Citrus Sinensis ID: 038066

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Protein Sequence
MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYPC
Secondary Structure (PSIPRED)
ccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccEEEEcEEcc
Secondary Structure Prediction (SSPRO)
ccccccccccHHHHHHHHHHHHHEEcccHcccccHHEEEEEcccccEEcccccccEEEEEccccccccccccccccccccccEEEcccEEEEEcccc
Coil and Loop (DISEMBL)
mehlcsdsfsrNEVIRCMHMRLLRvrkdpadrplMATIVLVLDSysiilpvpqqpvfFIVErrgasqqkkfecsnksmsksmpwsvdetsitevypc
Flexible Loop (DISEMBL)
mehlcsdsfsrnEVIRCMHMRLlrvrkdpadrPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAsqqkkfecsnksmsksmpwsvdetsitevypc
Low Complexity Region (SEG)
MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYPC
Disordered region (IsUnstruct)
***********NEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVER***********************************
Disordered Region (DISOPRED)
MEHL***SFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFF****************************DETSITEVYPC
Disordered Region (DISEMBL)
MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRG*********************************
Disordered Region (DISPRO)
***LCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVER******************SMPWSVDETSITEVYPC
Transmembrane Helix (TMHMM)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (Phobius)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYPC
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	97	2.2.26 [Sep-21-2011]
Q8GYA4	669	Cysteine-rich receptor-li	yes	no	0.835	0.121	0.476	5e-16
Q9C5S9	674	Cysteine-rich receptor-li	no	no	0.958	0.137	0.385	3e-15
Q3E9X6	690	Cysteine-rich receptor-li	no	no	0.927	0.130	0.444	5e-14
Q8L7G3	659	Cysteine-rich receptor-li	no	no	0.907	0.133	0.384	8e-14
O65468	676	Cysteine-rich receptor-li	no	no	0.958	0.137	0.364	8e-14
Q9LDM5	666	Putative cysteine-rich re	no	no	0.927	0.135	0.422	1e-13
Q9M0X5	675	Cysteine-rich receptor-li	no	no	0.865	0.124	0.385	2e-12
Q9LDQ3	669	Putative cysteine-rich re	no	no	0.907	0.131	0.406	2e-12
O65479	666	Putative cysteine-rich re	no	no	0.876	0.127	0.422	3e-12
Q9LDS6	656	Putative cysteine-rich re	no	no	0.927	0.137	0.422	3e-12

>sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 41/86 (47%), Positives = 59/86 (68%), Gaps = 5/86 (5%)

Query: 11  RNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGASQQKK 70
           RNEV+RC+H+ LL V++DPA+RP ++TIVL+L S ++ LPVP+QP  F   R G     K
Sbjct: 588 RNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIG-----K 642

Query: 71  FECSNKSMSKSMPWSVDETSITEVYP 96
                 + SKS+  SVD+ SIT+++P
Sbjct: 643 DPLDTDTTSKSLLGSVDDASITDIHP 668

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -

>sp|Q9C5S9|CRK6_ARATH Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 65/96 (67%), Gaps = 3/96 (3%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           ++ L +++   +EV+RC+H+ LL V++DPA RP ++T+ ++L S ++ LPVP+QP FFI 
Sbjct: 581 VDPLIAENCQNSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQ 640

Query: 61  ERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
            R   + +   +    + +KS P S+D+ SIT++YP
Sbjct: 641 CR---AVKDPLDSDQSTTTKSFPASIDDESITDLYP 673

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q3E9X6|CRK21_ARATH Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana GN=CRK21 PE=2 SV=1

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 56/90 (62%)

Query: 7   DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
           +++ ++EVIRC+H+ LL V+++P DRP M+TI  +L + SI LPVPQ P FF  ER   +
Sbjct: 600 ENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFRERSEPN 659

Query: 67  QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
              +      S S S   SVD+ SIT V P
Sbjct: 660 PLAERLLPGPSTSMSFTCSVDDASITSVRP 689

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q8L7G3|CRK7_ARATH Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=2 SV=1

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/91 (38%), Positives = 60/91 (65%), Gaps = 3/91 (3%)

Query: 6   SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGA 65
           +DS  ++EV+RC H+ LL V++DP  RP M+TI ++L S ++ LP PQQP FF+  R G 
Sbjct: 571 ADSCRKSEVVRCTHIGLLCVQEDPVKRPAMSTISVMLTSNTMALPAPQQPGFFVRSRPGT 630

Query: 66  SQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
           +   + +    + +KS+  S+D+ S++++ P
Sbjct: 631 N---RLDSDQSTTNKSVTVSIDDKSMSDLDP 658

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 3/96 (3%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           ++ L +++   +EV+RC+H+ LL V++DPA RP ++T+ ++L S ++ LPVP+QP FFI 
Sbjct: 583 VDPLIANNCQNSEVVRCIHIGLLCVQEDPAKRPTISTVFMMLTSNTVTLPVPRQPGFFI- 641

Query: 61  ERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
             + +  +   +    + +KS P S+D+  IT++YP
Sbjct: 642 --QSSPVKDPTDSDQSTTTKSTPASIDDELITDLYP 675

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q9LDM5|CRK31_ARATH Putative cysteine-rich receptor-like protein kinase 31 OS=Arabidopsis thaliana GN=CRK31 PE=3 SV=1

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 54/90 (60%)

Query: 7   DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
           +S+  +EVIRC+H+ +L V++ PADRP M+TI  +L + SI LPVP+ P FF   R    
Sbjct: 576 ESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGFFFRNRPNLD 635

Query: 67  QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                    +S S S+P+S+D  SIT   P
Sbjct: 636 PLTYGSEQGQSSSMSVPFSIDSASITRATP 665

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 61/96 (63%), Gaps = 12/96 (12%)

Query: 8   SFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVE------ 61
           +F  NEVIRC+H+ LL V++D ++RP M  I+++++S+++ LP+P++  F +        
Sbjct: 584 NFQTNEVIRCIHIALLCVQEDSSERPSMDDILVMMNSFTVTLPIPKRSGFLLRTMKDSRD 643

Query: 62  -RRGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
            R G S        + + SKS+P SVD++SIT VYP
Sbjct: 644 PRSGGSAS-----DHSATSKSLPLSVDDSSITIVYP 674

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q9LDQ3|CRK35_ARATH Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=3

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 59/91 (64%), Gaps = 3/91 (3%)

Query: 6   SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGA 65
            +S+  +E  RC+H+ LL V++DPADRPL+  I+++L S +  L VP+ P F +  R   
Sbjct: 581 GESYQSSEATRCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHVPRAPGFCLSGRD-- 638

Query: 66  SQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
            +Q   E + +S S+S+P S+++ SITE YP
Sbjct: 639 LEQDGVEYT-ESTSRSIPGSINDASITEFYP 668

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 5/90 (5%)

Query: 7   DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
           D++  +E+ RC+H+ LL V++D  DRP M+ IV +L + SI L VP+ P FF+      S
Sbjct: 581 DNYQTSEITRCIHIALLCVQEDANDRPTMSAIVQMLTTSSIALAVPRPPGFFL-----RS 635

Query: 67  QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
           +Q++ E +  SM  S  +S+DE SIT V P
Sbjct: 636 KQEQAERACPSMDTSDLFSIDEASITSVAP 665

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q9LDS6|CRK32_ARATH Putative cysteine-rich receptor-like protein kinase 32 OS=Arabidopsis thaliana GN=CRK32 PE=3 SV=1

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%)

Query: 7   DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
           +S   ++VIRC+H+ LL V++ P DRP M+TI  +L + SI LPVP+ P FF   R    
Sbjct: 566 ESCDNDKVIRCIHIGLLCVQETPVDRPEMSTIFQMLTNSSITLPVPRPPGFFFRNRSNLD 625

