Query         037984
Match_columns 201
No_of_seqs    99 out of 123
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 06:21:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037984.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037984hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0 2.1E-57 4.5E-62  381.2   8.2  133    9-141     1-180 (180)
  2 PF07096 DUF1358:  Protein of u  36.8      99  0.0022   25.3   5.4   53   77-130    28-93  (124)
  3 TIGR03793 TOMM_pelo TOMM prope  32.2      15 0.00033   27.3   0.0   11    6-16     18-28  (77)
  4 PF10247 Romo1:  Reactive mitoc  31.5      30 0.00064   25.4   1.4   51   83-133    14-66  (67)
  5 PF07281 INSIG:  Insulin-induce  30.0 1.1E+02  0.0024   26.3   4.9   39  155-200    79-117 (193)
  6 PF10653 Phage-A118_gp45:  Prot  28.2      54  0.0012   23.4   2.2   27    8-37     22-48  (62)
  7 KOG4096 Uncharacterized conser  26.2      23 0.00051   26.6   0.1   22  113-134    50-71  (75)
  8 PF14407 Frankia_peptide:  Ribo  22.0      32 0.00069   24.9   0.1   13    5-17     13-25  (61)
  9 PF06946 Phage_holin_5:  Phage   20.3 1.2E+02  0.0027   23.6   3.1   27   66-103    57-83  (93)
 10 PF02979 NHase_alpha:  Nitrile   18.5      36 0.00078   29.6  -0.2   13    5-17     54-66  (188)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=2.1e-57  Score=381.17  Aligned_cols=133  Identities=44%  Similarity=0.754  Sum_probs=125.7

Q ss_pred             hhhhcCchhhHHHHHHHhhhhHHHHHHHHhhcCCc---------------eEeeeeec----------------------
Q 037984            9 PRMLADPAFLYKLLVEQAPIIGCTVWWELENRKDR---------------RLINVCSL----------------------   51 (201)
Q Consensus         9 ~RllADP~Fl~Kl~~E~~i~i~~~~~~E~~~R~~~---------------~i~nf~tv----------------------   51 (201)
                      |||+|||+|||||++||+||++|+++|||++|||+               +++||++|                      
T Consensus         1 ~RllADP~Fl~Kl~~E~~i~i~~~~~~e~~~R~e~f~~E~d~v~~d~v~~~i~n~~lv~llAPt~s~~~~~~~~~~~~~~   80 (180)
T PF11891_consen    1 ERLLADPSFLFKLAIEEVIGIGCATAAEYAKRGERFWNELDFVFSDVVVGSIVNFALVWLLAPTRSFGSPAASSPGGGLQ   80 (180)
T ss_pred             CcccccchHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHHHHHHHHhccchHhhCcccccccchHHH
Confidence            79999999999999999999999999999999999               57888876                      


Q ss_pred             ----cCChhhhhhcCCCCccchhhhHHHHHhhchhhhhhhhhHhhhhHHHHHHHhh--ccC----CCCCCCCchhhhhHH
Q 037984           52 ----SFPNNILERSCPFREFDLQKRIHSLFYKAAELCMVGLTAGAVQGSLSNYLAG--KKD----RLSVTIPSVSTNALG  121 (201)
Q Consensus        52 ----slP~n~Fq~~~pg~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~--kk~----~~s~~~ppv~~ta~~  121 (201)
                          +||+|+||+++||++||++||++|++|||++|++||++||++|+++||+|++  ||.    ++++|+|||++||++
T Consensus        81 ~~~~~~P~n~Fq~~~~g~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~~rk~~~~~~e~~~~~ppv~~ta~~  160 (180)
T PF11891_consen   81 KFLGSLPNNAFQKGYPGRSFSLAQRIGAFVYKGAKLAAVGFIAGLVGTGLSNALIAARKKVDPSFEPSVPVPPVLKTALG  160 (180)
T ss_pred             HHHHhChHHHhccCCCCCcccHHHHHHHHHHcchHhhhhHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCCCHHHHHHH
Confidence                3999999999999999999999999999999999999999999999999998  444    455679999999999


Q ss_pred             HHHHHhhhhhhHHHHHHhHH
Q 037984          122 YGAFLGLCANMRYQLLCGFD  141 (201)
Q Consensus       122 ~g~fmGvSsNlRYQ~l~Gie  141 (201)
                      ||+|||+|||+|||+|||+|
T Consensus       161 ~g~fmGvSsNlRYQil~GiE  180 (180)
T PF11891_consen  161 WGAFMGVSSNLRYQILNGIE  180 (180)
T ss_pred             HHHHHhhhHhHHHHHHcCCC
Confidence            99999999999999999987


