BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037606
         (165 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|A6UQV8|DGGGP_METVS Digeranylgeranylglyceryl phosphate synthase OS=Methanococcus
           vannielii (strain SB / ATCC 35089 / DSM 1224)
           GN=Mevan_0977 PE=3 SV=1
          Length = 278

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%)

Query: 87  IHRTRHVHHNMSTIRPTAKTGLFGGAAFMALNASLFWLICLMLADNARDDYFDEED 142
           I++   +  NM     T    +FGG A   +N SL+   C M +  AR+   D ED
Sbjct: 123 IYKKNKIIGNMLVAYLTGSVFIFGGIAVGNVNVSLYLFSCAMFSMWAREIIKDYED 178


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.324    0.138    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 58,890,012
Number of Sequences: 539616
Number of extensions: 2083080
Number of successful extensions: 6450
Number of sequences better than 100.0: 27
Number of HSP's better than 100.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 6424
Number of HSP's gapped (non-prelim): 27
length of query: 165
length of database: 191,569,459
effective HSP length: 109
effective length of query: 56
effective length of database: 132,751,315
effective search space: 7434073640
effective search space used: 7434073640
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 56 (26.2 bits)