 proteins. The function of P33 is unclear although it is known that the protein is not needed for virion formation [].
Probab=22.23  E-value=81  Score=26.04  Aligned_cols=24  Identities=29%  Similarity=0.832  Sum_probs=15.4

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhhee
Q 037451           39 WCCATLCLIFSLILIFFGIATLII   62 (220)
Q Consensus        39 ~C~~~l~~~~~~l~l~lgi~~li~   62 (220)
                      -||--.|.+.+.++++-|+.++|+
T Consensus       279 vccyavcvlvvs~limsgllaii~  302 (303)
T PF07184_consen  279 VCCYAVCVLVVSLLIMSGLLAIIF  302 (303)
T ss_pred             HHHHHHHHHHHHHHHHhcchheEe
Confidence            454456666666777778776654


No 85 
>KOG3385 consensus V-SNARE [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.04  E-value=98  Score=23.21  Aligned_cols=19  Identities=16%  Similarity=0.467  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHHHHhheee
Q 037451           43 TLCLIFSLILIFFGIATLIIF   63 (220)
Q Consensus        43 ~l~~~~~~l~l~lgi~~li~~   63 (220)
                      ++|+++  ++++++++++..|
T Consensus        98 l~~~m~--~f~lV~~fi~~~~  116 (118)
T KOG3385|consen   98 LLCWMA--VFSLVAFFILWVW  116 (118)
T ss_pred             hHHHHH--HHHHHHHHHhhee
Confidence            445553  3344454444444


No 86 
>COG3736 VirB8 Type IV secretory pathway, component VirB8 [Intracellular trafficking and secretion]
Probab=21.95  E-value=77  Score=26.84  Aligned_cols=13  Identities=31%  Similarity=0.547  Sum_probs=9.1

Q ss_pred             cchhhhHHHHHHH
Q 037451           36 ILIWCCATLCLIF   48 (220)
Q Consensus        36 ~~~~C~~~l~~~~   48 (220)
                      +..||.|+++.++
T Consensus        41 ~~~~~va~~~~~l   53 (239)
T COG3736          41 RLAWRVAILFTLL   53 (239)
T ss_pred             HHHHHHHHHHHHH
Confidence            5678877776664


No 87 
>PF11628 TCR_zetazeta:  T-cell surface glycoprotein CD3 zeta chain;  InterPro: IPR021663 The TCR complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer co-expressed at the cell surface with the invariant subunits of CD3 labelled gamma, delta, epsilon, zeta, and eta []. The zeta subunit forms either homodimers or heterodimers with eta [], but eta homodimers have not been observed. The structure of the zetazeta transmembrane dimer consists of a left-handed coiled coil with polar contacts. Two aspartic acids are critical for zetazeta dimerisation and assembly with TCR [].  The high affinity immunoglobulin epsilon receptor (IgE Fc receptor) subunit gamma associates with a variety of FcR alpha chains to form a functional signaling complex. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface and regulates several aspects of the immune response []. This family includes both CD3 zeta subunits and IgE Fc receptor gamma subunits. The gamma chain of the high affinity Fc receptor for IgE has significant structural homology to CD3 zeta and the related CD3 eta subunit and can facilitate T cell receptor expression and signaling in the absence of CD3 zeta and CD3 eta [].; PDB: 2HAC_B.
Probab=21.65  E-value=75  Score=18.29  Aligned_cols=21  Identities=33%  Similarity=0.733  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHhheeee
Q 037451           44 LCLIFSLILIFFGIATLIIFL   64 (220)
Q Consensus        44 l~~~~~~l~l~lgi~~li~~l   64 (220)
                      +|.++=.++++-|+++.++|+
T Consensus         4 lCYiLDgiL~iYgiiiT~L~~   24 (33)
T PF11628_consen    4 LCYILDGILFIYGIIITALYC   24 (33)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             eeeeHHHHHHHHHHHHHHHHH
Confidence            456655667778888877764


