BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037682
         (397 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q2G5F5|PNP_NOVAD Polyribonucleotide nucleotidyltransferase OS=Novosphingobium
           aromaticivorans (strain DSM 12444) GN=pnp PE=3 SV=1
          Length = 772

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 18/91 (19%)

Query: 262 RRRNSSSSSSSSPERFFDMP-RSEIPKWVDDYMGQIGSVLREGGWSEPDIVEIVTVSAS- 319
           +R   ++   +   R  D P R   P+   + +  I  VL   G +EPDIV ++  SA+ 
Sbjct: 79  KRERGATEKETLVSRLIDRPVRPLFPEGFYNEINVIAQVLSYDGETEPDIVAMIAASAAL 138

Query: 320 ----------------GFFEGEMVMLDNQSV 334
                           GF EGE V+   Q V
Sbjct: 139 TISGVPFMGPIAAARVGFIEGEYVLNPKQDV 169


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.134    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,636,146
Number of Sequences: 539616
Number of extensions: 6209174
Number of successful extensions: 18299
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 18252
Number of HSP's gapped (non-prelim): 40
length of query: 397
length of database: 191,569,459
effective HSP length: 120
effective length of query: 277
effective length of database: 126,815,539
effective search space: 35127904303
effective search space used: 35127904303
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)