Query 037901
Match_columns 119
No_of_seqs 48 out of 50
Neff 2.7
Searched_HMMs 46136
Date Fri Mar 29 05:26:48 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037901.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037901hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG4196 bZIP transcription fac 18.1 88 0.0019 24.4 1.8 12 100-111 22-33 (135)
2 PF10476 DUF2448: Protein of u 16.1 86 0.0019 25.9 1.4 25 39-63 159-202 (204)
3 PF02270 TFIIF_beta: Transcrip 11.6 88 0.0019 25.3 0.3 21 39-59 241-264 (275)
4 PF15215 FDC-SP: Follicular de 11.0 1E+02 0.0022 21.5 0.4 12 58-69 10-21 (67)
5 KOG2510 SWI-SNF chromatin-remo 10.8 2.4E+02 0.0051 26.4 2.8 15 39-53 293-307 (532)
6 PLN02345 endoglucanase 10.3 2E+02 0.0043 25.7 2.0 18 97-114 426-443 (469)
7 PF08821 CGGC: CGGC domain; I 10.0 89 0.0019 22.5 -0.2 18 95-112 26-45 (107)
8 PF05132 RNA_pol_Rpc4: RNA pol 9.3 1.7E+02 0.0037 21.1 1.1 12 2-13 8-19 (131)
9 PF02845 CUE: CUE domain; Int 8.5 1.3E+02 0.0029 17.5 0.2 10 105-114 6-15 (42)
10 CHL00031 psbT photosystem II p 8.0 1.9E+02 0.0041 17.8 0.7 6 5-10 26-31 (33)
No 1
>KOG4196 consensus bZIP transcription factor MafK [Transcription]
Probab=18.14 E-value=88 Score=24.36 Aligned_cols=12 Identities=33% Similarity=0.731 Sum_probs=11.1
Q ss_pred Cccchhhhhccc
Q 037901 100 DKFDDEQFMSMF 111 (119)
Q Consensus 100 Dr~dDeQ~mSMF 111 (119)
|+|.||+|++|=
T Consensus 22 d~lsDd~LvsmS 33 (135)
T KOG4196|consen 22 DRLSDDELVSMS 33 (135)
T ss_pred CCcCHHHHHHhh
Confidence 999999999984
No 2
>PF10476 DUF2448: Protein of unknown function C-terminus (DUF2448) ; InterPro: IPR018861 The proteins in the entry are restricted to chordates and their function is not known.
Probab=16.09 E-value=86 Score=25.88 Aligned_cols=25 Identities=44% Similarity=0.826 Sum_probs=17.0
Q ss_pred CCCchHHHh----------hCchhh---------cccCCCCCCC
Q 037901 39 HNPSWVDEF----------LDFSSA---------RRGTHRRSVS 63 (119)
Q Consensus 39 ~~psWlDe~----------L~~~~~---------rrg~HRRS~S 63 (119)
..|+|||-+ ..|.++ ||..-||..|
T Consensus 159 ~~psWldt~Kf~ttSlCCLVgftAAvATrK~tG~RR~RpRR~~~ 202 (204)
T PF10476_consen 159 DSPSWLDTLKFSTTSLCCLVGFTAAVATRKATGPRRFRPRRYLS 202 (204)
T ss_pred CCchHHHHHHHhhhhHHHHHHHHHHHHhccCCCccccCccccCC
Confidence 889999976 233322 6777888765
No 3
>PF02270 TFIIF_beta: Transcription initiation factor IIF, beta subunit; InterPro: IPR003196 Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIF (TFIIF) is a tetramer of two beta subunits associate with two alpha subunits which interacts directly with RNA polymerase II. The beta subunit of TFIIF is required for recruitment of RNA polymerase II onto the promoter. ; GO: 0005524 ATP binding, 0006367 transcription initiation from RNA polymerase II promoter, 0005674 transcription factor TFIIF complex; PDB: 1F3U_C 2BBY_A 1BBY_A.
Probab=11.63 E-value=88 Score=25.33 Aligned_cols=21 Identities=29% Similarity=0.740 Sum_probs=11.3
Q ss_pred CCC-chHHHhhCchhh--cccCCC
Q 037901 39 HNP-SWVDEFLDFSSA--RRGTHR 59 (119)
Q Consensus 39 ~~p-sWlDe~L~~~~~--rrg~HR 59 (119)
.|| +||.|.|++-+. ++|.|+
T Consensus 241 ~QP~~yLKeiL~eIa~~~k~g~~~ 264 (275)
T PF02270_consen 241 QQPEAYLKEILEEIAVLNKRGPHK 264 (275)
T ss_dssp -S-HHHHHHHHHHH--EE--TT--
T ss_pred CCCHHHHHHHHHHHHHHhccCCcC
Confidence 677 899999999654 777776
No 4
>PF15215 FDC-SP: Follicular dendritic cell secreted peptide
Probab=10.99 E-value=1e+02 Score=21.53 Aligned_cols=12 Identities=42% Similarity=0.451 Sum_probs=8.7
Q ss_pred CCCCCCcceeec
Q 037901 58 HRRSVSDSITYL 69 (119)
Q Consensus 58 HRRS~SDSvafl 69 (119)
..||+|||=.|-
T Consensus 10 EKRS~SDSDe~~ 21 (67)
T PF15215_consen 10 EKRSISDSDELS 21 (67)
T ss_pred hhcccccccccc
Confidence 469999985543
No 5
>KOG2510 consensus SWI-SNF chromatin-remodeling complex protein [Chromatin structure and dynamics]
Probab=10.82 E-value=2.4e+02 Score=26.36 Aligned_cols=15 Identities=27% Similarity=0.694 Sum_probs=11.3
Q ss_pred CCCchHHHhhCchhh
Q 037901 39 HNPSWVDEFLDFSSA 53 (119)
Q Consensus 39 ~~psWlDe~L~~~~~ 53 (119)
+.--|||+++.|...
