Query         038007
Match_columns 230
No_of_seqs    131 out of 296
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 06:35:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038007.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038007hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03195 DUF260:  Protein of un 100.0 4.7E-46   1E-50  292.1   9.2  101    4-109     1-101 (101)
  2 PF14653 IGFL:  Insulin growth   21.9      47   0.001   26.5   1.1   14   13-26     43-56  (89)
  3 PRK00451 glycine dehydrogenase  20.8      66  0.0014   29.9   2.0   35   22-62      2-36  (447)
  4 PF04706 Dickkopf_N:  Dickkopf   20.2      53  0.0011   23.5   0.9   16    3-18     21-36  (52)
  5 PF03242 LEA_3:  Late embryogen  19.9      42 0.00091   26.6   0.4   20   70-89     58-77  (93)
  6 PF15300 INT_SG_DDX_CT_C:  INTS  19.2      64  0.0014   24.2   1.2   30   45-74     18-51  (65)
  7 PF05965 FYRC:  F/Y rich C-term  15.6 1.1E+02  0.0023   22.8   1.7   22   41-62     53-76  (86)
  8 PF00172 Zn_clus:  Fungal Zn(2)  14.0      89  0.0019   20.3   0.8   15    3-17      1-15  (40)
  9 PHA02616 VP2/VP3; Provisional   12.5 1.9E+02  0.0041   26.8   2.7   58   76-133    88-158 (259)
 10 smart00542 FYRC "FY-rich" doma  11.1 1.6E+02  0.0035   22.3   1.6   21   42-62     50-72  (86)

No 1  
>PF03195 DUF260:  Protein of unknown function DUF260;  InterPro: IPR004883 The lateral organ boundaries (LOB) gene is expressed at the adaxial base of initiating lateral organs and encodes a plant-specific protein of unknown function. The N-terminal one half of the LOB protein contains a conserved approximately 100-amino acid domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins and in proteins from a variety of other plant species. Genes encoding LOB domain (LBD) proteins are expressed in a variety of temporal- and tissue-specific patterns, suggesting that they may function in diverse processes [] The LOB domain contains conserved blocks of amino acids that identify the LBD gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is defining feature of the LOB domain, is present in all LBD proteins. It is possible that this motif forms a new zinc finger [].
Probab=100.00  E-value=4.7e-46  Score=292.12  Aligned_cols=101  Identities=26%  Similarity=0.538  Sum_probs=94.8

Q ss_pred             CChhhhhccCCCCCCCccccCCCCCCCchhhhhHHHHHHHHhccccHHHHHHcCCCCChHHHHHHhHHhhcccccCCCCc
Q 038007            4 SCNGCRVLRKGCGENCSIRPCLQWIKSPQCQANATLFLAKFYGRAGLVNLINAGPQDLRPAIFKSLLYEACGRIVNPIYG   83 (230)
Q Consensus         4 ~CAACK~lRRrC~~dCilAPYFP~~~~pe~qana~~fvhKvFG~sNv~klL~~lp~~~R~~a~~SLvYEA~aR~~DPVyG   83 (230)
                      +|||||||||+|+++|+||||||     ..+.+.|.+||||||++||+|||+++|+++|+++|+||+|||++|.+|||||
T Consensus         1 ~CaaCk~lRr~C~~~C~laPyFP-----~~~~~~F~~vhkvFG~sni~k~L~~~~~~~R~~a~~Sl~yEA~~R~~dPv~G   75 (101)
T PF03195_consen    1 PCAACKHLRRRCSPDCVLAPYFP-----ADQPQRFANVHKVFGVSNISKMLQELPPEQREDAMRSLVYEANARARDPVYG   75 (101)
T ss_pred             CChHHHHHhCCCCCCCcCCCCCC-----hhHHHHHHHHHHHHchhHHHHHHHhCCccchhhHHHHHHHHHHhhccCCCcc
Confidence            79999999999999999999999     3445677889999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhhHHHHHHHHHHHHcCCCC
Q 038007           84 SVGLMWSGRWHLCQAAVEAVFRGEPV  109 (230)
Q Consensus        84 cvGiI~~Lq~Ql~q~avEavl~g~~i  109 (230)
                      |+|+||.|||||++.++|+++.+..|
T Consensus        76 c~G~i~~L~~ql~~~~~el~~~~~~l  101 (101)
T PF03195_consen   76 CVGIISQLQQQLQQLQAELALVRAQL  101 (101)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHccC
Confidence            99999999999999999999877654


No 2  
>PF14653 IGFL:  Insulin growth factor-like family
Probab=21.87  E-value=47  Score=26.52  Aligned_cols=14  Identities=43%  Similarity=1.384  Sum_probs=13.0

