Citrus Sinensis ID: 037802

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MACQEEGLLLDEYPKEKFWEILDLYQLDGYWYSGDVIPGMLAFKSEFEALSDDVILASSMKTGTTWLKALCICIMGNQRKNDGDEVDQLEVKNPHDHIKCLEYFYYFNLLSKLKDMQSPRVFNTHLPYSALPESIKNSECKIVYIARNPKDTFVSLWHFFNQILPPNTEPYRLEKAYDSFIKGIHLFGPFHDHVLEYWQESLKNPNKLLFLKYEDLKRDPKGEVRKLASFLCRPFGDEDNDEVDKVLWRSSFERLKNLEVNKNGKLSDSGVPNSSFFRLGNVGDWQNCFTDEMKQGLDEITCKKFEGSGLDL
cccHHHHHHHHcccccccccccccEEEccCCccccccHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHcccHHHHHHccccccEEEcccccccccccccccccEEEEEEcccccEEEEHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEEEcHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHccccccccccccccccccccECccccccccccccHHHHHHHHHHHHHHcccccccc
******GLLLDEYPKEKFWEILDLYQLDGYWYSGDVIPGMLAFKSEFEALSDDVILASSMKTGTTWLKALCICIMGNQRKNDGDEVDQLEVKNPHDHIKCLEYFYYFNLLSKLKDMQSPRVFNTHLPYSALPESIKNSECKIVYIARNPKDTFVSLWHFFNQILPPNTEPYRLEKAYDSFIKGIHLFGPFHDHVLEYWQESLKNPNKLLFLKYEDLKRDPKGEVRKLASFLCRPFGDEDNDEVDKVLWRSSFERLKNL******KL*DSGVPNSSFFRLGNVGDWQNCFTDEMKQGLDEITCKKFEGSGLDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACQEEGLLLDEYPKEKFWEILDLYQLDGYWYSGDVIPGMLAFKSEFEALSDDVILASSMKTGTTWLKALCICIMGNQRKNDGDEVDQLEVKNPHDHIKCLEYFYYFNLLSKLKDMQSPRVFNTHLPYSALPESIKNSECKIVYIARNPKDTFVSLWHFFNQILPPNTEPYRLEKAYDSFIKGIHLFGPFHDHVLEYWQESLKNPNKLLFLKYEDLKRDPKGEVRKLASFLCRPFGDEDNDEVDKVLWRSSFERLKNLEVNKNGKLSDSGVPNSSFFRLGNVGDWQNCFTDEMKQGLDEITCKKFEGSGLDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sulfotransferase 1C2 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters.probableQ9WUW8
Sulfotransferase 1C2 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).probableO00338
Cytosolic sulfotransferase 12 Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the stereospecific sulfate conjugation of 24-epibrassinosteroids. Preferred substrates are 24-epicathasterone and 6-deoxo-24-epicathasterone. Low activity with 22-deoxy-24-epiteasterone. No activity with 24-epimers catasterone and brassinolide. Sulfonates salicylic acid. May be involved in detoxification. Enhances plant response to pathogen infection and contributes to long distance signaling in systemic acquired resistance (SAR).probableP52839

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q44, chain A
Confidence level:very confident
Coverage over the Query: 3-253,284-312
View the alignment between query and template
View the model in PyMOL