No 88 
>PF15145 DUF4577:  Domain of unknown function (DUF4577)
Probab=21.62  E-value=88  Score=23.33  Aligned_cols=21  Identities=19%  Similarity=0.645  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHhheeeeEEecC
Q 037451           49 SLILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        49 ~~l~l~lgi~~li~~lvl~P~   69 (220)
                      +++++.++++.++++|+++-.
T Consensus        69 i~LivSLaLVsFvIFLiiQTg   89 (128)
T PF15145_consen   69 IVLIVSLALVSFVIFLIIQTG   89 (128)
T ss_pred             HHHHHHHHHHHHHHHheeecc
Confidence            345566677777778887753


No 89 
>PHA02973 hypothetical protein; Provisional
Probab=21.21  E-value=2.6e+02  Score=20.37  Aligned_cols=53  Identities=11%  Similarity=0.072  Sum_probs=28.1

Q ss_pred             hheeeeEEecC-CCEEEecceeeeeEEcCCCCeeeEEEEEEEEEecCCCeeeEEEecEEEEEEEC
Q 037451           59 TLIIFLVIRPR-TPVFDTPNANLSTIYFDSPEYFNGDFTFLANFSNPNRKIGARFEFLEIELLFF  122 (220)
Q Consensus        59 ~li~~lvl~P~-~P~~~V~~~~v~~f~~~~~~~l~~~~~~~l~v~NPN~~~~i~Y~~~~~~v~Y~  122 (220)
                      ++..|+-+.|. .-...|....-.+.. ++     .....++-+.||++.+     ...+.++|+
T Consensus        13 ~l~Y~fn~~pTNKmq~aV~~l~~e~~~-d~-----p~~l~t~lF~~~~~~~-----~~~v~~yyd   66 (102)
T PHA02973         13 LLCYFFNFKRTNKMDIGINPIKKIPWS-DN-----DHIFVSSLFHNKDKYL-----TGPMKLNYD   66 (102)
T ss_pred             HHHHHhhccccchhhhhhhhccccccc-CC-----CceeEEEEecCCCCcc-----ccceEEEEc
Confidence            34445567774 455555555444421 22     2355567788988642     344555554


No 90 
>PF08956 DUF1869:  Domain of unknown function (DUF1869);  InterPro: IPR015051 This domain is found in a set of hypothetical bacterial proteins. ; PDB: 1NEI_A.
Probab=20.99  E-value=1.2e+02  Score=19.85  Aligned_cols=19  Identities=26%  Similarity=0.405  Sum_probs=11.0

Q ss_pred             EEEEEEecCCCeeeEEEec
Q 037451           96 TFLANFSNPNRKIGARFEF  114 (220)
Q Consensus        96 ~~~l~v~NPN~~~~i~Y~~  114 (220)
                      +++|++.|-|..+++.|+.
T Consensus         5 ~~~LTvTNn~NGVSVDk~~   23 (60)
T PF08956_consen    5 EFTLTVTNNNNGVSVDKEF   23 (60)
T ss_dssp             -EEEEEEETTT--EEEEEE
T ss_pred             eEEEEEEeCCCceEeeccc
Confidence            3567787766577777754


No 91 
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=20.92  E-value=80  Score=22.21  Aligned_cols=12  Identities=25%  Similarity=0.609  Sum_probs=5.4

Q ss_pred             HHHHHHHhheee
Q 037451           52 LIFFGIATLIIF   63 (220)
Q Consensus        52 ~l~lgi~~li~~   63 (220)
                      ++++++++.|+|
T Consensus        78 ~~f~~~v~yI~~   89 (92)
T PF03908_consen   78 LFFLLVVLYILW   89 (92)
T ss_pred             HHHHHHHHHHhh
Confidence            344444444443