T Consensus 293 ~r~~wvDR~raF~ee 307 (532)
T KOG2510|consen 293 ERKEWVDRLRAFTEE 307 (532)
T ss_pred chhhHHHHHHHHHHh
Confidence 444799999999643
No 6
>PLN02345 endoglucanase
Probab=10.27 E-value=2e+02 Score=25.75 Aligned_cols=18 Identities=28% Similarity=0.252 Sum_probs=12.9
Q ss_pred CCCCccchhhhhcccccC
Q 037901 97 HEFDKFDDEQFMSMFTDD 114 (119)
Q Consensus 97 ~eFDr~dDeQ~mSMFsD~ 114 (119)
..+|.|.|++---..++.
T Consensus 426 d~~D~y~D~r~~y~~nEv 443 (469)
T PLN02345 426 FQNDTFVDSRDNSMQNEP 443 (469)
T ss_pred CccCCccccccccccccc
Confidence 468999998876665553
No 7
>PF08821 CGGC: CGGC domain; InterPro: IPR014925 Proteins in this entry are a quite highly conserved sequence of CGGC in its central region. The region has many conserved cysteines and histidines suggestive of a zinc binding function.
Probab=9.98 E-value=89 Score=22.48 Aligned_cols=18 Identities=28% Similarity=0.709 Sum_probs=14.4
Q ss_pred CCCCCCccch--hhhhcccc
Q 037901 95 NHHEFDKFDD--EQFMSMFT 112 (119)
Q Consensus 95 g~~eFDr~dD--eQ~mSMFs 112 (119)
....|.+|++ .++++||+
T Consensus 26 r~g~F~~y~~~~~elvgf~~ 45 (107)
T PF08821_consen 26 RKGAFARYDDEDVELVGFFT 45 (107)
T ss_pred ccCccccCCCCCeEEEEEee
Confidence 4468999985 89999975
No 8
>PF05132 RNA_pol_Rpc4: RNA polymerase III RPC4; InterPro: IPR007811 This family comprises a specific subunit for Pol III, the tRNA specific polymerase.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006383 transcription from RNA polymerase III promoter, 0005666 DNA-directed RNA polymerase III complex
Probab=9.31 E-value=1.7e+02 Score=21.10 Aligned_cols=12 Identities=50% Similarity=1.018 Sum_probs=9.2
Q ss_pred CCCCCCCCCCCC
Q 037901 2 AQLPPKIPNMTP 13 (119)
Q Consensus 2 AQLPPKIP~~~~ 13 (119)
=|||+..|...+
T Consensus 8 fQlP~~LP~~~~ 19 (131)
T PF05132_consen 8 FQLPPVLPPFKP 19 (131)
T ss_pred EECcCCCCCCCC
Confidence 389999998643
No 9
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs). CUE domains also occur in two proteins of the IL-1 signal transduction pathway, tollip and TAB2.; GO: 0005515 protein binding; PDB: 2EKF_A 1OTR_A 1P3Q_Q 1MN3_A 1WGL_A 2EJS_A 2DAE_A 2DHY_A 2DI0_A.
Probab=8.53 E-value=1.3e+02 Score=17.52 Aligned_cols=10 Identities=40% Similarity=0.590 Sum_probs=8.1
Q ss_pred hhhhcccccC
Q 037901 105 EQFMSMFTDD 114 (119)
Q Consensus 105 eQ~mSMFsD~ 114 (119)
+++.+||++-
T Consensus 6 ~~L~~mFP~~ 15 (42)
T PF02845_consen 6 QQLQEMFPDL 15 (42)
T ss_dssp HHHHHHSSSS
T ss_pred HHHHHHCCCC
Confidence 5789999874
No 10
>CHL00031 psbT photosystem II protein T
Probab=7.98 E-value=1.9e+02 Score=17.75 Aligned_cols=6 Identities=67% Similarity=1.641 Sum_probs=5.0
Q ss_pred CCCCCC
Q 037901 5 PPKIPN 10 (119)
Q Consensus 5 PPKIP~ 10 (119)
||||+.
T Consensus 26 PPri~k 31 (33)
T CHL00031 26 PPKVPT 31 (33)
T ss_pred CCCCCC
Confidence 899985
Done!