Query         038029
Match_columns 101
No_of_seqs    105 out of 137
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:49:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038029.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038029hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04690 YABBY:  YABBY protein; 100.0 7.5E-37 1.6E-41  227.7   2.5  100    1-101    31-134 (170)
  2 PF11331 DUF3133:  Protein of u  87.9    0.34 7.5E-06   29.4   1.5   17    4-20     29-45  (46)
  3 PF10122 Mu-like_Com:  Mu-like   85.1    0.28 6.1E-06   30.6   0.1   14    5-18      3-16  (51)
  4 PF13719 zinc_ribbon_5:  zinc-r  84.4    0.59 1.3E-05   26.5   1.2   15    4-18     23-37  (37)
  5 PF13717 zinc_ribbon_4:  zinc-r  74.8     1.9 4.1E-05   24.4   1.2   13    4-16     23-35  (36)
  6 KOG4684 Uncharacterized conser  73.2     1.8 3.8E-05   34.7   1.1   17    4-20    168-184 (275)
  7 TIGR02098 MJ0042_CXXC MJ0042 f  72.1     2.4 5.2E-05   23.5   1.2   14    5-18     24-37  (38)
  8 COG4416 Com Mu-like prophage p  67.5     1.3 2.8E-05   28.3  -0.6   14    4-17      2-15  (60)
  9 PF01020 Ribosomal_L40e:  Ribos  63.1     2.9 6.3E-05   26.1   0.4    9    8-16     38-46  (52)
 10 PF05180 zf-DNL:  DNL zinc fing  60.6     5.3 0.00011   25.9   1.3   13    3-15     26-38  (66)
 11 PF13408 Zn_ribbon_recom:  Reco  55.9     5.9 0.00013   23.1   0.8   14    6-19      5-18  (58)
 12 TIGR01053 LSD1 zinc finger dom  52.4     6.4 0.00014   21.8   0.6   15    7-21      2-16  (31)
 13 COG4357 Zinc finger domain con  52.0     4.2   9E-05   28.7  -0.3   19    2-20     58-76  (105)
 14 PF03811 Zn_Tnp_IS1:  InsA N-te  49.4      13 0.00029   21.1   1.6   17    3-19      2-18  (36)
 15 PF09788 Tmemb_55A:  Transmembr  48.0      11 0.00024   30.3   1.4   17    4-20    155-171 (256)
 16 PF15227 zf-C3HC4_4:  zinc fing  44.9      12 0.00026   21.4   1.0   10    2-11      9-18  (42)
 17 TIGR02064 dsrA sulfite reducta  44.9       8 0.00017   32.4   0.3    9    7-15    275-283 (402)
 18 TIGR03114 cas_csf1 CRISPR-asso  39.7     8.1 0.00018   30.0  -0.4   15    6-20     32-46  (202)
 19 KOG1404 Alanine-glyoxylate ami  39.2      16 0.00035   31.4   1.2   12    3-14     58-69  (442)
 20 COG1756 Mra1 Uncharacterized c  38.6     8.4 0.00018   30.4  -0.5   10   91-100   102-111 (223)
 21 PF02150 RNA_POL_M_15KD:  RNA p  36.2      16 0.00035   20.4   0.6   12    8-19      3-14  (35)
 22 PF04690 YABBY:  YABBY protein;  36.0      17 0.00037   27.4   0.8   18    5-22     11-28  (170)
 23 PF05495 zf-CHY:  CHY zinc fing  35.8      18 0.00038   23.0   0.8   15    6-20     41-55  (71)
 24 PF06397 Desulfoferrod_N:  Desu  32.3      20 0.00043   20.6   0.5   12    7-18      7-18  (36)
 25 cd00246 RabGEF Nucleotide exch  31.0      25 0.00055   24.7   1.0   12    6-17      2-13  (103)
 26 PF12028 DUF3515:  Protein of u  27.5      31 0.00067   25.4   1.0    8    3-10     79-86  (163)
 27 PF04810 zf-Sec23_Sec24:  Sec23  27.4      28 0.00061   19.7   0.6   10    7-16      3-12  (40)
 28 PF15288 zf-CCHC_6:  Zinc knuck  23.4      31 0.00068   20.4   0.3    9    7-15      2-10  (40)
 29 PF05634 APO_RNA-bind:  APO RNA  22.4      43 0.00093   26.1   0.9   15    1-15     92-107 (204)
 30 PF11017 DUF2855:  Protein of u  22.1      32  0.0007   28.1   0.2   15   86-100    81-95  (314)
 31 PF02258 SLT_beta:  Shiga-like   20.9      77  0.0017   20.9   1.8   13    3-15     49-61  (70)
 32 PF00518 E6:  Early Protein (E6  20.8      51  0.0011   22.7   1.0   18    2-19     67-84  (110)
 33 PF04502 DUF572:  Family of unk  20.7      39 0.00085   27.2   0.4   10    6-15     40-49  (324)