No 2  
>PF07096 DUF1358:  Protein of unknown function (DUF1358);  InterPro: IPR009792 This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown.
Probab=36.80  E-value=99  Score=25.27  Aligned_cols=53  Identities=25%  Similarity=0.242  Sum_probs=33.6

Q ss_pred             HhhchhhhhhhhhHhhhhHHHHHHHhhccCCCC-----------CCC--CchhhhhHHHHHHHhhhh
Q 037984           77 FYKAAELCMVGLTAGAVQGSLSNYLAGKKDRLS-----------VTI--PSVSTNALGYGAFLGLCA  130 (201)
Q Consensus        77 ~~kg~~l~~VG~~ag~vg~~lsn~L~~kk~~~s-----------~~~--ppv~~ta~~~g~fmGvSs  130 (201)
                      ++.|+.++.|+.++-++|-+.+-++.+|| +|+           ++.  ..+-.-|++||..+.+..
T Consensus        28 ~~~~~FL~~Va~~s~~aGF~~tl~~aKKk-~p~~F~kg~~~~~~l~esGasLAlRALgWGTlyA~~G   93 (124)
T PF07096_consen   28 IKGGAFLGGVAGASALAGFGTTLALAKKK-SPKWFSKGISQTKALHESGASLALRALGWGTLYAVCG   93 (124)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CcHHHhccCcCcccCCcchHHHHHHHHhHHHHHHHHh
Confidence            34556677788888777777776666543 322           111  224667899998877653


No 3  
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=32.17  E-value=15  Score=27.26  Aligned_cols=11  Identities=18%  Similarity=0.392  Sum_probs=7.9

Q ss_pred             cchhhhhcCch
Q 037984            6 CCCPRMLADPA   16 (201)
Q Consensus         6 ~~r~RllADP~   16 (201)
                      +||.||++||.
T Consensus        18 ~Fr~~Ll~DPr   28 (77)
T TIGR03793        18 AFKQALLTNPK   28 (77)
T ss_pred             HHHHHHHHCHH
Confidence            47777777775


No 4  
>PF10247 Romo1:  Reactive mitochondrial oxygen species modulator 1;  InterPro: IPR018450 The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression.  This entry contains the mitochondrial protein, reactive oxygen species modulator 1 (Romo1), that is responsible for increasing the level of ROS in cells. In various cancer cell lines with elevated levels of ROS there is also an increased abundance of Romo1 []. Increased Romo1 expression can have a number of other affects including: inducing premature senescence of cultured human fibroblasts [, ] and increased resistance to 5-fluorouracil [].
Probab=31.46  E-value=30  Score=25.38  Aligned_cols=51  Identities=22%  Similarity=0.277  Sum_probs=30.9

Q ss_pred             hhhhhhhHhhhhHHHHHHHhhccCCCCC--CCCchhhhhHHHHHHHhhhhhhH
Q 037984           83 LCMVGLTAGAVQGSLSNYLAGKKDRLSV--TIPSVSTNALGYGAFLGLCANMR  133 (201)
Q Consensus        83 l~~VG~~ag~vg~~lsn~L~~kk~~~s~--~~ppv~~ta~~~g~fmGvSsNlR  133 (201)
                      =++||.+.|.+-...+-.=...+...-+  ....++.++.+.|.||++=|=+|
T Consensus        14 G~~VG~~~G~l~G~~~~~r~g~~~~~~~~~lg~~~l~sg~tFG~Fm~iGs~IR   66 (67)
T PF10247_consen   14 GGAVGGAFGALFGTFSAFRYGARGRGLMRTLGKYMLGSGATFGFFMSIGSVIR   66 (67)
T ss_pred             hhHHHhhhhhhhhhHHHhccCCCCcchHhHHhHHHhcchhHHHHHHhhhcccc
Confidence            3567777777666554332221111111  24568999999999999877655


No 5  
>PF07281 INSIG:  Insulin-induced protein (INSIG)
Probab=30.02  E-value=1.1e+02  Score=26.31  Aligned_cols=39  Identities=26%  Similarity=0.257  Sum_probs=25.2

Q ss_pred             HHHHHHhhhcccchhhHHHHHHhcccccccccccchHHhhHhhhhc
Q 037984          155 LFLSTALRSLPLSLLRICLLIYISIYIDRLFWSNQITIVLMFCLLN  200 (201)
Q Consensus       155 ~~~s~a~R~~Nn~lG~~~~v~~~G~~~~~~~~~~~~~~~~~~~~~~  200 (201)
                      .-.+.++|..|-++|=.     .++.+-|  +++++-..+.++++|
T Consensus        79 ~~w~~v~R~i~~FvGi~-----~airkl~--w~s~~Q~s~~lalln  117 (193)
T PF07281_consen   79 PDWSSVLRSIGAFVGIS-----FAIRKLP--WSSSLQASITLALLN  117 (193)
T ss_pred             ccHHHHHHHHHHHHHHH-----HHHhhCC--CCcHHHHHHHHHHHH
Confidence            33567799999988754     3344444  455666666777766