Query: 67  QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                    +S SKS+P+++D  SIT V P
Sbjct: 626 PLTYGSELGQSSSKSIPYTIDSASITRVTP 655

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	97
359496581	666	PREDICTED: cysteine-rich receptor-like p	0.948	0.138	0.565	1e-23
296088180	699	unnamed protein product [Vitis vinifera]	0.948	0.131	0.565	1e-23
224113935	674	predicted protein [Populus trichocarpa]	0.979	0.140	0.551	4e-23
296087502	632	unnamed protein product [Vitis vinifera]	0.948	0.145	0.56	4e-23
359475759	739	PREDICTED: cysteine-rich receptor-like p	0.948	0.124	0.56	1e-22
147821544	655	hypothetical protein VITISV_034184 [Viti	0.948	0.140	0.56	1e-22
224076439	533	predicted protein [Populus trichocarpa]	0.907	0.165	0.572	1e-20
359474715	684	PREDICTED: cysteine-rich receptor-like p	0.907	0.128	0.565	1e-20
224076518	643	predicted protein [Populus trichocarpa]	0.927	0.139	0.553	1e-20
359484134	665	PREDICTED: cysteine-rich receptor-like p	0.948	0.138	0.52	7e-20

>gi|359496581|ref|XP_002270035.2| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Vitis vinifera]

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 74/99 (74%), Gaps = 7/99 (7%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP FFI 
Sbjct: 571 MDPIMRDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPAFFI- 629

Query: 61  ERRGASQQKKFEC---SNKSMSKSMPWSVDETSITEVYP 96
              G+  Q  F     S++S SKS PWSV+ETSI+E+YP
Sbjct: 630 ---GSGTQSGFPIKAESDQSTSKSTPWSVNETSISELYP 665

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296088180|emb|CBI35672.3| unnamed protein product [Vitis vinifera]

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 74/99 (74%), Gaps = 7/99 (7%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP FFI 
Sbjct: 604 MDPIMRDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPAFFI- 662

Query: 61  ERRGASQQKKFEC---SNKSMSKSMPWSVDETSITEVYP 96
              G+  Q  F     S++S SKS PWSV+ETSI+E+YP
Sbjct: 663 ---GSGTQSGFPIKAESDQSTSKSTPWSVNETSISELYP 698

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224113935|ref|XP_002316618.1| predicted protein [Populus trichocarpa] gi|222859683|gb|EEE97230.1| predicted protein [Populus trichocarpa]

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 76/98 (77%), Gaps = 3/98 (3%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+   +D++SRNEV+RC+H+ LL V++DPA RP MAT+VL+L+SYSI LP+PQ+P FF+ 
Sbjct: 577 MDPTLADTYSRNEVMRCIHIGLLCVQEDPASRPTMATVVLLLNSYSITLPLPQEPAFFLH 636

Query: 61  ER--RGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
            R  +G+   K+F  ++KS S S+P+S DE SITEVYP
Sbjct: 637 SRTDQGSIPSKEF-FADKSKSNSVPYSGDEGSITEVYP 673

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296087502|emb|CBI34091.3| unnamed protein product [Vitis vinifera]

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 8/100 (8%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP FFI 
Sbjct: 536 MDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPAFFI- 594

Query: 61  ERRGASQQKKFEC----SNKSMSKSMPWSVDETSITEVYP 96
            R G   Q  F      S++S SKS PWS++ETSI+E+YP
Sbjct: 595 -RSGT--QSGFPINALESDQSASKSTPWSLNETSISELYP 631

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359475759|ref|XP_002269246.2| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Vitis vinifera]

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 8/100 (8%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP FFI 
Sbjct: 643 MDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPAFFI- 701

Query: 61  ERRGASQQKKFEC----SNKSMSKSMPWSVDETSITEVYP 96
            R G   Q  F      S++S SKS PWS++ETSI+E+YP
Sbjct: 702 -RSGT--QSGFPINALESDQSASKSTPWSLNETSISELYP 738

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147821544|emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 8/100 (8%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP FFI 
Sbjct: 559 MDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPAFFI- 617

Query: 61  ERRGASQQKKFEC----SNKSMSKSMPWSVDETSITEVYP 96
            R G   Q  F      S++S SKS PWS++ETSI+E+YP
Sbjct: 618 -RSGT--QSGFPINALESDQSASKSTPWSLNETSISELYP 654

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224076439|ref|XP_002304943.1| predicted protein [Populus trichocarpa] gi|222847907|gb|EEE85454.1| predicted protein [Populus trichocarpa]

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 8/96 (8%)

Query: 6   SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV----- 60
           +D++SRNEVIRC+H+ LL V++DPA RP MATIVL L+SYS+ LP PQ+P FFI      
Sbjct: 440 TDTYSRNEVIRCIHIGLLCVQEDPAIRPAMATIVLTLNSYSVTLPSPQEPAFFIHSTITD 499

Query: 61  ERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
           E   +S++  FE    S SKS+ +SVDE SITEVYP
Sbjct: 500 EVNISSKEFLFE---HSKSKSVAYSVDEASITEVYP 532

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359474715|ref|XP_003631522.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 2 [Vitis vinifera]

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/92 (56%), Positives = 67/92 (72%), Gaps = 4/92 (4%)

Query: 7   DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
           +SFS+NEVIRC+HM LL V++DP DRP MA++VL+L SYS+ LP+PQQP  F   R GA 
Sbjct: 594 NSFSKNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYSVTLPLPQQPASF--SRTGAL 651

Query: 67  QQKKFEC--SNKSMSKSMPWSVDETSITEVYP 96
                    S++S SKSM WSV+E SIT++YP
Sbjct: 652 SDFPIMALESDQSASKSMTWSVNEASITDLYP 683

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224076518|ref|XP_002304955.1| predicted protein [Populus trichocarpa] gi|222847919|gb|EEE85466.1| predicted protein [Populus trichocarpa]

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 4/94 (4%)

Query: 6   SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFI---VER 62
           +D++SRNEVIRC+H+ LL V++DPA RP MATI+L L+SYS+ LP PQ+P FF    +  
Sbjct: 550 TDTYSRNEVIRCIHIGLLCVQEDPAIRPAMATIILTLNSYSVTLPSPQEPAFFFHSTITD 609

Query: 63  RGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
              S  K+F   + S SKS+ +SVDE SITEVYP
Sbjct: 610 EVNSSSKEFLLEH-SKSKSVAYSVDEDSITEVYP 642

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359484134|ref|XP_002269330.2| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Vitis vinifera]

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 8/100 (8%)

Query: 1   MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
           M+ +  DS++RNEVIRC+HM LL V++DP DRP MA++VL+L SYS+  P+PQQP F I 
Sbjct: 569 MDPIMGDSYARNEVIRCIHMGLLCVQEDPEDRPSMASVVLMLSSYSVTPPLPQQPAFCI- 627

Query: 61  ERRGASQQKKFEC----SNKSMSKSMPWSVDETSITEVYP 96
              G+  +  F      S++S SKS PWSV+ETSI+E+ P
Sbjct: 628 ---GSGTRSGFPINVLKSDQSASKSTPWSVNETSISELDP 664