No 1  
>PF04690 YABBY:  YABBY protein;  InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ].
Probab=100.00  E-value=7.5e-37  Score=227.70  Aligned_cols=100  Identities=41%  Similarity=0.548  Sum_probs=54.7

Q ss_pred             CCceeeEeCCCCCCccccccCccccc-ccc--ccccCCCCCChhhhhhchhhHHhhhhhcCCCCc-cccCCCCccccccC
Q 038029            1 MSMVVTVRCGHCTSLLSVNMMKASFV-PLH--LLASFSHDDEPKEEFRKEEVQADQKAFKRFSPS-ILTSSDNEEEDTGS   76 (101)
Q Consensus         1 l~~iVTVRCGHCtnLlSVNm~~~~~~-P~~--~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~ss~~~~~~~~~   76 (101)
                      ||+|||||||||||||||||++++++ |.+  +.+++..+..+..............+.++.+.+ .......++ +...
T Consensus        31 L~~~VTVRCGHCtNLLSVNm~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  109 (170)
T PF04690_consen   31 LLKTVTVRCGHCTNLLSVNMRALLQPLPSQDHLQHSLLPPQSQELQFQPENFGSNSSSSSSSSSSSSSSSMSFSE-EEEI  109 (170)
T ss_pred             hhhhhceeccCccceeeeeccccccCCCcccchhccccccccccccccccccccccccCCCccccccccccCccc-cccc
Confidence            79999999999999999999976432 322  111111111000000000000000011111111 111111222 3367


Q ss_pred             ccCCCCCCCCCccCCCCcccccCCC
Q 038029           77 VINHVVSKPPEKRQRAPSAYNRFIK  101 (101)
Q Consensus        77 p~~~~v~rPPEKRQRvPSAYNRFIK  101 (101)
                      |+.+.|+||||||||+|||||||||
T Consensus       110 pr~~~v~kPPEKRqR~psaYn~f~k  134 (170)
T PF04690_consen  110 PRAPPVNKPPEKRQRVPSAYNRFMK  134 (170)
T ss_pred             cccccccCCccccCCCchhHHHHHH
Confidence            8888899999999999999999998


No 2  
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=87.89  E-value=0.34  Score=29.43  Aligned_cols=17  Identities=35%  Similarity=0.899  Sum_probs=14.3

Q ss_pred             eeeEeCCCCCCcccccc
Q 038029            4 VVTVRCGHCTSLLSVNM   20 (101)
Q Consensus         4 iVTVRCGHCtnLlSVNm   20 (101)
                      .-.+|||.|..++++.+
T Consensus        29 ~~klrCGaCs~vl~~s~   45 (46)
T PF11331_consen   29 QQKLRCGACSEVLSFSL   45 (46)
T ss_pred             eeEEeCCCCceeEEEec
Confidence            45789999999998875