No 6  
>PF10653 Phage-A118_gp45:  Protein gp45 of Bacteriophage A118;  InterPro: IPR018915  The proteins in this entry represents Gp45 in Listeria phage A118 (Bacteriophage A118) and related proteins; Gp45 is thought to have a function in the phage tail-fibre system. 
Probab=28.19  E-value=54  Score=23.41  Aligned_cols=27  Identities=30%  Similarity=0.496  Sum_probs=18.2

Q ss_pred             hhhhhcCchhhHHHHHHHhhhhHHHHHHHH
Q 037984            8 CPRMLADPAFLYKLLVEQAPIIGCTVWWEL   37 (201)
Q Consensus         8 r~RllADP~Fl~Kl~~E~~i~i~~~~~~E~   37 (201)
                      |..|.|+|+|-+|+..   |-.||--+++|
T Consensus        22 rtkmianpaf~qkipl---ietgcekm~dy   48 (62)
T PF10653_consen   22 RTKMIANPAFQQKIPL---IETGCEKMTDY   48 (62)
T ss_pred             hHHHhcCHHHHhccch---hhhhhHHHHHH
Confidence            6689999999999853   23344444443


No 7  
>KOG4096 consensus Uncharacterized conserved protein [Function unknown]
Probab=26.24  E-value=23  Score=26.55  Aligned_cols=22  Identities=23%  Similarity=0.517  Sum_probs=19.6

Q ss_pred             CchhhhhHHHHHHHhhhhhhHH
Q 037984          113 PSVSTNALGYGAFLGLCANMRY  134 (201)
Q Consensus       113 ppv~~ta~~~g~fmGvSsNlRY  134 (201)
                      ..++.+|.++|.|||+-|-+||
T Consensus        50 kt~~~SagtFG~FM~igs~Ir~   71 (75)
T KOG4096|consen   50 KTMLQSAGTFGLFMGIGSGIRC   71 (75)
T ss_pred             HHHHhccchhhhhhhhhhheec
Confidence            4588999999999999998887


No 8  
>PF14407 Frankia_peptide:  Ribosomally synthesized peptide prototyped by Frankia Franean1_4349.
Probab=21.99  E-value=32  Score=24.92  Aligned_cols=13  Identities=31%  Similarity=0.445  Sum_probs=9.0

Q ss_pred             ccchhhhhcCchh
Q 037984            5 NCCCPRMLADPAF   17 (201)
Q Consensus         5 ~~~r~RllADP~F   17 (201)
                      .+||.|+++||.=
T Consensus        13 ~~FRqqllad~~~   25 (61)
T PF14407_consen   13 EAFRQQLLADPEE   25 (61)
T ss_pred             HHHHHHHhcCHHH
Confidence            3577777777764


No 9  
>PF06946 Phage_holin_5:  Phage holin;  InterPro: IPR009708 This entry represents the Bacteriophage A118, holin protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This protein family represent one of a large number of mutually dissimilar families of phage holins. It is thought that the temporal precision of holin-mediated lysis may occur through the build-up of a holin oligomer which causes the lysis [].
Probab=20.29  E-value=1.2e+02  Score=23.59  Aligned_cols=27  Identities=19%  Similarity=0.132  Sum_probs=21.4

Q ss_pred             ccchhhhHHHHHhhchhhhhhhhhHhhhhHHHHHHHhh
Q 037984           66 EFDLQKRIHSLFYKAAELCMVGLTAGAVQGSLSNYLAG  103 (201)
Q Consensus        66 ~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~  103 (201)
                      ++++.+|+.+           |.+||+.++++-...-+
T Consensus        57 ~~~l~~~~~a-----------G~laGlAaTGL~e~~t~   83 (93)
T PF06946_consen   57 DGNLALMAWA-----------GGLAGLAATGLFEQFTN   83 (93)
T ss_pred             CccHHHHHHH-----------HHHhhhhhhhHHHHHHh
Confidence            4677777654           88999999999888776


No 10 
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=18.55  E-value=36  Score=29.61  Aligned_cols=13  Identities=38%  Similarity=0.534  Sum_probs=9.0

Q ss_pred             ccchhhhhcCchh
Q 037984            5 NCCCPRMLADPAF   17 (201)
Q Consensus         5 ~~~r~RllADP~F   17 (201)
                      ++||+|||+||.=
T Consensus        54 p~FK~rLLaD~~a   66 (188)
T PF02979_consen   54 PAFKARLLADPTA   66 (188)
T ss_dssp             HHHHHHHHHSHHH
T ss_pred             HHHHHHHHHCHHH
Confidence            3577888888753


Done!