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	97
TAIR|locus:2121676	669	CRK10 "cysteine-rich RLK (RECE	0.876	0.127	0.455	1.9e-14
TAIR|locus:2121651	676	CRK8 "cysteine-rich RLK (RECEP	0.958	0.137	0.364	6.3e-13
TAIR|locus:2121706	690	CRK21 "cysteine-rich RLK (RECE	0.927	0.130	0.444	1.1e-12
TAIR|locus:2121636	659	CRK7 "cysteine-rich RLK (RECEP	0.907	0.133	0.384	2.1e-12
TAIR|locus:2123126	666	CRK31 "cysteine-rich RLK (RECE	0.927	0.135	0.422	2.1e-12
TAIR|locus:2115728	675	CRK25 "cysteine-rich RLK (RECE	0.917	0.131	0.395	3.5e-12
TAIR|locus:2123056	656	CRK32 "cysteine-rich RLK (RECE	0.927	0.137	0.422	5.5e-12
TAIR|locus:2123111	669	CRK34 "cysteine-rich RLK (RECE	0.896	0.130	0.411	1.2e-11
TAIR|locus:2077147	676	CRK4 "cysteine-rich RLK (RECEP	0.896	0.128	0.411	5e-10
TAIR|locus:2121626	830	CRK23 "cysteine-rich RLK (RECE	0.876	0.102	0.4	2.3e-09

TAIR|locus:2121676 CRK10 "cysteine-rich RLK (RECEPTOR-like protein kinase) 10" [Arabidopsis thaliana (taxid:3702)]

 Score = 195 (73.7 bits), Expect = 1.9e-14, P = 1.9e-14
 Identities = 41/90 (45%), Positives = 61/90 (67%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             ++  RNEV+RC+H+ LL V++DPA+RP ++TIVL+L S ++ LPVP+QP  F   R G  
Sbjct:   584 ENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIG-- 641

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                K      + SKS+  SVD+ SIT+++P
Sbjct:   642 ---KDPLDTDTTSKSLLGSVDDASITDIHP 668

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0005886 "plasma membrane" evidence=IDA

GO:0006995 "cellular response to nitrogen starvation" evidence=RCA

TAIR|locus:2121651 CRK8 "cysteine-rich RLK (RECEPTOR-like protein kinase) 8" [Arabidopsis thaliana (taxid:3702)]

 Score = 181 (68.8 bits), Expect = 6.3e-13, P = 6.3e-13
 Identities = 35/96 (36%), Positives = 64/96 (66%)

Query:     1 MEHLCSDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIV 60
             ++ L +++   +EV+RC+H+ LL V++DPA RP ++T+ ++L S ++ LPVP+QP FFI 
Sbjct:   583 VDPLIANNCQNSEVVRCIHIGLLCVQEDPAKRPTISTVFMMLTSNTVTLPVPRQPGFFI- 641

Query:    61 ERRGASQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
               + +  +   +    + +KS P S+D+  IT++YP
Sbjct:   642 --QSSPVKDPTDSDQSTTTKSTPASIDDELITDLYP 675

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2121706 CRK21 "cysteine-rich RLK (RECEPTOR-like protein kinase) 21" [Arabidopsis thaliana (taxid:3702)]

 Score = 179 (68.1 bits), Expect = 1.1e-12, P = 1.1e-12
 Identities = 40/90 (44%), Positives = 56/90 (62%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             +++ ++EVIRC+H+ LL V+++P DRP M+TI  +L + SI LPVPQ P FF  ER   +
Sbjct:   600 ENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFRERSEPN 659

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                +      S S S   SVD+ SIT V P
Sbjct:   660 PLAERLLPGPSTSMSFTCSVDDASITSVRP 689

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0005634 "nucleus" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0005739 "mitochondrion" evidence=IDA

TAIR|locus:2121636 CRK7 "cysteine-rich RLK (RECEPTOR-like protein kinase) 7" [Arabidopsis thaliana (taxid:3702)]

 Score = 176 (67.0 bits), Expect = 2.1e-12, P = 2.1e-12
 Identities = 35/91 (38%), Positives = 60/91 (65%)

Query:     6 SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGA 65
             +DS  ++EV+RC H+ LL V++DP  RP M+TI ++L S ++ LP PQQP FF+  R G 
Sbjct:   571 ADSCRKSEVVRCTHIGLLCVQEDPVKRPAMSTISVMLTSNTMALPAPQQPGFFVRSRPGT 630

Query:    66 SQQKKFECSNKSMSKSMPWSVDETSITEVYP 96
             +   + +    + +KS+  S+D+ S++++ P
Sbjct:   631 N---RLDSDQSTTNKSVTVSIDDKSMSDLDP 658

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA

TAIR|locus:2123126 CRK31 "cysteine-rich RLK (RECEPTOR-like protein kinase) 31" [Arabidopsis thaliana (taxid:3702)]

 Score = 176 (67.0 bits), Expect = 2.1e-12, P = 2.1e-12
 Identities = 38/90 (42%), Positives = 54/90 (60%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             +S+  +EVIRC+H+ +L V++ PADRP M+TI  +L + SI LPVP+ P FF   R    
Sbjct:   576 ESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGFFFRNRPNLD 635

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                      +S S S+P+S+D  SIT   P
Sbjct:   636 PLTYGSEQGQSSSMSVPFSIDSASITRATP 665

GO:0004672 "protein kinase activity" evidence=IEA;ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2115728 CRK25 "cysteine-rich RLK (RECEPTOR-like protein kinase) 25" [Arabidopsis thaliana (taxid:3702)]

 Score = 174 (66.3 bits), Expect = 3.5e-12, P = 3.5e-12
 Identities = 36/91 (39%), Positives = 62/91 (68%)

Query:     8 SFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGASQ 67
             +F  NEVIRC+H+ LL V++D ++RP M  I+++++S+++ LP+P++  F +   + +  
Sbjct:   584 NFQTNEVIRCIHIALLCVQEDSSERPSMDDILVMMNSFTVTLPIPKRSGFLLRTMKDSRD 643

Query:    68 QKKF-ECSNKSM-SKSMPWSVDETSITEVYP 96
              +     S+ S  SKS+P SVD++SIT VYP
Sbjct:   644 PRSGGSASDHSATSKSLPLSVDDSSITIVYP 674

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0000041 "transition metal ion transport" evidence=RCA

GO:0006826 "iron ion transport" evidence=RCA

GO:0010106 "cellular response to iron ion starvation" evidence=RCA

GO:0010167 "response to nitrate" evidence=RCA

GO:0010413 "glucuronoxylan metabolic process" evidence=RCA

GO:0015706 "nitrate transport" evidence=RCA

GO:0045492 "xylan biosynthetic process" evidence=RCA

TAIR|locus:2123056 CRK32 "cysteine-rich RLK (RECEPTOR-like protein kinase) 32" [Arabidopsis thaliana (taxid:3702)]

 Score = 172 (65.6 bits), Expect = 5.5e-12, P = 5.5e-12
 Identities = 38/90 (42%), Positives = 54/90 (60%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             +S   ++VIRC+H+ LL V++ P DRP M+TI  +L + SI LPVP+ P FF   R    
Sbjct:   566 ESCDNDKVIRCIHIGLLCVQETPVDRPEMSTIFQMLTNSSITLPVPRPPGFFFRNRSNLD 625

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
                      +S SKS+P+++D  SIT V P
Sbjct:   626 PLTYGSELGQSSSKSIPYTIDSASITRVTP 655

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2123111 CRK34 "cysteine-rich RLK (RECEPTOR-like protein kinase) 34" [Arabidopsis thaliana (taxid:3702)]

 Score = 169 (64.5 bits), Expect = 1.2e-11, P = 1.2e-11
 Identities = 37/90 (41%), Positives = 59/90 (65%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             +S+  +E  RC+H+ LL V++DPADRPL+  I+++L S +  L VP+ P F +  R    
Sbjct:   582 ESYQSSEATRCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHVPRAPGFCLSGRD--L 639

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
             +Q   E + +S S+S+P S+++ SITE YP
Sbjct:   640 EQDGVEYT-ESTSRSIPGSINDASITEFYP 668