No 3  
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=85.11  E-value=0.28  Score=30.56  Aligned_cols=14  Identities=50%  Similarity=1.179  Sum_probs=11.5

Q ss_pred             eeEeCCCCCCcccc
Q 038029            5 VTVRCGHCTSLLSV   18 (101)
Q Consensus         5 VTVRCGHCtnLlSV   18 (101)
                      =.+|||||.-||--
T Consensus         3 ~eiRC~~CnklLa~   16 (51)
T PF10122_consen    3 KEIRCGHCNKLLAK   16 (51)
T ss_pred             cceeccchhHHHhh
Confidence            36899999999754


No 4  
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=84.45  E-value=0.59  Score=26.50  Aligned_cols=15  Identities=33%  Similarity=0.680  Sum_probs=11.9

Q ss_pred             eeeEeCCCCCCcccc
Q 038029            4 VVTVRCGHCTSLLSV   18 (101)
Q Consensus         4 iVTVRCGHCtnLlSV   18 (101)
                      ...|||++|...+.|
T Consensus        23 ~~~vrC~~C~~~f~v   37 (37)
T PF13719_consen   23 GRKVRCPKCGHVFRV   37 (37)
T ss_pred             CcEEECCCCCcEeeC
Confidence            357999999988654


No 5  
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=74.82  E-value=1.9  Score=24.38  Aligned_cols=13  Identities=31%  Similarity=0.754  Sum_probs=10.9

Q ss_pred             eeeEeCCCCCCcc
Q 038029            4 VVTVRCGHCTSLL   16 (101)
Q Consensus         4 iVTVRCGHCtnLl   16 (101)
                      .+.|||+.|.+.+
T Consensus        23 g~~v~C~~C~~~f   35 (36)
T PF13717_consen   23 GRKVRCSKCGHVF   35 (36)
T ss_pred             CcEEECCCCCCEe
Confidence            4789999999875


No 6  
>KOG4684 consensus Uncharacterized conserved protein, contains C4-type Zn-finger [General function prediction only]
Probab=73.24  E-value=1.8  Score=34.67  Aligned_cols=17  Identities=35%  Similarity=0.800  Sum_probs=13.1

Q ss_pred             eeeEeCCCCCCcccccc
Q 038029            4 VVTVRCGHCTSLLSVNM   20 (101)
Q Consensus         4 iVTVRCGHCtnLlSVNm   20 (101)
                      -+-|+||||.+..--|.
T Consensus       168 gcRV~CgHC~~tFLfnt  184 (275)
T KOG4684|consen  168 GCRVKCGHCNETFLFNT  184 (275)
T ss_pred             ceEEEecCccceeehhh
Confidence            37899999999765553


No 7  
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=72.12  E-value=2.4  Score=23.47  Aligned_cols=14  Identities=36%  Similarity=0.788  Sum_probs=11.1

Q ss_pred             eeEeCCCCCCcccc
Q 038029            5 VTVRCGHCTSLLSV   18 (101)
Q Consensus         5 VTVRCGHCtnLlSV   18 (101)
                      ..|+|++|.+.+.|
T Consensus        24 ~~v~C~~C~~~~~~   37 (38)
T TIGR02098        24 GKVRCGKCGHVWYA   37 (38)
T ss_pred             CEEECCCCCCEEEe
Confidence            46999999987654


No 8  
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=67.50  E-value=1.3  Score=28.28  Aligned_cols=14  Identities=43%  Similarity=1.051  Sum_probs=11.6

Q ss_pred             eeeEeCCCCCCccc
Q 038029            4 VVTVRCGHCTSLLS   17 (101)
Q Consensus         4 iVTVRCGHCtnLlS   17 (101)
                      +-|.||-||.-||-
T Consensus         2 ~~tiRC~~CnKlLa   15 (60)
T COG4416           2 MQTIRCAKCNKLLA   15 (60)
T ss_pred             ceeeehHHHhHHHH
Confidence            45899999999853