Q ss_pred             CCCCCCCccccCCC
Q 038007           13 KGCGENCSIRPCLQ   26 (230)
Q Consensus        13 RrC~~dCilAPYFP   26 (230)
                      ++|..+|.|.|+|.
T Consensus        43 ~~Cg~~Ctf~pcfe   56 (89)
T PF14653_consen   43 RKCGPNCTFWPCFE   56 (89)
T ss_pred             cccCCCCCccCccc
Confidence            78999999999997


No 3  
>PRK00451 glycine dehydrogenase subunit 1; Validated
Probab=20.78  E-value=66  Score=29.86  Aligned_cols=35  Identities=17%  Similarity=0.257  Sum_probs=24.2

Q ss_pred             ccCCCCCCCchhhhhHHHHHHHHhccccHHHHHHcCCCCCh
Q 038007           22 RPCLQWIKSPQCQANATLFLAKFYGRAGLVNLINAGPQDLR   62 (230)
Q Consensus        22 APYFP~~~~pe~qana~~fvhKvFG~sNv~klL~~lp~~~R   62 (230)
                      -||.|  .+|+...    .+-+.||.++|-.++..+|.+.|
T Consensus         2 ~~~~~--~~~~~~~----~~~~~~~~~~~~~~~~~~p~~~~   36 (447)
T PRK00451          2 MPYIP--HTEEDIR----EMLDAIGVKSIDELFADIPEELR   36 (447)
T ss_pred             CCCCC--CCHHHHH----HHHHHhCCCCHHHHHHhCCHHHH
Confidence            38998  3455443    36799999999887776665443


No 4  
>PF04706 Dickkopf_N:  Dickkopf N-terminal cysteine-rich region;  InterPro: IPR006796 Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This family represents the N-terminal conserved region []. The C-terminal region has been found to share significant sequence similarity to the colipase fold (IPR001981 from INTERPRO) [].; GO: 0007275 multicellular organismal development, 0030178 negative regulation of Wnt receptor signaling pathway, 0005576 extracellular region
Probab=20.17  E-value=53  Score=23.53  Aligned_cols=16  Identities=38%  Similarity=0.796  Sum_probs=14.2

Q ss_pred             CCChhhhhccCCCCCC
Q 038007            3 VSCNGCRVLRKGCGEN   18 (230)
Q Consensus         3 ~~CAACK~lRRrC~~d   18 (230)
                      ..|..||-+|++|..|
T Consensus        21 ~~C~~Cr~~~~rC~Rd   36 (52)
T PF04706_consen   21 SKCLPCRKRRKRCTRD   36 (52)
T ss_pred             ccChhhccCCCCCCCC
Confidence            4699999999999976


No 5  
>PF03242 LEA_3:  Late embryogenesis abundant protein;  InterPro: IPR004926  Late-embryogenesis abundant (LEA) genes encode a diverse group of proteins that accumulate to high levels during the maturation phase of seed development [].  This group includes LEA-5 [], whose expression is induced by salt, drought and heat stress [], and related proteins. ; GO: 0006950 response to stress
Probab=19.88  E-value=42  Score=26.62  Aligned_cols=20  Identities=15%  Similarity=0.074  Sum_probs=16.4

Q ss_pred             HHhhcccccCCCCchhhhhh
Q 038007           70 LYEACGRIVNPIYGSVGLMW   89 (230)
Q Consensus        70 vYEA~aR~~DPVyGcvGiI~   89 (230)
                      -+|-..|..|||-|++--..
T Consensus        58 ~~~~~~W~pDPvTGyyrPen   77 (93)
T PF03242_consen   58 SKEKSSWMPDPVTGYYRPEN   77 (93)
T ss_pred             cccccccccCCCCccccCCC
Confidence            66778999999999986554


No 6  
>PF15300 INT_SG_DDX_CT_C:  INTS6/SAGE1/DDX26B/CT45 C-terminus
Probab=19.24  E-value=64  Score=24.20  Aligned_cols=30  Identities=23%  Similarity=0.449  Sum_probs=24.8

Q ss_pred             hcc--ccHHHHHHcC--CCCChHHHHHHhHHhhc
Q 038007           45 YGR--AGLVNLINAG--PQDLRPAIFKSLLYEAC   74 (230)
Q Consensus        45 FG~--sNv~klL~~l--p~~~R~~a~~SLvYEA~   74 (230)
                      +|.  +.|.++|+.+  |.+.|...+..++.||.
T Consensus        18 pGr~ye~iF~lL~~vqG~~~~r~~fv~~~IkEA~   51 (65)
T PF15300_consen   18 PGRNYEKIFKLLEQVQGPLEVRKQFVEMIIKEAA   51 (65)
T ss_pred             cCCcHHHHHHHHHHccCCHHHHHHHHHHHHHHHH
Confidence            454  4688889875  78999999999999995


No 7  
>PF05965 FYRC:  F/Y rich C-terminus;  InterPro: IPR003889 The "FY-rich" domain C-terminal region is sometimes closely juxtaposed with the N-terminal region (IPR003888 from INTERPRO), but sometimes is far distant. It is of unknown function, but occurs frequently in chromatin-associated proteins like trithorax and its homologues.; GO: 0005634 nucleus; PDB: 2WZO_A.
Probab=15.64  E-value=1.1e+02  Score=22.79  Aligned_cols=22  Identities=18%  Similarity=0.318  Sum_probs=17.9

