Query         037730
Match_columns 83
No_of_seqs    102 out of 115
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 03:49:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037730.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037730hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00165 hypothetical protein; 100.0 3.6E-48 7.9E-53  256.3   4.5   83    1-83      1-84  (88)
  2 PF12609 DUF3774:  Wound-induce 100.0 2.3E-38 4.9E-43  204.8   2.1   74   10-83      1-76  (79)
  3 PF02284 COX5A:  Cytochrome c o  27.9      55  0.0012   22.6   2.2   27   10-36     61-90  (108)
  4 TIGR02894 DNA_bind_RsfA transc  21.9      53  0.0012   24.1   1.3   14   24-37     45-60  (161)
  5 PF00751 DM:  DM DNA binding do  19.9      39 0.00084   19.9   0.2   16   15-30     12-28  (47)
  6 PF02083 Urotensin_II:  Urotens  18.7      39 0.00086   15.0   0.0    7   25-31      5-11  (12)
  7 KOG1066 Glucosidase II catalyt  18.5      41 0.00088   30.5   0.1    7   25-31    363-369 (915)
  8 PRK13426 F0F1 ATP synthase sub  18.0      89  0.0019   23.8   1.8   19   22-40     84-104 (291)
  9 COG3205 Predicted membrane pro  17.6      99  0.0021   20.0   1.7   20    4-23     22-41  (72)
 10 KOG3851 Sulfide:quinone oxidor  17.2      84  0.0018   26.3   1.6   25   15-40    152-176 (446)

No 1  
>PLN00165 hypothetical protein; Provisional
Probab=100.00  E-value=3.6e-48  Score=256.26  Aligned_cols=83  Identities=67%  Similarity=0.921  Sum_probs=76.0

Q ss_pred             CCcchhHHHHHHHHHHHHhhcccCcccchhhHHHHHHHHHHhhhhHHhhhccchh-hHHhhcccccccchhhhhhhhhhh
Q 037730            1 MSAKGKAWMVAASVGAVEALKDQGFVRRNYSLRFLKQRAETNLRSMVQANKLSLS-SAMALSKVRDDKMNESVESLRKVM   79 (83)
Q Consensus         1 Ms~~~~~w~vAaSvgaVEalKDQG~CRwn~alrSl~~~ak~~~~S~sqa~~ls~s-sa~~~~~~~~~k~kqaEEsLRtVM   79 (83)
                      ||+++++|||||||||||+|||||+|||||+|||||||+++|++|++|+++|+++ ++.++...+++|.||+||+|||||
T Consensus         1 Ms~~~r~w~vAaSvgaVEalkDQG~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s~~~~~~k~kq~EEsLRtVM   80 (88)
T PLN00165          1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM   80 (88)
T ss_pred             CccchhHHHHHHHHHHHhhccccCeeehhhHHHHHHHHHHhccccccccccCCCcchhhhhhhhccccccchHHhhheee
Confidence            8999999999999999999999999999999999999999999999999999764 334445567788999999999999


Q ss_pred             cccC
Q 037730           80 YSSC   83 (83)
Q Consensus        80 yLSC   83 (83)
                      ||||
T Consensus        81 yLSC   84 (88)
T PLN00165         81 YLSC   84 (88)
T ss_pred             Eecc
Confidence            9999


No 2  
>PF12609 DUF3774:  Wound-induced protein;  InterPro: IPR022251  This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this. 
Probab=100.00  E-value=2.3e-38  Score=204.76  Aligned_cols=74  Identities=55%  Similarity=0.728  Sum_probs=65.6