No 9  
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=63.10  E-value=2.9  Score=26.15  Aligned_cols=9  Identities=44%  Similarity=1.113  Sum_probs=5.5

Q ss_pred             eCCCCCCcc
Q 038029            8 RCGHCTSLL   16 (101)
Q Consensus         8 RCGHCtnLl   16 (101)
                      +|||++||-
T Consensus        38 kCGhsn~LR   46 (52)
T PF01020_consen   38 KCGHSNNLR   46 (52)
T ss_dssp             SCTS-S-EE
T ss_pred             cCCCCcccC
Confidence            499999983


No 10 
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=60.65  E-value=5.3  Score=25.89  Aligned_cols=13  Identities=38%  Similarity=0.677  Sum_probs=8.6

Q ss_pred             ceeeEeCCCCCCc
Q 038029            3 MVVTVRCGHCTSL   15 (101)
Q Consensus         3 ~iVTVRCGHCtnL   15 (101)
                      -+|-|||+.|.|.
T Consensus        26 GvViv~C~gC~~~   38 (66)
T PF05180_consen   26 GVVIVQCPGCKNR   38 (66)
T ss_dssp             SEEEEE-TTS--E
T ss_pred             CeEEEECCCCcce
Confidence            3799999999996


No 11 
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=55.86  E-value=5.9  Score=23.07  Aligned_cols=14  Identities=43%  Similarity=1.009  Sum_probs=11.2

Q ss_pred             eEeCCCCCCccccc
Q 038029            6 TVRCGHCTSLLSVN   19 (101)
Q Consensus         6 TVRCGHCtnLlSVN   19 (101)
                      .|+||+|..-+...
T Consensus         5 ~l~C~~CG~~m~~~   18 (58)
T PF13408_consen    5 LLRCGHCGSKMTRR   18 (58)
T ss_pred             cEEcccCCcEeEEE
Confidence            47999999886664


No 12 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=52.44  E-value=6.4  Score=21.83  Aligned_cols=15  Identities=40%  Similarity=0.673  Sum_probs=12.0

Q ss_pred             EeCCCCCCccccccC
Q 038029            7 VRCGHCTSLLSVNMM   21 (101)
Q Consensus         7 VRCGHCtnLlSVNm~   21 (101)
                      |.||+|..+|..--+
T Consensus         2 ~~C~~C~t~L~yP~g   16 (31)
T TIGR01053         2 VVCGGCRTLLMYPRG   16 (31)
T ss_pred             cCcCCCCcEeecCCC
Confidence            689999999876543


No 13 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=51.98  E-value=4.2  Score=28.66  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=14.8

Q ss_pred             CceeeEeCCCCCCcccccc
Q 038029            2 SMVVTVRCGHCTSLLSVNM   20 (101)
Q Consensus         2 ~~iVTVRCGHCtnLlSVNm   20 (101)
                      ++.=.|-||+|-++|+++=
T Consensus        58 ~~~~~iiCGvC~~~LT~~E   76 (105)
T COG4357          58 FNPKAIICGVCRKLLTRAE   76 (105)
T ss_pred             cCCccEEhhhhhhhhhHHH
Confidence            3445688999999999873


No 14 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=49.36  E-value=13  Score=21.13  Aligned_cols=17  Identities=29%  Similarity=0.577  Sum_probs=14.3

Q ss_pred             ceeeEeCCCCCCccccc
Q 038029            3 MVVTVRCGHCTSLLSVN   19 (101)
Q Consensus         3 ~iVTVRCGHCtnLlSVN   19 (101)
                      .+|+|.|-+|.+-.+|.
T Consensus         2 a~i~v~CP~C~s~~~v~   18 (36)
T PF03811_consen    2 AKIDVHCPRCQSTEGVK   18 (36)
T ss_pred             CcEeeeCCCCCCCCcce
Confidence            57999999999887664


