Citrus Sinensis ID: 037627

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------86
MVDAVVSFVVQRLGDYLIQEAAFLGEVRTEVRSLKKELEWMLCFIKDAEDKQVDDPMIRQWVSDIRDVAHDIEDVLYNFTLKVDDSAEIDDRKRKPSFLGKMKICLCVFNKGKEKIDLYNIGKEIEELRKRVSDISRRRESYHLESTDNYNLEAKGHDVSRRVRELRRATSFSIEGNVVGFDDDVSKLLAKLLNKEPRRFVISVYGMGGLGKTTLARKLYHNNDVKNKFDRCAWVSVSQDYDTKDLLLRIIRSFKINVLTRELEEMREEDLERYLHNCLQGKSYLVVVDDAWQKETWESLKRAFPDNKNGSRVIITTRIKEVAERSDENAYAHKLRFLRSDESWELFCEKAFRKSNGSEGLEKLGREMVEKCRGLPLAIVVLGGLLSMKKPQEWRRVRDHLWQHLKNDCIHISSLLNLSFRNLSHELKLCFLYLGLFPEDFEINVQTLIRLLVAEGFIQQDTDRSTEEVAGEILDELINRSLIQIDKRCWGRIATCRVHDLLRDLAIEQAKKIKFIHICKDAPNLISSSCRRQAVHFRIMGDWGLGHCNPRSSSLLLFNQRVLNFEGVVSNVLCSVGGCYNLPEEMVKLVNLKYLRLTNAHIDVIPSCIAKLQRLQTLDISGNMAFMELPREICELKELRHLIGNFTGTLNIENLSNLQTLKYVERGSWAEINPEKLVNLRDLRIISKYQEEEFSFKSIAYLKNLQLLSIRLSDDTCFDSLQPLSDCSYLIDLRLSGKIEKLPEDLHEVLPNLECLSLKKSHLKEDPMPKLEKLPNLTILDLGLKSYGGKKMICTTKGFHLLEILQLIDLNDLAQWQVEDGAMPILRGLRVTNAYKLKIPERLKSIPLPTEWECDENW
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEECccccHHHHHHHHHccccccEEEEEECcccccHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHcccccccccEEEEEcccHHHHHcccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHcccccccccccHHHHHHcccccccHHHHHHHcccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEcHHHHHHHHHHHHHHccEEEEccccccccccEEEEEEEcccccccccccccccccEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccHHcccccccccccEEEEECccccccccccccccccccEEEEEEECcccccccHcccccccEEEEEEcccccccccccccccccccEEEEEcCECcccCEECcccccccccEEEEccccccccCECcccccccccccEECccccccccccccccccccEEEccccc
MVDAVVSFVVQRLGDYLIQEAAFLGEVRTEVRSLKKELEWMLCFIKDAEDKQVDDPMIRQWVSDIRDVAHDIEDVLYNFTLKVDDSA********PSFLGKMKICLCVFNKGKEKIDLYNIGKEIEELRKRVSDISRRRESYHL**********************RRATSFSIEGNVVGFDDDVSKLLAKLLNKEPRRFVISVYGMGGLGKTTLARKLYHNNDVKNKFDRCAWVSVSQDYDTKDLLLRIIRSFKINVLTRELEEMREEDLERYLHNCLQGKSYLVVVDDAWQKETWESLKRAFPDNKNGSRVIITTRIKEVAERSDENAYAHKLRFLRSDESWELFCEKAFRKSNGSEGLEKLGREMVEKCRGLPLAIVVLGGLLSMKKPQEWRRVRDHLWQHLKNDCIHISSLLNLSFRNLSHELKLCFLYLGLFPEDFEINVQTLIRLLVAEGFIQQDTDRSTEEVAGEILDELINRSLIQIDKRCWGRIATCRVHDLLRDLAIEQAKKIKFIHICKDAPNLISSSCRRQAVHFRIMGDWGLGHCNPRSSSLLLFNQRVLNFEGVVSNVLCSVGGCYNLPEEMVKLVNLKYLRLTNAHIDVIPSCIAKLQRLQTLDISGNMAFMELPREICELKELRHLIGNFTGTLNIENLSNLQTLKYVERGSWAEINPEKLVNLRDLRIISKYQEEEFSFKSIAYLKNLQLLSIRLSDDTCFDSLQPLSDCSYLIDLRLSGKIEKLPEDLHEVLPNLECLSLKKSHLKEDPMPKLEKLPNLTILDLGLKSYGGKKMICTTKGFHLLEILQLIDLNDLAQWQVEDGAMPILRGLRVTNAYKLKIPERLKSIPLPTEWECDENW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDAVVSFVVQRLGDYLIQEAAFLGEVRTEVRSLKKELEWMLCFIKDAEDKQVDDPMIRQWVSDIRDVAHDIEDVLYNFTLKVDDSAEIDDRKRKPSFLGKMKICLCVFNKGKEKIDLYNIGKExxxxxxxxxxxxxxxxxxxxxSTDNYNLEAKGHDVSRRVRELRRATSFSIEGNVVGFDDDVSKLLAKLLNKEPRRFVISVYGMGGLGKTTLARKLYHNNDVKNKFDRCAWVSVSQDYDTKDLLLRIIRSFKINVLTRELEEMREEDLERYLHNCLQGKSYLVVVDDAWQKETWESLKRAFPDNKNGSRVIITTRIKEVAERSDENAYAHKLRFLRSDESWELFCEKAFRKSNGSEGLEKLGREMVEKCRGLPLAIVVLGGLLSMKKPQEWRRVRDHLWQHLKNDCIHISSLLNLSFRNLSHELKLCFLYLGLFPEDFEINVQTLIRLLVAEGFIQQDTDRSTEEVAGEILDELINRSLIQIDKRCWGRIATCRVHDLLRDLAIEQAKKIKFIHICKDAPNLISSSCRRQAVHFRIMGDWGLGHCNPRSSSLLLFNQRVLNFEGVVSNVLCSVGGCYNLPEEMVKLVNLKYLRLTNAHIDVIPSCIAKLQRLQTLDISGNMAFMELPREICELKELRHLIGNFTGTLNIENLSNLQTLKYVERGSWAEINPEKLVNLRDLRIISKYQEEEFSFKSIAYLKNLQLLSIRLSDDTCFDSLQPLSDCSYLIDLRLSGKIEKLPEDLHEVLPNLECLSLKKSHLKEDPMPKLEKLPNLTILDLGLKSYGGKKMICTTKGFHLLEILQLIDLNDLAQWQVEDGAMPILRGLRVTNAYKLKIPERLKSIPLPTEWECDENW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disease resistance protein RPP13 Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to other resistance proteins, it works independently of ESD1 and NSD1 proteins and does not require the accumulation of salicylic acid, suggesting the existence of an independent signaling pathway. The specificity to avirulence proteins differs in the different cultivars.probableQ9M667

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 561-857
View the alignment between query and template
View the model in PyMOL
Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 528-857
View the alignment between query and template
View the model in PyMOL
Template: 1Z6T, chain A
Confidence level:very confident
Coverage over the Query: 173-454,466-510
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 179-515
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 4-85
View the alignment between query and template
View the model in PyMOL