BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037836
         (163 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4H7X|A Chain A, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
 pdb|4H7X|B Chain B, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
 pdb|4H7Y|A Chain A, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
 pdb|4H7Y|B Chain B, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
 pdb|4H7Y|C Chain C, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
 pdb|4H7Y|D Chain D, Crystal Structure Of The Tetratricopeptide Repeat (Tpr)
          Motif Of Human Dual Specificity Protein Kinase Mps1
          Length = 161

 Score = 26.2 bits (56), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 16 DLYGKRRELAKVQVLEREISFLEEELKTVDRFHPASRSCKEVA 58
          D YG+    A++QV   E+  ++E     D F  A  +CK+ A
Sbjct: 52 DKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCKKFA 94


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.141    0.500 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,017,037
Number of Sequences: 62578
Number of extensions: 101537
Number of successful extensions: 283
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 282
Number of HSP's gapped (non-prelim): 1
length of query: 163
length of database: 14,973,337
effective HSP length: 91
effective length of query: 72
effective length of database: 9,278,739
effective search space: 668069208
effective search space used: 668069208
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)