No 15 
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=47.97  E-value=11  Score=30.32  Aligned_cols=17  Identities=35%  Similarity=0.778  Sum_probs=13.3

Q ss_pred             eeeEeCCCCCCcccccc
Q 038029            4 VVTVRCGHCTSLLSVNM   20 (101)
Q Consensus         4 iVTVRCGHCtnLlSVNm   20 (101)
                      ..-|+||||.+-..-|.
T Consensus       155 ~~rv~CghC~~~Fl~~~  171 (256)
T PF09788_consen  155 SCRVICGHCSNTFLFNT  171 (256)
T ss_pred             ceeEECCCCCCcEeccC
Confidence            35699999999876664


No 16 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=44.92  E-value=12  Score=21.44  Aligned_cols=10  Identities=40%  Similarity=0.840  Sum_probs=6.9

Q ss_pred             CceeeEeCCC
Q 038029            2 SMVVTVRCGH   11 (101)
Q Consensus         2 ~~iVTVRCGH   11 (101)
                      -+-||..|||
T Consensus         9 ~~Pv~l~CGH   18 (42)
T PF15227_consen    9 KDPVSLPCGH   18 (42)
T ss_dssp             SSEEE-SSSS
T ss_pred             CCccccCCcC
Confidence            4568888888


No 17 
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit. This model describes the alpha subunit of sulfite reductase.
Probab=44.88  E-value=8  Score=32.41  Aligned_cols=9  Identities=56%  Similarity=1.176  Sum_probs=8.1

Q ss_pred             EeCCCCCCc
Q 038029            7 VRCGHCTSL   15 (101)
Q Consensus         7 VRCGHCtnL   15 (101)
                      ||||||-|.
T Consensus       275 ~~Cm~Ci~~  283 (402)
T TIGR02064       275 VRCMHCINK  283 (402)
T ss_pred             CcCcccccc
Confidence            799999995


No 18 
>TIGR03114 cas_csf1 CRISPR-associated protein, Csf1 family. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf1 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies closest to the repeats.
Probab=39.72  E-value=8.1  Score=30.00  Aligned_cols=15  Identities=53%  Similarity=1.143  Sum_probs=12.1

Q ss_pred             eEeCCCCCCcccccc
Q 038029            6 TVRCGHCTSLLSVNM   20 (101)
Q Consensus         6 TVRCGHCtnLlSVNm   20 (101)
                      +--||||+-|+|-.|
T Consensus        32 ~~vCG~C~al~skd~   46 (202)
T TIGR03114        32 GMVCGHCTALMSKDM   46 (202)
T ss_pred             CeeecccHHHhhHHH
Confidence            346999999998665


No 19 
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism]
Probab=39.20  E-value=16  Score=31.41  Aligned_cols=12  Identities=50%  Similarity=0.872  Sum_probs=10.3

Q ss_pred             ceeeEeCCCCCC
Q 038029            3 MVVTVRCGHCTS   14 (101)
Q Consensus         3 ~iVTVRCGHCtn   14 (101)
                      -+|||-||||-=
T Consensus        58 Gi~tvslGHchP   69 (442)
T KOG1404|consen   58 GIVTVSLGHCHP   69 (442)
T ss_pred             CeEEEEcCCCCh
Confidence            489999999964


No 20 
>COG1756 Mra1 Uncharacterized conserved protein [Function unknown]
Probab=38.56  E-value=8.4  Score=30.39  Aligned_cols=10  Identities=70%  Similarity=1.261  Sum_probs=9.1

Q ss_pred             CCCcccccCC
Q 038029           91 RAPSAYNRFI  100 (101)
Q Consensus        91 RvPSAYNRFI  100 (101)
                      |+|--|||||
T Consensus       102 R~Prny~RFi  111 (223)
T COG1756         102 RLPRNYNRFI  111 (223)
T ss_pred             cCCCCHHHHH
Confidence            5999999997