Q ss_pred             HHHHHHHHHhhccc-CcccchhhHHHHHHHHHHhh-hhHHhhhccchhhHHhhcccccccchhhhhhhhhhhcccC
Q 037730           10 VAASVGAVEALKDQ-GFVRRNYSLRFLKQRAETNL-RSMVQANKLSLSSAMALSKVRDDKMNESVESLRKVMYSSC   83 (83)
Q Consensus        10 vAaSvgaVEalKDQ-G~CRwn~alrSl~~~ak~~~-~S~sqa~~ls~ssa~~~~~~~~~k~kqaEEsLRtVMyLSC   83 (83)
                      ||+||||||+|||| |+|||||+|||+|+++++++ ++.+|+++++++++.......+++.||+||||||||||||
T Consensus         1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~~~~~~~~~~k~aEEsLRtVMyLSC   76 (79)
T PF12609_consen    1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSSSAAAEEEKRKQAEESLRTVMYLSC   76 (79)
T ss_pred             CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccccccccccccchhhhhhceeEEEec
Confidence            68999999999999 99999999999999999998 8889999987643322445677899999999999999999


No 3  
>PF02284 COX5A:  Cytochrome c oxidase subunit Va;  InterPro: IPR003204 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits is known as Va.; GO: 0004129 cytochrome-c oxidase activity; PDB: 2DYR_R 3AG1_E 3ABL_E 1V54_R 2EIJ_R 1OCR_E 2DYS_E 2EIM_E 2OCC_E 3ASN_R ....
Probab=27.89  E-value=55  Score=22.64  Aligned_cols=27  Identities=37%  Similarity=0.479  Sum_probs=19.0

Q ss_pred             HHHHHHHHHhhccc-Cccc--chhhHHHHH
Q 037730           10 VAASVGAVEALKDQ-GFVR--RNYSLRFLK   36 (83)
Q Consensus        10 vAaSvgaVEalKDQ-G~CR--wn~alrSl~   36 (83)
                      .|..|...|++||. |...  |.|-|.-|.
T Consensus        61 ~a~AVR~lE~iK~K~~~~~~~Y~~~lqElk   90 (108)
T PF02284_consen   61 FALAVRILEGIKDKCGNKKEIYPYILQELK   90 (108)
T ss_dssp             HHHHHHHHHHHHHHTTT-TTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHccChHHHHHHHHHHHh
Confidence            47889999999998 7665  555554444


No 4  
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO.
Probab=21.87  E-value=53  Score=24.06  Aligned_cols=14  Identities=21%  Similarity=0.055  Sum_probs=10.1

Q ss_pred             Ccc--cchhhHHHHHH
Q 037730           24 GFV--RRNYSLRFLKQ   37 (83)
Q Consensus        24 G~C--Rwn~alrSl~~   37 (83)
                      .-|  |||..+|-=++
T Consensus        45 AACGFRWNs~VRkqY~   60 (161)
T TIGR02894        45 AACGFRWNAYVRKQYE   60 (161)
T ss_pred             HHhcchHHHHHHHHHH
Confidence            457  99999985443


No 5  
>PF00751 DM:  DM DNA binding domain;  InterPro: IPR001275 This domain was first discovered in the doublesex proteins of Drosophila melanogaster and is also seen in proteins from Caenorhabditis elegans []. In D. melanogaster the doublesex gene controls somatic sexual differentiation by producing alternatively spliced mRNAs encoding related sex-specific polypeptides []. These proteins are believed to function as transcription factors on downstream sex-determination genes, especially on neuroblast differentiation and yolk protein genes transcription [, ]. The DM domain binds DNA as a dimer, allowing the recognition of pseudopalindromic sequences [, , ]. The NMR analysis of the DSX DM domain [] revealed a novel zinc module containing 'intertwined' CCHC and HCCC zinc-binding sites. The recognition of the DNA requires the carboxy-terminal basic tail which contacts the minor groove of the target sequence.; GO: 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007548 sex differentiation, 0005634 nucleus; PDB: 1LPV_A.
Probab=19.87  E-value=39  Score=19.89  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=8.8