No 92 
>PHA03281 envelope glycoprotein E; Provisional
Probab=20.84  E-value=1.1e+02  Score=29.04  Aligned_cols=15  Identities=33%  Similarity=0.576  Sum_probs=11.1

Q ss_pred             CCCCCCCCCCCCCCC
Q 037451            1 PPINHQSPAPETEPL   15 (220)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (220)
                      ||-+|++|++.+++-
T Consensus       524 P~~~~~~~s~~~p~~  538 (642)
T PHA03281        524 PPEAGNPPAPSKPKE  538 (642)
T ss_pred             CccCCCCCCCCCccc
Confidence            566788888887665


No 93 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=20.78  E-value=32  Score=29.85  Aligned_cols=17  Identities=24%  Similarity=0.718  Sum_probs=8.9

Q ss_pred             HHHHHHHHHhheeeeEE
Q 037451           50 LILIFFGIATLIIFLVI   66 (220)
Q Consensus        50 ~l~l~lgi~~li~~lvl   66 (220)
                      ++++++.++++|+|+++
T Consensus       266 lvllil~vvliiLYiWl  282 (295)
T TIGR01478       266 LVLIILTVVLIILYIWL  282 (295)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34445555556665543


No 94 
>TIGR02115 potass_kdpF K+-transporting ATPase, KdpF subunit. This model describes a very small integral membrane peptide KdpF, a subunit of the K(+)-translocating Kdp complex. It is found upstream of the KdpA subunit (TIGR00680). Because of its very small size and highly hydrophobic character, it is sometimes missed in genome annotation.
Probab=20.67  E-value=20  Score=19.51  Aligned_cols=19  Identities=16%  Similarity=0.644  Sum_probs=10.6

Q ss_pred             HHHHHHHHhheeeeEEecC
Q 037451           51 ILIFFGIATLIIFLVIRPR   69 (220)
Q Consensus        51 l~l~lgi~~li~~lvl~P~   69 (220)
                      +++.+++++..+|-.++|.
T Consensus         4 ~~l~~~L~~YL~~aLl~PE   22 (26)
T TIGR02115         4 LVLAVGLFIYLFYALLRPE   22 (26)
T ss_pred             HHHHHHHHHHHHHHHhCHH
Confidence            3444555555555567775


No 95 
>PF12321 DUF3634:  Protein of unknown function (DUF3634);  InterPro: IPR022090  This family of proteins is found in bacteria. Proteins in this family are typically between 103 and 114 amino acids in length. 
Probab=20.45  E-value=37  Score=25.15  Aligned_cols=23  Identities=39%  Similarity=0.696  Sum_probs=11.0

Q ss_pred             heeeeEEecC--CCEEEe--cceeeee
Q 037451           60 LIIFLVIRPR--TPVFDT--PNANLST   82 (220)
Q Consensus        60 li~~lvl~P~--~P~~~V--~~~~v~~   82 (220)
                      +++||++-=+  .|.|.|  ++-.+..
T Consensus        11 li~~Lv~~~r~~~~vf~i~f~dG~l~~   37 (108)
T PF12321_consen   11 LIFWLVFVDRRGLPVFEIHFKDGRLRV   37 (108)
T ss_pred             HHHHHHHccccCceEEEEEEECCcEEE
Confidence            6666654332  355544  3444443


No 96 
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=20.20  E-value=1e+02  Score=24.81  Aligned_cols=16  Identities=25%  Similarity=0.183  Sum_probs=11.8

Q ss_pred             EEEecEEEEEEECCEE
Q 037451          110 ARFEFLEIELLFFNRL  125 (220)
Q Consensus       110 i~Y~~~~~~v~Y~g~~  125 (220)
                      -+|-.+++.+.+.+..
T Consensus       102 ~ryLkv~i~Le~~~~~  117 (182)
T PRK08455        102 RRYLKTSISLELSNEK  117 (182)
T ss_pred             ceEEEEEEEEEECCHh
Confidence            3788888888877654


Done!