No 21 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=36.18  E-value=16  Score=20.42  Aligned_cols=12  Identities=33%  Similarity=0.653  Sum_probs=9.3

Q ss_pred             eCCCCCCccccc
Q 038029            8 RCGHCTSLLSVN   19 (101)
Q Consensus         8 RCGHCtnLlSVN   19 (101)
                      -|..|.|||.+-
T Consensus         3 FCp~C~nlL~p~   14 (35)
T PF02150_consen    3 FCPECGNLLYPK   14 (35)
T ss_dssp             BETTTTSBEEEE
T ss_pred             eCCCCCccceEc
Confidence            388999998753


No 22 
>PF04690 YABBY:  YABBY protein;  InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ].
Probab=35.95  E-value=17  Score=27.44  Aligned_cols=18  Identities=28%  Similarity=0.667  Sum_probs=15.1

Q ss_pred             eeEeCCCCCCccccccCc
Q 038029            5 VTVRCGHCTSLLSVNMMK   22 (101)
Q Consensus         5 VTVRCGHCtnLlSVNm~~   22 (101)
                      --|+|+.|+-+|=|+...
T Consensus        11 CYVhCnFC~TiLaVsVP~   28 (170)
T PF04690_consen   11 CYVHCNFCNTILAVSVPC   28 (170)
T ss_pred             EEEEcCCcCeEEEEecch
Confidence            469999999999998753


No 23 
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=35.82  E-value=18  Score=23.05  Aligned_cols=15  Identities=27%  Similarity=0.702  Sum_probs=10.6

Q ss_pred             eEeCCCCCCcccccc
Q 038029            6 TVRCGHCTSLLSVNM   20 (101)
Q Consensus         6 TVRCGHCtnLlSVNm   20 (101)
                      .|.||.|...++++-
T Consensus        41 ~v~Cg~C~~~~~~~~   55 (71)
T PF05495_consen   41 RVICGKCRTEQPIDE   55 (71)
T ss_dssp             EEEETTT--EEES-S
T ss_pred             CeECCCCCCccChhh
Confidence            799999999998874


No 24 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=32.35  E-value=20  Score=20.63  Aligned_cols=12  Identities=33%  Similarity=1.049  Sum_probs=6.8

Q ss_pred             EeCCCCCCcccc
Q 038029            7 VRCGHCTSLLSV   18 (101)
Q Consensus         7 VRCGHCtnLlSV   18 (101)
                      -||-||.|+--|
T Consensus         7 YkC~~CGniVev   18 (36)
T PF06397_consen    7 YKCEHCGNIVEV   18 (36)
T ss_dssp             EE-TTT--EEEE
T ss_pred             EEccCCCCEEEE
Confidence            589999998653


No 25 
>cd00246 RabGEF Nucleotide exchange factor for Rab-like small GTPases (RabGEF), Mss4 type; RabGEF positely regulates the function of  Rab GTPase by promoting exchange of GDP for GTP; members of the Rab subfamily of Ras GTPases are important in vesicular transport;
Probab=31.03  E-value=25  Score=24.66  Aligned_cols=12  Identities=33%  Similarity=0.639  Sum_probs=9.8

Q ss_pred             eEeCCCCCCccc
Q 038029            6 TVRCGHCTSLLS   17 (101)
Q Consensus         6 TVRCGHCtnLlS   17 (101)
                      +|+|.||.++.-
T Consensus         2 ~v~C~~C~S~VL   13 (103)
T cd00246           2 AVLCQRCGSRVL   13 (103)
T ss_pred             ceECCCCCCEEE
Confidence            689999999643


No 26 
>PF12028 DUF3515:  Protein of unknown function (DUF3515);  InterPro: IPR021903  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 166 to 214 amino acids in length. This protein has a conserved RCG sequence motif. 
Probab=27.54  E-value=31  Score=25.42  Aligned_cols=8  Identities=50%  Similarity=1.007  Sum_probs=6.7

