BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038007
(230 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1Q45|A Chain A, 12-0xo-Phytodienoate Reductase Isoform 3
pdb|1Q45|B Chain B, 12-0xo-Phytodienoate Reductase Isoform 3
pdb|2G5W|A Chain A, X-Ray Crystal Structure Of Arabidopsis Thaliana
12-Oxophytodienoate Reductase Isoform 3 (Atopr3) In
Complex With 8-Iso Prostaglandin A1 And Its Cofactor,
Flavin Mononucleotide.
pdb|2G5W|B Chain B, X-Ray Crystal Structure Of Arabidopsis Thaliana
12-Oxophytodienoate Reductase Isoform 3 (Atopr3) In
Complex With 8-Iso Prostaglandin A1 And Its Cofactor,
Flavin Mononucleotide.
pdb|2Q3O|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of
12-Oxo- Phytodienoate Reductase Isoform 3
pdb|2Q3O|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of
12-Oxo- Phytodienoate Reductase Isoform 3
Length = 391
Score = 27.7 bits (60), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
Query: 63 PAIFKSLLYEACGRIVNPIYGSVGLMWSGRWHLCQAAVEAVFRGEPVTPLSS 114
P I+ EA ++V ++ G ++ WH+ +A+ AV++ +P+SS
Sbjct: 78 PGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRAS-HAVYQPNGGSPISS 128
>pdb|4A3U|A Chain A, X-Structure Of The Old Yellow Enzyme Homologue From
Zymomonas Mobilis (Ncr)
pdb|4A3U|B Chain B, X-Structure Of The Old Yellow Enzyme Homologue From
Zymomonas Mobilis (Ncr)
Length = 358
Score = 27.7 bits (60), Expect = 6.2, Method: Compositional matrix adjust.
Identities = 14/54 (25%), Positives = 27/54 (50%)
Query: 63 PAIFKSLLYEACGRIVNPIYGSVGLMWSGRWHLCQAAVEAVFRGEPVTPLSSES 116
P I+ EA I ++ + GL+++ WH+ + V +PV P +S++
Sbjct: 70 PGIWSDAQVEAWLPITQAVHDAGGLIFAQLWHMGRMVPSNVSGMQPVAPSASQA 123
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.134 0.406
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,684,503
Number of Sequences: 62578
Number of extensions: 252546
Number of successful extensions: 478
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 477
Number of HSP's gapped (non-prelim): 2
length of query: 230
length of database: 14,973,337
effective HSP length: 96
effective length of query: 134
effective length of database: 8,965,849
effective search space: 1201423766
effective search space used: 1201423766
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)