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2077147 CRK4 "cysteine-rich RLK (RECEPTOR-like protein kinase) 4" [Arabidopsis thaliana (taxid:3702)]

 Score = 154 (59.3 bits), Expect = 5.0e-10, P = 5.0e-10
 Identities = 37/90 (41%), Positives = 54/90 (60%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             D++  NEV RC+H+ LL V+++  DRP M+ IV +L + SI L VPQ+P FF    R + 
Sbjct:   589 DNYRINEVSRCIHIALLCVQEEAEDRPTMSAIVQMLTTSSIALAVPQRPGFFF---RSSK 645

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
              ++       S++ S   SVD+ SIT V P
Sbjct:   646 HEQVGLVDRLSINTSALCSVDDASITNVTP 675

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0006952 "defense response" evidence=TAS

GO:0009751 "response to salicylic acid stimulus" evidence=IEP

GO:0012501 "programmed cell death" evidence=IMP

GO:0042742 "defense response to bacterium" evidence=IEP

TAIR|locus:2121626 CRK23 "cysteine-rich RLK (RECEPTOR-like protein kinase) 23" [Arabidopsis thaliana (taxid:3702)]

 Score = 149 (57.5 bits), Expect = 2.3e-09, P = 2.3e-09
 Identities = 36/90 (40%), Positives = 56/90 (62%)

Query:     7 DSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPVPQQPVFFIVERRGAS 66
             D++  +++ RC+H+ LL V++D  DRP M+ IV +L + SI+L VP+QP FF    RG  
Sbjct:   745 DNYQTHDITRCIHIALLCVQEDVDDRPNMSAIVQMLTTSSIVLAVPKQPGFFF---RGRH 801

Query:    67 QQKKFECSNKSMSKSMPWSVDETSITEVYP 96
             +Q   E  + S+ +    S+D+ SIT V P
Sbjct:   802 EQVG-EVGS-SVDRLALCSIDDASITSVAP 829

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0006952 "defense response" evidence=TAS

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	97
KOG1187	361	consensus Serine/threonine protein kinase [Signal	98.27
PF11883	48	DUF3403: Domain of unknown function (DUF3403); Int	97.45
PLN00113	968	leucine-rich repeat receptor-like protein kinase;	96.6
cd05038	284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	95.19
cd05097	295	PTKc_DDR_like Catalytic domain of Discoidin Domain	94.7
cd05051	296	PTKc_DDR Catalytic domain of the Protein Tyrosine	94.61
cd05045	290	PTKc_RET Catalytic domain of the Protein Tyrosine	94.47
cd05112	256	PTKc_Itk Catalytic domain of the Protein Tyrosine	94.44
cd05063	268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	94.38
cd05068	261	PTKc_Frk_like Catalytic domain of Fyn-related kina	94.36
cd05148	261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	94.26
cd05048	283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	94.18
cd05053	293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	94.16
cd05050	288	PTKc_Musk Catalytic domain of the Protein Tyrosine	94.14
cd05095	296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	94.08
cd05033	266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	94.05
cd08528	269	STKc_Nek10 Catalytic domain of the Protein Serine/	94.04
cd05081	284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	93.98
cd05114	256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	93.84
cd05094	291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	93.82
cd05102	338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	93.78
cd05072	261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	93.75
cd05052	263	PTKc_Abl Catalytic domain of the Protein Tyrosine	93.74
cd05080	283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	93.71
cd05096	304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	93.57
cd05091	283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	93.41
cd05104	375	PTKc_Kit Catalytic domain of the Protein Tyrosine	93.37
cd05084	252	PTKc_Fes Catalytic domain of the Protein Tyrosine	93.31
cd05062	277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	93.29
cd05054	337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	93.25
cd05059	256	PTKc_Tec_like Catalytic domain of Tec-like Protein	93.21
cd05085	250	PTKc_Fer Catalytic domain of the Protein Tyrosine	93.19
cd05058	262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	93.09
cd05035	273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	93.08
cd05060	257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	93.01
PF07714	259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	92.96
cd05116	257	PTKc_Syk Catalytic domain of the Protein Tyrosine	92.73
cd05074	273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	92.71
cd05093	288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	92.59
cd05075	272	PTKc_Axl Catalytic domain of the Protein Tyrosine	92.58
cd08229	267	STKc_Nek7 Catalytic domain of the Protein Serine/T	92.58
cd05066	267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	92.5
cd05078	258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	92.49
cd05079	284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	92.44
cd05036	277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	92.44
cd05113	256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	92.42
cd05065	269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	92.3
cd05043	280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	92.29
cd05039	256	PTKc_Csk_like Catalytic domain of C-terminal Src k	92.26
cd05047	270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	92.11
cd05103	343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	91.91
cd05070	260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	91.91
cd05083	254	PTKc_Chk Catalytic domain of the Protein Tyrosine	91.88
PHA02988	283	hypothetical protein; Provisional	91.86
cd08224	267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	91.79
cd05101	304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	91.74
cd05044	269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	91.7
cd05032	277	PTKc_InsR_like Catalytic domain of Insulin Recepto	91.68
cd05049	280	PTKc_Trk Catalytic domain of the Protein Tyrosine	91.66
cd08228	267	STKc_Nek6 Catalytic domain of the Protein Serine/T	91.65
cd05098	307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	91.58
cd05071	262	PTKc_Src Catalytic domain of the Protein Tyrosine	91.57
cd05061	288	PTKc_InsR Catalytic domain of the Protein Tyrosine	91.51
cd05069	260	PTKc_Yes Catalytic domain of the Protein Tyrosine	91.49
cd00192	262	PTKc Catalytic domain of Protein Tyrosine Kinases.	91.49
cd05055	302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	91.42
cd05041	251	PTKc_Fes_like Catalytic domain of Fes-like Protein	91.34
cd05089	297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	91.34
cd05082	256	PTKc_Csk Catalytic domain of the Protein Tyrosine	91.33
cd05090	283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	91.28
cd05040	257	PTKc_Ack_like Catalytic domain of the Protein Tyro	91.27
cd05073	260	PTKc_Hck Catalytic domain of the Protein Tyrosine	91.16
cd05111	279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	91.14
cd05076	274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	91.0
cd05064	266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	90.98
cd05106	374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	90.82
cd05067	260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	90.79
cd05099	314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	90.65
cd05034	261	PTKc_Src_like Catalytic domain of Src kinase-like	90.0
cd05092	280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	89.89
cd05088	303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	89.87
cd05037	259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	89.79
cd05100	334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	89.49
smart00219	258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	89.27
cd05108	316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	89.21
cd05105	400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	89.19
cd08217	265	STKc_Nek2 Catalytic domain of the Protein Serine/T	89.16
cd05077	262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	88.84
smart00220	244	S_TKc Serine/Threonine protein kinases, catalytic	88.48
cd05046	275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	88.37
cd05110	303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	88.35
cd07835	283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	87.72
cd06642	277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	87.25
cd05107	401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	87.23
smart00750	176	KIND kinase non-catalytic C-lobe domain. It is an	87.19
cd08529	256	STKc_FA2-like Catalytic domain of the Protein Seri	87.09
cd07846	286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	87.08
cd05115	257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	86.89
cd05056	270	PTKc_FAK Catalytic domain of the Protein Tyrosine	86.77
cd05109	279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	86.71
cd08218	256	STKc_Nek1 Catalytic domain of the Protein Serine/T	86.7
cd07830	283	STKc_MAK_like Catalytic domain of Male germ cell-A	86.4
cd06621	287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	86.13
cd07840	287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	85.51
cd06620	284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	85.29
cd08223	257	STKc_Nek4 Catalytic domain of the Protein Serine/T	85.18
cd06624	268	STKc_ASK Catalytic domain of the Protein Serine/Th	84.99
cd08220	256	STKc_Nek8 Catalytic domain of the Protein Serine/T	84.69
cd06612	256	STKc_MST1_2 Catalytic domain of the Protein Serine	84.18
cd06606	260	STKc_MAPKKK Catalytic domain of the Protein Serine	84.14
cd05118	283	STKc_CMGC Catalytic domain of CMGC family Serine/T	84.0
cd07833	288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	83.86
cd06638	286	STKc_myosinIIIA Catalytic domain of the Protein Se	83.67
cd07842	316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	83.17
cd05086	268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	82.91
cd00180	215	PKc Catalytic domain of Protein Kinases. Protein K	82.82
cd05122	253	PKc_STE Catalytic domain of STE family Protein Kin	82.56
cd07841	298	STKc_CDK7 Catalytic domain of the Serine/Threonine	82.48
cd06640	277	STKc_MST4 Catalytic domain of the Protein Serine/T	82.44
cd06608	275	STKc_myosinIII_like Catalytic domain of Class III	82.4
cd08225	257	STKc_Nek5 Catalytic domain of the Protein Serine/T	82.34
cd07831	282	STKc_MOK Catalytic domain of the Serine/Threonine	82.31
cd07847	286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	82.27
cd06615	308	PKc_MEK Catalytic domain of the dual-specificity P	81.76
cd06637	272	STKc_TNIK Catalytic domain of the Protein Serine/T	81.49
cd06641	277	STKc_MST3 Catalytic domain of the Protein Serine/T	81.39
cd08216	314	PK_STRAD Pseudokinase domain of STE20-related kina	81.22
cd07860	284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	80.65
cd06639	291	STKc_myosinIIIB Catalytic domain of the Protein Se	80.52
cd06609	274	STKc_MST3_like Catalytic domain of Mammalian Ste20	80.51
cd06619	279	PKc_MKK5 Catalytic domain of the dual-specificity	80.31
cd07838	287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	80.21
PF00069	260	Pkinase: Protein kinase domain Protein kinase; unc	80.16
cd08226	328	PK_STRAD_beta Pseudokinase domain of STE20-related	80.01