Q ss_pred             ceeeEeCC
Q 038029            3 MVVTVRCG   10 (101)
Q Consensus         3 ~iVTVRCG   10 (101)
                      .-|++|||
T Consensus        79 ~~vvlRCG   86 (163)
T PF12028_consen   79 EPVVLRCG   86 (163)
T ss_pred             CcEEEECC
Confidence            36899999


No 27 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=27.44  E-value=28  Score=19.75  Aligned_cols=10  Identities=50%  Similarity=1.185  Sum_probs=4.9

Q ss_pred             EeCCCCCCcc
Q 038029            7 VRCGHCTSLL   16 (101)
Q Consensus         7 VRCGHCtnLl   16 (101)
                      |||.+|...+
T Consensus         3 ~rC~~C~ayl   12 (40)
T PF04810_consen    3 VRCRRCRAYL   12 (40)
T ss_dssp             -B-TTT--BS
T ss_pred             cccCCCCCEE
Confidence            7999998774


No 28 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=23.36  E-value=31  Score=20.35  Aligned_cols=9  Identities=33%  Similarity=1.154  Sum_probs=7.7

Q ss_pred             EeCCCCCCc
Q 038029            7 VRCGHCTSL   15 (101)
Q Consensus         7 VRCGHCtnL   15 (101)
                      |||+.|..+
T Consensus         2 ~kC~~CG~~   10 (40)
T PF15288_consen    2 VKCKNCGAF   10 (40)
T ss_pred             ccccccccc
Confidence            789999876


No 29 
>PF05634 APO_RNA-bind:  APO RNA-binding;  InterPro: IPR008512 This family consists of plant APO (accumulation of photosystem 1) proteins.
Probab=22.43  E-value=43  Score=26.13  Aligned_cols=15  Identities=33%  Similarity=0.771  Sum_probs=11.4

Q ss_pred             CCceeeE-eCCCCCCc
Q 038029            1 MSMVVTV-RCGHCTSL   15 (101)
Q Consensus         1 l~~iVTV-RCGHCtnL   15 (101)
                      |+++++| .||.|.-+
T Consensus        92 Lm~v~pV~~C~~C~EV  107 (204)
T PF05634_consen   92 LMKVYPVKACGYCPEV  107 (204)
T ss_pred             HheeeeeeecCCCCCe
Confidence            5677777 49999875


No 30 
>PF11017 DUF2855:  Protein of unknown function (DUF2855);  InterPro: IPR021276  This family of proteins has no known function. 
Probab=22.07  E-value=32  Score=28.14  Aligned_cols=15  Identities=27%  Similarity=0.689  Sum_probs=13.1

Q ss_pred             CCccCCCCcccccCC
Q 038029           86 PEKRQRAPSAYNRFI  100 (101)
Q Consensus        86 PEKRQRvPSAYNRFI  100 (101)
                      -|-||=+|..||||.
T Consensus        81 s~hR~~l~~~YN~Y~   95 (314)
T PF11017_consen   81 SPHRAGLPPIYNQYL   95 (314)
T ss_pred             hhhhCcCchhhhcee
Confidence            477999999999985


No 31 
>PF02258 SLT_beta:  Shiga-like toxin beta subunit;  InterPro: IPR003189 This family represents the B subunit of shiga-like toxin (SLT or verotoxin) produced by some strains of Escherichia coli associated with hemorrhagic colitis and hemolytic uremic syndrome. SLT s are composed of one enzymatic A subunit and five cell binding B subunits.; GO: 0019836 hemolysis by symbiont of host erythrocytes, 0005576 extracellular region; PDB: 2GA4_B 1R4P_D 1BOS_I 4ULL_A 2C5C_I 1QNU_C 1CZW_F 1D1I_C 1CZG_D 2XSC_D ....
Probab=20.91  E-value=77  Score=20.87  Aligned_cols=13  Identities=38%  Similarity=0.639  Sum_probs=11.3

