BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037537
         (677 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2X0S|A Chain A, 3.0 A Resolution Crystal Structure Of Glycosomal Pyruvate
           Phosphate Dikinase From Trypanosoma Brucei
          Length = 913

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 98  SYNTLISAYADC------GDTESALSLFKDMREKRFDTD 130
           SY   I+ YAD        D E ALS  K+ R  +FDTD
Sbjct: 138 SYRRFITMYADIVMQVGREDFEEALSRMKERRGTKFDTD 176


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,042,656
Number of Sequences: 62578
Number of extensions: 812994
Number of successful extensions: 1838
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1837
Number of HSP's gapped (non-prelim): 2
length of query: 677
length of database: 14,973,337
effective HSP length: 105
effective length of query: 572
effective length of database: 8,402,647
effective search space: 4806314084
effective search space used: 4806314084
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.8 bits)