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=98.27  E-value=1.5e-06  Score=64.12  Aligned_cols=45  Identities=24%  Similarity=0.440  Sum_probs=39.8

Q ss_pred             CCCCCC-CcCCH-HHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066            1 MEHLCS-DSFSR-NEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus         1 ~D~~L~-~~~~~-~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +||+|. +.+.. +++.+++.+|++|++.+|..||+|.+|+.+|+..
T Consensus       306 iD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~  352 (361)
T KOG1187|consen  306 VDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGI  352 (361)
T ss_pred             eCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhh
Confidence            689987 66664 7899999999999999999999999999999643

>PF11883 DUF3403: Domain of unknown function (DUF3403); InterPro: IPR021820 This functionally uncharacterised domain of around 50 amino acids is found in the C terminus of eukaryotic S-locus receptor kinase proteins

Probab=97.45  E-value=0.0003  Score=37.90  Aligned_cols=43  Identities=35%  Similarity=0.470  Sum_probs=31.3

Q ss_pred             CCCCCCCCCCceeeeecccccccchhhccCCCCCCC--CCcccCceeeeeecC
Q 038066           46 SIILPVPQQPVFFIVERRGASQQKKFECSNKSMSKS--MPWSVDETSITEVYP   96 (97)
Q Consensus        46 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~s~~~~s~s~~~~   96 (97)
                      ...+|.|++|+|+..+.....        ..++...  ..+++|++++|.+++
T Consensus         3 ~~~LP~PKqPgF~~~r~~~e~--------~sSss~~~~~~~SvNevTiT~l~~   47 (48)
T PF11883_consen    3 TATLPQPKQPGFFTGRSPSET--------DSSSSKQRDESCSVNEVTITMLEA   47 (48)
T ss_pred             cccCCCCCCCCEEeEcCCCCc--------CCCcccccCCCCCeeeEEEEeEec
Confidence            356899999999999885542        2222222  578999999999875

; GO: 0004674 protein serine/threonine kinase activity

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional

Probab=96.60  E-value=0.0035  Score=50.87  Aligned_cols=36  Identities=28%  Similarity=0.514  Sum_probs=32.3

Q ss_pred             CHHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           10 SRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        10 ~~~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      ..+++..+++++.+|.+.+|.+||+|.+|++.|+..
T Consensus       916 ~~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~  951 (968)
T PLN00113        916 NQNEIVEVMNLALHCTATDPTARPCANDVLKTLESA  951 (968)
T ss_pred             cHHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHh
Confidence            456788899999999999999999999999999864

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=95.19  E-value=0.023  Score=38.95  Aligned_cols=30  Identities=27%  Similarity=0.482  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+..+..+|.+.+|.+||++.+++.+|+.
T Consensus       253 ~~~~~li~~cl~~~p~~Rpt~~ei~~~l~~  282 (284)
T cd05038         253 DEVYDLMKLCWEAEPQDRPSFADLILIVDR  282 (284)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHhh
Confidence            357778889999999999999999999975

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases

Probab=94.70  E-value=0.037  Score=38.59  Aligned_cols=28  Identities=21%  Similarity=0.280  Sum_probs=25.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|.+.+|.+||+|.+|++.|+
T Consensus       267 ~l~~li~~~l~~~p~~RPs~~~i~~~l~  294 (295)
T cd05097         267 PVFKLMMRCWSRDIKDRPTFNKIHHFLR  294 (295)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHh
Confidence            4678889999999999999999999885

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors

Probab=94.61  E-value=0.04  Score=38.20  Aligned_cols=29  Identities=31%  Similarity=0.385  Sum_probs=25.9

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..+.++...|++.+|.+||++.+++..|+
T Consensus       267 ~~l~~li~~cl~~~p~~Rpt~~el~~~L~  295 (296)
T cd05051         267 KDIYELMLECWRRDEEDRPTFREIHLFLQ  295 (296)
T ss_pred             HHHHHHHHHHhccChhcCCCHHHHHHHhc
Confidence            35778889999999999999999998885

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein

Probab=94.47  E-value=0.054  Score=37.65  Aligned_cols=30  Identities=23%  Similarity=0.388  Sum_probs=26.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       257 ~~~~~i~~cl~~~P~~Rp~~~~i~~~l~~~  286 (290)
T cd05045         257 EMYNLMLTCWKQEPDKRPTFADISKELEKM  286 (290)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHHHHHHHH
Confidence            566788899999999999999999999763

Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase

Probab=94.44  E-value=0.046  Score=37.01  Aligned_cols=28  Identities=18%  Similarity=0.283  Sum_probs=24.7

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      ..+..+..+|++.+|.+||++.+|++.|
T Consensus       228 ~~~~~l~~~~l~~~p~~Rp~~~~~l~~l  255 (256)
T cd05112         228 QSVYELMQHCWKERPEDRPSFSLLLHQL  255 (256)
T ss_pred             HHHHHHHHHHcccChhhCCCHHHHHHhh
Confidence            3467788999999999999999999887

Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2

Probab=94.38  E-value=0.061  Score=36.75  Aligned_cols=29  Identities=31%  Similarity=0.401  Sum_probs=26.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||+|.+|+..|+.
T Consensus       238 ~~~~li~~c~~~~p~~Rp~~~~i~~~l~~  266 (268)
T cd05063         238 AVYQLMLQCWQQDRARRPRFVDIVNLLDK  266 (268)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            46788899999999999999999999864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases

Probab=94.36  E-value=0.051  Score=37.06  Aligned_cols=29  Identities=28%  Similarity=0.395  Sum_probs=25.7