Q ss_pred             ceeeEeCCCCCCc
Q 038029            3 MVVTVRCGHCTSL   15 (101)
Q Consensus         3 ~iVTVRCGHCtnL   15 (101)
                      ++||++|--|.+=
T Consensus        49 ~~vTi~~~sc~sG   61 (70)
T PF02258_consen   49 MTVTIKTNSCESG   61 (70)
T ss_dssp             SEEEEESSSSSTT
T ss_pred             eEEEEEeecccCC
Confidence            5899999999874


No 32 
>PF00518 E6:  Early Protein (E6);  InterPro: IPR001334 The papillomavirus E6 oncoproteins are small zinc-binding proteins that share a conserved zinc-binding CXXC motif and do not have identified intrinsic enzymatic activity. E6 proteins are thought to act as adapter proteins, thereby altering the function of E6-associated cellular proteins. This model for E6 function is best supported by observations of human papillomavirus type 16 (HPV-16) E6 (16E6), which can alter the metabolism of the p53 tumor suppressor through association with a cellular E3 ubiquitin ligase called E6AP. HPV-16 E6 interacts with an 18-amino-acid sequence in E6AP, and in an as yet ill-defined fashion the E6AP-16E6 complex binds to p53, inducing the ubiquitin-dependent degradation of the trimolecular complex. 16E6 apparently functions as an adapter protein in the complex with p53, since E6AP does not interact with p53 in the absence of E6 and since the degradation of p53 requires both E6 and E6AP. Despite the similarity in structure of the E6 oncoproteins, studies have indicated surprising biochemical diversity among E6 oncoproteins of different papillomavirus types. E6 from the cancer-associated human papillomaviruses (HPVs) complex with a cellular protein termed E6-AP and together with E6-AP bind to the p53 tumor suppressor protein thereby degrading p53 through ubiquitin-mediated proteolysis. E6 from the non-cancer-associated HPV types do not bind E6-AP or degrade p53. Bovine papilloma virus E6 (BE6) binds E6-AP but fails either to complex with p53 or to degrade associated proteins, implying that BE6 might transform cells through a mechanism different from that of the HPVs. In addition to targeting p53, E6 of both cancer-associated HPVs and BPV-1 have been shown to associate with a cellular-calcium-binding protein localized to the endoplasmic reticulum [, ].; GO: 0003677 DNA binding, 0042025 host cell nucleus; PDB: 2LJY_B 2LJX_A 2LJZ_A 2FK4_A 3PY7_A.
Probab=20.77  E-value=51  Score=22.67  Aligned_cols=18  Identities=22%  Similarity=0.405  Sum_probs=11.0

Q ss_pred             CceeeEeCCCCCCccccc
Q 038029            2 SMVVTVRCGHCTSLLSVN   19 (101)
Q Consensus         2 ~~iVTVRCGHCtnLlSVN   19 (101)
                      +.-+.|||-+|-.+|+..
T Consensus        67 l~~i~iRC~~C~k~L~~~   84 (110)
T PF00518_consen   67 LSDIIIRCYYCLKPLTPS   84 (110)
T ss_dssp             CCCSEEEETTT--B--HH
T ss_pred             eeEEEEEhHHcCCcCCHH
Confidence            346899999999987754


No 33 
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=20.75  E-value=39  Score=27.23  Aligned_cols=10  Identities=20%  Similarity=0.807  Sum_probs=5.2

Q ss_pred             eEeCCCCCCc
Q 038029            6 TVRCGHCTSL   15 (101)
Q Consensus         6 TVRCGHCtnL   15 (101)
                      +|||.+|.+-
T Consensus        40 ~i~C~~C~~~   49 (324)
T PF04502_consen   40 NIWCNTCGEY   49 (324)
T ss_pred             cCcCCCCccc
Confidence            4455555554


Done!