Citrus Sinensis ID: 037958


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MAIAAAAVIVPLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPKSSPAPTMIRLFKGQSSV
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHccEEEEEcccccHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccEEEEEEEECccccccccHHHHccccccc
*AIAAAAVIVPLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPKSSPAPTMIRLFKGQS**
xxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIAAAAVIVPLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPKSSPAPTMIRLFKGQSSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-acyl-sn-glycerol-3-phosphate acyltransferase 2 Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position. Has preference for C-18-CoA substrates compared to C-16-CoA substrates. Required for female but not male gametophyte development.probableQ8LG50
1-acyl-sn-glycerol-3-phosphate acyltransferase 2 Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position.probableQ9XFW4
1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position.probableQ41745

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.511-acylglycerol-3-phosphate O-acyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:confident
Coverage over the Query: 81-201
View the alignment between query and template
View the model in PyMOL