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..+..+..+|++.+|.+||++.+++..|+
T Consensus       231 ~~~~~li~~~l~~~P~~Rp~~~~l~~~l~  259 (261)
T cd05068         231 KELYDIMLDCWKEDPDDRPTFETLQWKLE  259 (261)
T ss_pred             HHHHHHHHHHhhcCcccCCCHHHHHHHHh
Confidence            45677888999999999999999999886

Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk

Probab=94.26  E-value=0.062  Score=36.50  Aligned_cols=29  Identities=24%  Similarity=0.330  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+..+|.+.+|.+||++.++.+.|+.
T Consensus       232 ~~~~~i~~~l~~~p~~Rpt~~~l~~~L~~  260 (261)
T cd05148         232 EIYKIMLECWAAEPEDRPSFKALREELDN  260 (261)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHhc
Confidence            45677789999999999999999999864

Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors

Probab=94.18  E-value=0.056  Score=37.22  Aligned_cols=29  Identities=28%  Similarity=0.269  Sum_probs=25.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++...|++
T Consensus       254 ~~~~l~~~c~~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05048         254 RVYALMIECWNEIPARRPRFKDIHTRLRS  282 (283)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHhc
Confidence            46677789999999999999999999864

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors

Probab=94.16  E-value=0.063  Score=37.23  Aligned_cols=30  Identities=23%  Similarity=0.253  Sum_probs=26.5

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+..+...|++.+|.+||++.+++..|+.
T Consensus       261 ~~~~~li~~~l~~~p~~Rps~~eil~~l~~  290 (293)
T cd05053         261 QELYHLMRDCWHEVPSQRPTFKQLVEDLDR  290 (293)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHHHHHH
Confidence            356778899999999999999999999875

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase

Probab=94.14  E-value=0.068  Score=37.02  Aligned_cols=29  Identities=31%  Similarity=0.421  Sum_probs=25.6

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..+..+..+|++.+|.+||++.++++.|+
T Consensus       259 ~~l~~li~~~l~~~p~~Rpt~~el~~~l~  287 (288)
T cd05050         259 LELYNLMRLCWSKLPSDRPSFASINRILQ  287 (288)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhh
Confidence            35677889999999999999999999886

Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2

Probab=94.08  E-value=0.069  Score=37.27  Aligned_cols=29  Identities=21%  Similarity=0.204  Sum_probs=25.3

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..+.++..+|.+.+|..||+|.++++.|+
T Consensus       267 ~~~~~li~~cl~~~p~~Rp~~~~i~~~l~  295 (296)
T cd05095         267 DSLYKLMLSCWRRNAKERPSFQEIHATLL  295 (296)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            35667888999999999999999998875

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases

Probab=94.05  E-value=0.073  Score=36.37  Aligned_cols=29  Identities=31%  Similarity=0.391  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       236 ~l~~li~~cl~~~p~~Rp~~~ei~~~l~~  264 (266)
T cd05033         236 ALYQLMLDCWQKDRNERPTFSQIVSTLDK  264 (266)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            46678889999999999999999999864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10

Probab=94.04  E-value=0.071  Score=36.43  Aligned_cols=28  Identities=11%  Similarity=0.176  Sum_probs=23.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+..+|.+.+|..||++.+|+.++.
T Consensus       241 ~l~~li~~cl~~~p~~Rp~~~e~~~~~~  268 (269)
T cd08528         241 DVTDVITSCLTPDAEARPDIIQVSAMIS  268 (269)
T ss_pred             HHHHHHHHHCCCCCccCCCHHHHHHHhc
Confidence            3455666899999999999999998874

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=93.98  E-value=0.073  Score=36.73  Aligned_cols=29  Identities=17%  Similarity=0.330  Sum_probs=25.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|+..+|..||++.+++..|+.
T Consensus       254 ~~~~li~~cl~~~p~~Rpt~~ei~~~l~~  282 (284)
T cd05081         254 EIYAIMKECWNNDPSQRPSFSELALQVEA  282 (284)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHh
Confidence            46778889999999999999999999874

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase

Probab=93.84  E-value=0.077  Score=36.05  Aligned_cols=27  Identities=15%  Similarity=0.288  Sum_probs=24.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|.+.+|..||++.+++..|
T Consensus       229 ~~~~li~~c~~~~p~~Rps~~~l~~~l  255 (256)
T cd05114         229 TVYEVMYSCWHEKPEGRPTFAELLRAI  255 (256)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHhh
Confidence            467788899999999999999999876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C

Probab=93.82  E-value=0.073  Score=37.07  Aligned_cols=30  Identities=17%  Similarity=0.248  Sum_probs=26.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|++.+|.+||++.+|+++|+..
T Consensus       253 ~~~~li~~~l~~~P~~Rpt~~~v~~~l~~~  282 (291)
T cd05094         253 EVYDIMLGCWQREPQQRLNIKEIYKILHAL  282 (291)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHHH
Confidence            466788899999999999999999999764

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3

Probab=93.78  E-value=0.07  Score=38.00  Aligned_cols=29  Identities=24%  Similarity=0.448  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       305 ~l~~li~~cl~~dp~~RPs~~el~~~l~~  333 (338)
T cd05102         305 EIYRIMLACWQGDPKERPTFSALVEILGD  333 (338)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            46678889999999999999999999975

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn

Probab=93.75  E-value=0.088  Score=35.80  Aligned_cols=29  Identities=17%  Similarity=0.247  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|+..+|.+||++.++...|+.
T Consensus       232 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  260 (261)
T cd05072         232 ELYDIMKTCWKEKAEERPTFDYLQSVLDD  260 (261)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            46677889999999999999999999863

Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase

Probab=93.74  E-value=0.098  Score=35.75  Aligned_cols=29  Identities=21%  Similarity=0.349  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||++.+++++|+.
T Consensus       233 ~~~~li~~cl~~~p~~Rp~~~~l~~~l~~  261 (263)
T cd05052         233 KVYELMRACWQWNPSDRPSFAEIHQAFET  261 (263)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHHHHHHh
Confidence            35557789999999999999999999864

Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=93.71  E-value=0.074  Score=36.74  Aligned_cols=30  Identities=10%  Similarity=0.122  Sum_probs=26.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+..+...|.+.+|.+||++.+++..|+.
T Consensus       251 ~~~~~li~~cl~~~p~~Rps~~~i~~~l~~  280 (283)
T cd05080         251 QEVYILMKNCWETEAKFRPTFRSLIPILKE  280 (283)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHHH
Confidence            356778889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1

Probab=93.57  E-value=0.09  Score=36.81  Aligned_cols=28  Identities=21%  Similarity=0.245  Sum_probs=24.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|.+.+|.+||++.+++..|+
T Consensus       276 ~~~~li~~cl~~~p~~RPs~~~i~~~l~  303 (304)
T cd05096         276 GLYELMLQCWSRDCRERPSFSDIHAFLT  303 (304)
T ss_pred             HHHHHHHHHccCCchhCcCHHHHHHHHh
Confidence            4667888999999999999999998875

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2

Probab=93.41  E-value=0.089  Score=36.29  Aligned_cols=28  Identities=21%  Similarity=0.202  Sum_probs=24.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|+.
T Consensus       255 ~~~li~~cl~~~p~~RP~~~~i~~~l~~  282 (283)
T cd05091         255 VYTLMLECWNEFPSRRPRFKDIHSRLRT  282 (283)
T ss_pred             HHHHHHHHhCCCcccCCCHHHHHHHhhC
Confidence            5567789999999999999999998863

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit

Probab=93.37  E-value=0.082  Score=38.68  Aligned_cols=29  Identities=21%  Similarity=0.322  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       345 ~l~~li~~cl~~dP~~RPs~~eil~~l~~  373 (375)
T cd05104         345 EMYDIMKSCWDADPLKRPTFKQIVQLIEQ  373 (375)
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHh
Confidence            35567788999999999999999999974

Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes

Probab=93.31  E-value=0.1  Score=35.31  Aligned_cols=28  Identities=21%  Similarity=0.252  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.++.++|+
T Consensus       224 ~~~~li~~~l~~~p~~Rps~~~~~~~l~  251 (252)
T cd05084         224 AVYRLMERCWEYDPGQRPSFSTVHQELQ  251 (252)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHh
Confidence            4566778999999999999999999885

Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor

Probab=93.29  E-value=0.093  Score=36.13  Aligned_cols=28  Identities=14%  Similarity=0.232  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.+++..|+
T Consensus       249 ~~~~li~~~l~~~p~~Rps~~e~l~~l~  276 (277)
T cd05062         249 MLFELMRMCWQYNPKMRPSFLEIISSIK  276 (277)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHhh
Confidence            4566888999999999999999998875

Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors

Probab=93.25  E-value=0.094  Score=37.76  Aligned_cols=30  Identities=23%  Similarity=0.367  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+.++...|.+.+|.+||++.++++.|+.
T Consensus       303 ~~~~~l~~~cl~~~p~~RPs~~ell~~l~~  332 (337)
T cd05054         303 PEIYSIMLDCWHNNPEDRPTFSELVEILGD  332 (337)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            356788899999999999999999999975

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases

Probab=93.21  E-value=0.088  Score=35.83  Aligned_cols=27  Identities=19%  Similarity=0.320  Sum_probs=24.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|++.+|.+||++.+++..|
T Consensus       229 ~~~~li~~cl~~~p~~Rpt~~~~l~~l  255 (256)
T cd05059         229 EVYTIMYSCWHEKPEDRPAFKKLLSQL  255 (256)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHh
Confidence            477788899999999999999999876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer

Probab=93.19  E-value=0.12  Score=34.79  Aligned_cols=29  Identities=14%  Similarity=0.109  Sum_probs=25.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..+..+...|++.+|.+||++.++++.|.
T Consensus       221 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~  249 (250)
T cd05085         221 DDVYKVMQRCWDYKPENRPKFSELQKELA  249 (250)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhc
Confidence            45677888999999999999999998874

Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron

Probab=93.09  E-value=0.12  Score=35.04  Aligned_cols=29  Identities=17%  Similarity=0.247  Sum_probs=25.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       230 ~~~~li~~cl~~~p~~Rp~~~~il~~l~~  258 (262)
T cd05058         230 PLYEVMLSCWHPKPEMRPTFSELVSRIEQ  258 (262)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            46678889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases

Probab=93.08  E-value=0.13  Score=35.04  Aligned_cols=30  Identities=27%  Similarity=0.365  Sum_probs=25.6

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+.++...|.+.+|.+||++.+++..|+.
T Consensus       242 ~~~~~li~~~l~~~p~~Rp~~~e~~~~l~~  271 (273)
T cd05035         242 DELYDLMYSCWRADPKDRPTFTKLREVLEN  271 (273)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            356677778999999999999999998864

Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases

Probab=93.01  E-value=0.11  Score=35.24  Aligned_cols=30  Identities=17%  Similarity=0.230  Sum_probs=26.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|...+|.+||++.+++..|+..
T Consensus       226 ~l~~li~~cl~~~p~~Rp~~~~l~~~l~~~  255 (257)
T cd05060         226 EIYSIMLSCWKYRPEDRPTFSELESTFRRD  255 (257)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHhc
Confidence            456788899999999999999999999753

Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity

Probab=92.96  E-value=0.093  Score=36.07  Aligned_cols=27  Identities=22%  Similarity=0.268  Sum_probs=20.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|...+|.+||++.++++.|
T Consensus       233 ~~~~li~~C~~~~p~~RPs~~~i~~~L  259 (259)
T PF07714_consen  233 DIYSLIQQCWSHDPEKRPSFQEILQEL  259 (259)
T ss_dssp             HHHHHHHHHT-SSGGGS--HHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHhcC
Confidence            355677889999999999999999875

Tyrosine kinase, catalytic domain; InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []: Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction []. Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases []. ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase

Probab=92.73  E-value=0.13  Score=35.04  Aligned_cols=28  Identities=21%  Similarity=0.188  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++-..|.+.+|.+||++.+|+..|+.
T Consensus       227 l~~li~~~~~~~p~~Rp~~~~i~~~l~~  254 (257)
T cd05116         227 MYDLMKLCWTYGVDERPGFAVVELRLRN  254 (257)
T ss_pred             HHHHHHHHhccCchhCcCHHHHHHHHhc
Confidence            4456678999999999999999999974

Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3

Probab=92.71  E-value=0.15  Score=34.81  Aligned_cols=30  Identities=13%  Similarity=0.086  Sum_probs=26.8

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+.++...|.+.+|.+||++.++...|+.
T Consensus       242 ~~~~~l~~~~l~~~p~~Rps~~~~~~~l~~  271 (273)
T cd05074         242 EDVYELMCQCWSPEPKCRPSFQHLRDQLEL  271 (273)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            467788899999999999999999999874

Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B

Probab=92.59  E-value=0.14  Score=35.56  Aligned_cols=30  Identities=17%  Similarity=0.181  Sum_probs=26.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.+|...|+..
T Consensus       250 ~l~~li~~~l~~~p~~Rpt~~~v~~~l~~~  279 (288)
T cd05093         250 EVYDLMLGCWQREPHMRLNIKEIHSLLQNL  279 (288)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHHH
Confidence            467788899999999999999999888753

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl

Probab=92.58  E-value=0.18  Score=34.43  Aligned_cols=29  Identities=21%  Similarity=0.203  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       242 ~~~~li~~~l~~~p~~Rps~~~l~~~l~~  270 (272)
T cd05075         242 GLYSLMSSCWLLNPKDRPSFETLRCELEK  270 (272)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            35667789999999999999999998864

Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7

Probab=92.58  E-value=0.2  Score=34.11  Aligned_cols=29  Identities=17%  Similarity=0.259  Sum_probs=24.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||+|.+|.+.+..
T Consensus       236 ~~~~li~~~l~~~p~~Rpt~~~i~~~~~~  264 (267)
T cd08229         236 ELRQLVNMCINPDPEKRPDITYVYDVAKR  264 (267)
T ss_pred             HHHHHHHHhcCCCcccCCCHHHHHHHHhh
Confidence            34456678999999999999999988864

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors

Probab=92.50  E-value=0.17  Score=34.57  Aligned_cols=29  Identities=31%  Similarity=0.392  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||+|.+++..|+.
T Consensus       237 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  265 (267)
T cd05066         237 ALHQLMLDCWQKDRNERPKFEQIVSILDK  265 (267)
T ss_pred             HHHHHHHHHcccCchhCCCHHHHHHHHHh
Confidence            45677789999999999999999999864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=92.49  E-value=0.13  Score=35.16  Aligned_cols=28  Identities=18%  Similarity=0.212  Sum_probs=23.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|..||++.++++.|+
T Consensus       231 ~~~~li~~~l~~~p~~Rps~~~il~~l~  258 (258)
T cd05078         231 ELANLINQCMDYEPDFRPSFRAIIRDLN  258 (258)
T ss_pred             HHHHHHHHHhccChhhCCCHHHHHHhcC
Confidence            3556777899999999999999998763

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=92.44  E-value=0.18  Score=34.82  Aligned_cols=30  Identities=7%  Similarity=0.101  Sum_probs=26.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+..+...|.+.+|.+||++.+++..|+.
T Consensus       253 ~~~~~li~~~l~~~p~~Rpt~~~il~~l~~  282 (284)
T cd05079         253 EEVYQLMRKCWEFQPSKRTTFQNLIEGFEA  282 (284)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHHHHh
Confidence            357778889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase

