BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037801
(84 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CC1|L Chain L, Crystal Structure Of A Reduced, Active Form Of The
Ni-Fe-Se Hydrogenase From Desulfomicrobium Baculatum
Length = 498
Score = 25.8 bits (55), Expect = 5.8, Method: Composition-based stats.
Identities = 10/30 (33%), Positives = 17/30 (56%)
Query: 27 LEPFVNHASQMAALDYIVSVESDVFIPSYS 56
L+ + H +AALDY+ + F+P Y+
Sbjct: 110 LQSHILHFYHLAALDYVKGPDVSPFVPRYA 139
>pdb|2HK2|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
From Staphylococcus Aureus (Monoclinic Form)
pdb|2HK2|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
From Staphylococcus Aureus (Monoclinic Form)
pdb|2HK3|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
From Staphylococcus Aureus (Orthorhombic Form)
pdb|2HK3|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
From Staphylococcus Aureus (Orthorhombic Form)
Length = 331
Score = 25.4 bits (54), Expect = 8.6, Method: Composition-based stats.
Identities = 8/31 (25%), Positives = 19/31 (61%)
Query: 24 VEELEPFVNHASQMAALDYIVSVESDVFIPS 54
+E++ +++ A +D+ +ESD F+P+
Sbjct: 74 LEKISKYMDIVRNRAGIDWYAEIESDNFVPT 104
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.131 0.357
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,984,365
Number of Sequences: 62578
Number of extensions: 55925
Number of successful extensions: 177
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 175
Number of HSP's gapped (non-prelim): 2
length of query: 84
length of database: 14,973,337
effective HSP length: 52
effective length of query: 32
effective length of database: 11,719,281
effective search space: 375016992
effective search space used: 375016992
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)