Q ss_pred             HHHHhcccc--HHHHHHcCCCCCh
Q 038007           41 LAKFYGRAG--LVNLINAGPQDLR   62 (230)
Q Consensus        41 vhKvFG~sN--v~klL~~lp~~~R   62 (230)
                      -+.+||.++  |.++|++||-.++
T Consensus        53 G~~~FGls~p~V~~lie~Lp~a~~   76 (86)
T PF05965_consen   53 GPEMFGLSNPAVQRLIESLPGADK   76 (86)
T ss_dssp             HHHHHSTTSHHHHHHHTTSTTGGG
T ss_pred             HhHhcCCCCHHHHHHHHhCCCcch
Confidence            478999865  8999999997654


No 8  
>PF00172 Zn_clus:  Fungal Zn(2)-Cys(6) binuclear cluster domain;  InterPro: IPR001138 The N-terminal region of a number of fungal transcriptional regulatory proteins contains a Cys-rich motif that is involved in zinc-dependent binding of DNA. The region forms a binuclear Zn cluster, in which two Zn atoms are bound by six Cys residues [, ]. A wide range of proteins are known to contain this domain. These include the proteins involved in arginine, proline, pyrimidine, quinate, maltose and galactose metabolism; amide and GABA catabolism; leucine biosynthesis, amongst others.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1AJY_A 1ZME_C 2VEQ_A 1CLD_A 1PYI_B 1D66_A 3COQ_A 1AW6_A 2ER8_A 2ERE_A ....
Probab=14.02  E-value=89  Score=20.30  Aligned_cols=15  Identities=27%  Similarity=0.767  Sum_probs=10.7

Q ss_pred             CCChhhhhccCCCCC
Q 038007            3 VSCNGCRVLRKGCGE   17 (230)
Q Consensus         3 ~~CAACK~lRRrC~~   17 (230)
                      .+|..|+..+.+|..
T Consensus         1 ~aC~~Cr~rK~kCd~   15 (40)
T PF00172_consen    1 RACDRCRRRKVKCDG   15 (40)
T ss_dssp             -SBHHHHHHTS--ST
T ss_pred             CcChHHHhhCcCcCC
Confidence            379999999999986


No 9  
>PHA02616 VP2/VP3; Provisional
Probab=12.49  E-value=1.9e+02  Score=26.76  Aligned_cols=58  Identities=21%  Similarity=0.181  Sum_probs=39.3

Q ss_pred             cccCCCCchhhhhhhhhHHHHHHHHHHHHcCCCCccCCchhhh-------------cccccccccCCcchh
Q 038007           76 RIVNPIYGSVGLMWSGRWHLCQAAVEAVFRGEPVTPLSSESAL-------------QAGDIRHVSKDESSA  133 (230)
Q Consensus        76 R~~DPVyGcvGiI~~Lq~Ql~q~avEavl~g~~i~~~~~~~~~-------------~~~dirh~~~~~~~~  133 (230)
                      -.-|||.|.+-.+.++-.--.+-..-+++-|.|+...-...++             --||.-..-+|.+.+
T Consensus        88 gesDPVnaiv~qVrs~v~~~RerEllqi~aGqPld~s~gvsa~~~a~~~l~~a~ynf~YDas~LP~dGfNa  158 (259)
T PHA02616         88 GESDPVNAIVNQVRSAVTYNRERELLQILAGQPLDESRGVSALSAAAGALTEAAYNFIYDASNLPKDGFNA  158 (259)
T ss_pred             CCCChHHHHHHHHHHHHhhhhhHHHHHHHcCCCccCCCCeehhhhhhhhhhhhhhhhhcccccCCCcCccc
Confidence            3579999998888776544444456778999998854433321             257777777777754


No 10 
>smart00542 FYRC "FY-rich" domain, C-terminal region. is sometimes closely juxtaposed with the N-terminal region (FYRN), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
Probab=11.10  E-value=1.6e+02  Score=22.28  Aligned_cols=21  Identities=24%  Similarity=0.425  Sum_probs=16.6

Q ss_pred             HHHhcccc--HHHHHHcCCCCCh
Q 038007           42 AKFYGRAG--LVNLINAGPQDLR   62 (230)
Q Consensus        42 hKvFG~sN--v~klL~~lp~~~R   62 (230)
                      ..+||.++  |+++|++||..++
T Consensus        50 ~~mFGls~p~V~~lie~Lpga~~   72 (86)
T smart00542       50 EDMFGLSSPAVVKLIEQLPGVHQ   72 (86)
T ss_pred             HHHhCCCcHHHHHHHHhCCCchh
Confidence            46888865  8999999997553


Done!