BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038007
         (230 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1Q45|A Chain A, 12-0xo-Phytodienoate Reductase Isoform 3
 pdb|1Q45|B Chain B, 12-0xo-Phytodienoate Reductase Isoform 3
 pdb|2G5W|A Chain A, X-Ray Crystal Structure Of Arabidopsis Thaliana
           12-Oxophytodienoate Reductase Isoform 3 (Atopr3) In
           Complex With 8-Iso Prostaglandin A1 And Its Cofactor,
           Flavin Mononucleotide.
 pdb|2G5W|B Chain B, X-Ray Crystal Structure Of Arabidopsis Thaliana
           12-Oxophytodienoate Reductase Isoform 3 (Atopr3) In
           Complex With 8-Iso Prostaglandin A1 And Its Cofactor,
           Flavin Mononucleotide.
 pdb|2Q3O|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of
           12-Oxo- Phytodienoate Reductase Isoform 3
 pdb|2Q3O|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of
           12-Oxo- Phytodienoate Reductase Isoform 3
          Length = 391

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 63  PAIFKSLLYEACGRIVNPIYGSVGLMWSGRWHLCQAAVEAVFRGEPVTPLSS 114
           P I+     EA  ++V  ++   G ++   WH+ +A+  AV++    +P+SS
Sbjct: 78  PGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRAS-HAVYQPNGGSPISS 128


>pdb|4A3U|A Chain A, X-Structure Of  The Old Yellow Enzyme Homologue From
           Zymomonas Mobilis (Ncr)
 pdb|4A3U|B Chain B, X-Structure Of  The Old Yellow Enzyme Homologue From
           Zymomonas Mobilis (Ncr)
          Length = 358

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 27/54 (50%)

Query: 63  PAIFKSLLYEACGRIVNPIYGSVGLMWSGRWHLCQAAVEAVFRGEPVTPLSSES 116
           P I+     EA   I   ++ + GL+++  WH+ +     V   +PV P +S++
Sbjct: 70  PGIWSDAQVEAWLPITQAVHDAGGLIFAQLWHMGRMVPSNVSGMQPVAPSASQA 123


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.134    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,684,503
Number of Sequences: 62578
Number of extensions: 252546
Number of successful extensions: 478
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 477
Number of HSP's gapped (non-prelim): 2
length of query: 230
length of database: 14,973,337
effective HSP length: 96
effective length of query: 134
effective length of database: 8,965,849
effective search space: 1201423766
effective search space used: 1201423766
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)