Citrus Sinensis ID: 037905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600------
LASDRAALLTLRKAIGGRTLLWNLTDGPCKWVGVFCTGERVTMLRFPGMGLSGQLPIAIGNLTELHTVSLRFNALRGTIPSDFAKLSNLRNLYLQGNLFSGEIPGLLFSLGNLIRLNLAKNNFSGTISADFNKLTRLGTLYLQENQLTGSIPDLGAFSSLAQFNVSFNKLNGSIPKRFARLPSSAFEGNSLCGKPLVSCNGGGDDDDDDGSNLSGGAIAGIVIGSVIGLLIILVLLIGLCRRKRDRQRSSKDVAPAATATATAKQTEIEIPREKGAGDGENTSSDLSGVVKGESKGSGVKNLVFFGKGDRAFDLEDLLRASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARISDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQIEEICRSSLQQGQAHDLENGSS
ccHHHHHHHHHHHHccccccccccccccccccEEEEccccCEEEECcccccCCcccccccccccccEEEccccccccccccccccccccccccccccccccccccHHHccccccEEEccccccccccccHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHccccECccccccEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHcccccccccccEEEEEcccCEEEEEcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccc
LASDRAALLTLRKAIGGRTLLWNLTDGPCKWVGVFCTGERVTMLRFPGMGLSGQLPIAIGNLTELHTVSLRFNALRGTIPSDFAKLSNLRNLYLQGNLFSGEIPGLLFSLGNLIRLNLAKNNFSGTISADFNKLTRLGTLYLQENQLTGSIPDLGAFSSLAQFNVSFNKLNGSIPKRFARLPSSAFEGNSLC***********************GAIAGIVIGSVIGLLIILVLLIGLCRRK*******************************************************VKNLVFFGKGDRAFDLEDLLRASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARISDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQ**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LASDRAALLTLRKAIGGRTLLWNLTDGPCKWVGVFCTGERVTMLRFPGMGLSGQLPIAIGNLTELHTVSLRFNALRGTIPSDFAKLSNLRNLYLQGNLFSGEIPGLLFSLGNLIRLNLAKNNFSGTISADFNKLTRLGTLYLQENQLTGSIPDLGAFSSLAQFNVSFNKLNGSIPKRFARLPSSAFEGNSLCGKPLVSCNGGGDDDDDDGSNLSGGAIAGIVIGSVIGLLIILVLLIGLCRRKRDRQRSSKDVAPAATATATAKQTEIEIPREKGAGDGENTSSDLSGVVKGESKGSGVKNLVFFGKGDRAFDLEDLLRASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARISDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQIEEICRSSLQQGQAHDLENGSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive receptor kinase At1g48480 probableQ9LP77

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 3-195
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 311-588
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:probable
Coverage over the Query: 242-514
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 210-218
View the alignment between query and template
View the model in PyMOL