Citrus Sinensis ID: 037913

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-

MKEKHQQYERVFNHFDSNGDRRISPSELQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRLVEGSGEEEKMNDLKEAFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNGDGVLNFDEFRIMMS

cHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHcc

**EKHQQYERVFNHFDSNGDRRISPSELQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRLVEG**********KEAFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNGDGVLNFDEFRIMMS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKEKHQQYERVFNHFDSNGDRRISPSELQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRLVEGSGEEEKMNDLKEAFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNGDGVLNFDEFRIMMS

Annotation	Function Description	Confidence Level	Reference Protein
Probable calcium-binding protein CML31	Potential calcium sensor.	probable	Q8RYK0
Calmodulin	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.	probable	P62152
Calcium-binding protein CML38	Potential calcium sensor that binds calcium in vitro.	probable	Q9SRE6

No EC number assigned to the protein, probably not an enzyme!

Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 4-140
View the alignment between query and template
View the model in PyMOL