Citrus Sinensis ID: 037481

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------

MAEVKLHGGWASIPYEYIEEDLYNKSASLLKYNPVNKMIPVLVHGEKPVCESMVILEYIEEMWPHNPSLMPSDSYDRAQARFWIKFAEDKGVAVWKMFFSTGQDLENAMKAALEMLQTVEKHGLGEKKFFNGDNIGLADLAFGAIAYWLQVLEDVMGVKLFESHKFPSLHGWFENFRKVPVIEENLPNQHEMVIAFKRRRETLMTSA

cEEEEEEccccccccEEEEcccccccHHHHHHccccccccEEEEccEEEEEHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutathione S-transferase U7	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	probable	Q9ZW24

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GWC, chain A
Confidence level:very confident
Coverage over the Query: 3-195
View the alignment between query and template
View the model in PyMOL