BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037485
         (358 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In
           Complex With Ca074 Inhibitor
 pdb|3S3Q|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In
           Complex With K11017 Inhibitor
 pdb|3S3R|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In
           Complex With K11777 Inhibitor
 pdb|3S3R|B Chain B, Structure Of Cathepsin B1 From Schistosoma Mansoni In
           Complex With K11777 Inhibitor
 pdb|3S3R|C Chain C, Structure Of Cathepsin B1 From Schistosoma Mansoni In
           Complex With K11777 Inhibitor
          Length = 254

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 20/48 (41%)

Query: 306 EDDIPYKYGIFHLIFSLGAMYFAMLFLSWNLLNPAKEWSIDVGWASTW 353
           ED + YK GI+  I        A+  + W + N A  W I   W   W
Sbjct: 180 EDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDW 227


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.141    0.455 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,259,407
Number of Sequences: 62578
Number of extensions: 391297
Number of successful extensions: 966
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 966
Number of HSP's gapped (non-prelim): 4
length of query: 358
length of database: 14,973,337
effective HSP length: 100
effective length of query: 258
effective length of database: 8,715,537
effective search space: 2248608546
effective search space used: 2248608546
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)