BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037857
         (582 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V0P|A Chain A, The Structure Of Tap42 Alpha4 Subunit
 pdb|2V0P|B Chain B, The Structure Of Tap42 Alpha4 Subunit
          Length = 234

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 259 TLMQSYKAAQEAAENKLNSLKKEYDPQLTE 288
           TL+Q YK        KL + K  Y+PQL+E
Sbjct: 116 TLLQDYKLLDPLVGEKLGNFKDRYNPQLSE 145


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.305    0.120    0.295 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,875,531
Number of Sequences: 62578
Number of extensions: 274546
Number of successful extensions: 749
Number of sequences better than 100.0: 46
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 41
Number of HSP's that attempted gapping in prelim test: 710
Number of HSP's gapped (non-prelim): 71
length of query: 582
length of database: 14,973,337
effective HSP length: 104
effective length of query: 478
effective length of database: 8,465,225
effective search space: 4046377550
effective search space used: 4046377550
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 54 (25.4 bits)