Citrus Sinensis ID: 037937


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MDRVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDQDANGREIEWALRALGCNPSVPAVFIGGRYVGSAKDVISLHVDGSLKQMLIDARAIWF
cHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccccEEEEccEEccccHHHHHHHHccccHHHHHHcccccc
*DRVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDQDANGREIEWALRALGCNPSVPAVFIGGRYVGSAKDVISLHVDGSLKQMLIDARAIWF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDQDANGREIEWALRALGCNPSVPAVFIGGRYVGSAKDVISLHVDGSLKQMLIDARAIWF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C11 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.confidentQ9LYC6
Glutaredoxin-C1 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableQ7G8Y5
Glutaredoxin Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity). Affects the culmination and cell fate decision by modulating the levels of reduced glutathione.probableQ54GP8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L4N, chain A
Confidence level:very confident
Coverage over the Query: 2-102
View the alignment between query and template
View the model in PyMOL