Q ss_pred             HHHHhhccc-Ccccchh
Q 037730           15 GAVEALKDQ-GFVRRNY   30 (83)
Q Consensus        15 gaVEalKDQ-G~CRwn~   30 (83)
                      |.+..||++ ..|+|..
T Consensus        12 G~~~~lKgHk~~C~~~~   28 (47)
T PF00751_consen   12 GVIVPLKGHKRYCPFRD   28 (47)
T ss_dssp             T---TTTT-GGG-TTTT
T ss_pred             CcccchhhhccccCcCC
Confidence            556788999 7999973


No 6  
>PF02083 Urotensin_II:  Urotensin II;  InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=18.72  E-value=39  Score=15.03  Aligned_cols=7  Identities=14%  Similarity=0.003  Sum_probs=5.1

Q ss_pred             cccchhh
Q 037730           25 FVRRNYS   31 (83)
Q Consensus        25 ~CRwn~a   31 (83)
                      -|-|+|-
T Consensus         5 ~CFWKYC   11 (12)
T PF02083_consen    5 ECFWKYC   11 (12)
T ss_pred             chhhhhc
Confidence            4889873


No 7  
>KOG1066 consensus Glucosidase II catalytic (alpha) subunit and related enzymes, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]
Probab=18.51  E-value=41  Score=30.49  Aligned_cols=7  Identities=43%  Similarity=0.620  Sum_probs=5.5

Q ss_pred             cccchhh
Q 037730           25 FVRRNYS   31 (83)
Q Consensus        25 ~CRwn~a   31 (83)
                      -|||||.
T Consensus       363 QcRWNY~  369 (915)
T KOG1066|consen  363 QCRWNYN  369 (915)
T ss_pred             hcccccc
Confidence            3999986


No 8  
>PRK13426 F0F1 ATP synthase subunit gamma; Provisional
Probab=18.04  E-value=89  Score=23.78  Aligned_cols=19  Identities=16%  Similarity=0.233  Sum_probs=13.2

Q ss_pred             ccCcc-cchhh-HHHHHHHHH
Q 037730           22 DQGFV-RRNYS-LRFLKQRAE   40 (83)
Q Consensus        22 DQG~C-Rwn~a-lrSl~~~ak   40 (83)
                      |+|+| ..|+. +|.+.++.+
T Consensus        84 DrGLcG~fN~~v~~~~~~~~~  104 (291)
T PRK13426         84 NTSLCGGFNANIIKLLLQTIG  104 (291)
T ss_pred             CCcccchhhHHHHHHHHHHHH
Confidence            99999 78866 466665543


No 9  
>COG3205 Predicted membrane protein [Function unknown]
Probab=17.60  E-value=99  Score=20.02  Aligned_cols=20  Identities=20%  Similarity=0.147  Sum_probs=16.3

Q ss_pred             chhHHHHHHHHHHHHhhccc
Q 037730            4 KGKAWMVAASVGAVEALKDQ   23 (83)
Q Consensus         4 ~~~~w~vAaSvgaVEalKDQ   23 (83)
                      ..+.|.|+.-||+||.+-..
T Consensus        22 lTG~~~v~~~ialvep~~nT   41 (72)
T COG3205          22 LTGSIGVAGLIALVEPMVNT   41 (72)
T ss_pred             hhhhHhhhHHHHHHHhhhcc
Confidence            35789999999999998544


No 10 
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion]
Probab=17.19  E-value=84  Score=26.33  Aligned_cols=25  Identities=36%  Similarity=0.610  Sum_probs=20.4

Q ss_pred             HHHHhhcccCcccchhhHHHHHHHHH
Q 037730           15 GAVEALKDQGFVRRNYSLRFLKQRAE   40 (83)
Q Consensus        15 gaVEalKDQG~CRwn~alrSl~~~ak   40 (83)
                      |+||||-+.|+| -||.-+-+..+=+
T Consensus       152 Gl~Eal~tP~Vc-SnYSpkyvdk~y~  176 (446)
T KOG3851|consen  152 GLVEALDTPGVC-SNYSPKYVDKVYK  176 (446)
T ss_pred             ChHhhccCCCcc-cccChHHHHHHHH
Confidence            799999999999 5888877776644


Done!