Probab=92.44  E-value=0.18  Score=34.73  Aligned_cols=28  Identities=25%  Similarity=0.300  Sum_probs=24.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|++.+|.+||++.+|++.|+
T Consensus       249 ~~~~~i~~cl~~~p~~Rps~~~vl~~l~  276 (277)
T cd05036         249 PVYRIMTDCWQHTPEDRPNFATILERIQ  276 (277)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHhh
Confidence            4567778999999999999999998874

Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome

Probab=92.42  E-value=0.17  Score=34.53  Aligned_cols=28  Identities=7%  Similarity=0.243  Sum_probs=24.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|.+.+|.+||++.+++..|+
T Consensus       229 ~~~~li~~cl~~~p~~Rp~~~~ll~~~~  256 (256)
T cd05113         229 KVYAIMYSCWHEKAEERPTFQQLLSSIE  256 (256)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHhhC
Confidence            4667778999999999999999988763

Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors

Probab=92.30  E-value=0.18  Score=34.51  Aligned_cols=29  Identities=31%  Similarity=0.328  Sum_probs=25.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||+|.+++..|+.
T Consensus       239 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  267 (269)
T cd05065         239 ALHQLMLDCWQKDRNARPKFGQIVSTLDK  267 (269)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            35567788999999999999999998864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)

Probab=92.29  E-value=0.17  Score=34.81  Aligned_cols=29  Identities=21%  Similarity=0.305  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|..||++.+++..|+.
T Consensus       247 ~~~~li~~~l~~~p~~Rps~~~~~~~l~~  275 (280)
T cd05043         247 ELFAVMACCWALDPEERPSFSQLVQCLTD  275 (280)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            46678889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases

Probab=92.26  E-value=0.17  Score=34.32  Aligned_cols=29  Identities=21%  Similarity=0.158  Sum_probs=25.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||++.+++.+|+.
T Consensus       227 ~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  255 (256)
T cd05039         227 EVYKVMKDCWELDPAKRPTFKQLREQLAL  255 (256)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHHHHHhc
Confidence            45667778999999999999999999864

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases

Probab=92.11  E-value=0.19  Score=34.51  Aligned_cols=29  Identities=24%  Similarity=0.397  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|..
T Consensus       239 ~~~~li~~~l~~~p~~Rps~~~il~~l~~  267 (270)
T cd05047         239 EVYDLMRQCWREKPYERPSFAQILVSLNR  267 (270)
T ss_pred             HHHHHHHHHcccChhhCCCHHHHHHHHHH
Confidence            46678889999999999999999999865

Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2

Probab=91.91  E-value=0.18  Score=36.29  Aligned_cols=29  Identities=21%  Similarity=0.291  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++.+.|.+.+|.+||++.+++..|+.
T Consensus       310 ~~~~~~~~cl~~~p~~Rps~~eil~~l~~  338 (343)
T cd05103         310 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  338 (343)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            46677789999999999999999998875

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk

Probab=91.91  E-value=0.23  Score=33.80  Aligned_cols=28  Identities=25%  Similarity=0.402  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.++...|+
T Consensus       231 ~~~~li~~~l~~~p~~Rpt~~~l~~~l~  258 (260)
T cd05070         231 SLHELMLQCWKKDPEERPTFEYLQSFLE  258 (260)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHHh
Confidence            4667788999999999999999998885

Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase

Probab=91.88  E-value=0.21  Score=33.86  Aligned_cols=29  Identities=14%  Similarity=0.180  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|..||++.+++..|+.
T Consensus       225 ~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  253 (254)
T cd05083         225 DVYVLMTSCWETEPKKRPSFHKLREKLEK  253 (254)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHcc
Confidence            45567789999999999999999998864

Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki

>PHA02988 hypothetical protein; Provisional

Probab=91.86  E-value=0.22  Score=34.81  Aligned_cols=28  Identities=18%  Similarity=0.157  Sum_probs=23.7

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +-.+...|.+.+|.+||++.+++..|+.
T Consensus       251 l~~li~~cl~~dp~~Rps~~ell~~l~~  278 (283)
T PHA02988        251 IKCIVEACTSHDSIKRPNIKEILYNLSL  278 (283)
T ss_pred             HHHHHHHHhcCCcccCcCHHHHHHHHHH
Confidence            4455568999999999999999998864

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7

Probab=91.79  E-value=0.28  Score=33.22  Aligned_cols=29  Identities=17%  Similarity=0.274  Sum_probs=25.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|+..+|..||++.+++.+|+.
T Consensus       236 ~~~~~i~~cl~~~p~~Rp~~~~il~~~~~  264 (267)
T cd08224         236 ELRDLVSRCINPDPEKRPDISYVLQVAKE  264 (267)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHHHH
Confidence            45567788999999999999999999875

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2

Probab=91.74  E-value=0.24  Score=34.69  Aligned_cols=30  Identities=23%  Similarity=0.169  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|..||++.+++..|...
T Consensus       267 ~~~~li~~cl~~~p~~Rps~~e~l~~l~~~  296 (304)
T cd05101         267 ELYMMMRDCWHAIPSHRPTFKQLVEDLDRI  296 (304)
T ss_pred             HHHHHHHHHcccChhhCCCHHHHHHHHHHH
Confidence            455677789999999999999999998753

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros

Probab=91.70  E-value=0.28  Score=33.39  Aligned_cols=28  Identities=21%  Similarity=0.375  Sum_probs=24.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|.+.+|.+||++.++...|+
T Consensus       241 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~  268 (269)
T cd05044         241 KIYQLMTNCWAQDPSERPTFDRIQEILQ  268 (269)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            3556777999999999999999998885

Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases

Probab=91.68  E-value=0.21  Score=34.12  Aligned_cols=28  Identities=21%  Similarity=0.325  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.+++..|+
T Consensus       249 ~~~~li~~~l~~~p~~Rpt~~~l~~~l~  276 (277)
T cd05032         249 KLLELMRMCWQYNPKMRPTFLEIVSSLK  276 (277)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHhc
Confidence            4567788999999999999999998875

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases

Probab=91.66  E-value=0.24  Score=33.93  Aligned_cols=28  Identities=21%  Similarity=0.215  Sum_probs=24.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|++.+|..||++.+|+..|+
T Consensus       252 ~~~~li~~~l~~~p~~Rp~~~eil~~l~  279 (280)
T cd05049         252 EVYDIMLGCWKRDPQQRINIKDIHERLQ  279 (280)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHhh
Confidence            4566778899999999999999999885

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6

Probab=91.65  E-value=0.27  Score=33.39  Aligned_cols=30  Identities=13%  Similarity=0.269  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||++.+|++.|+..
T Consensus       236 ~~~~li~~cl~~~p~~Rp~~~~vl~~~~~~  265 (267)
T cd08228         236 KLRELVSMCIYPDPDQRPDIGYVHQIAKQM  265 (267)
T ss_pred             HHHHHHHHHCCCCcccCcCHHHHHHHHHHh
Confidence            355666789999999999999999998753

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1

Probab=91.58  E-value=0.25  Score=34.68  Aligned_cols=29  Identities=24%  Similarity=0.198  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||+|.+|+..|+.
T Consensus       270 ~~~~li~~~l~~~p~~Rps~~evl~~l~~  298 (307)
T cd05098         270 ELYMMMRDCWHAVPSQRPTFKQLVEDLDR  298 (307)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHH
Confidence            45567788999999999999999999875

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src

Probab=91.57  E-value=0.3  Score=33.44  Aligned_cols=30  Identities=20%  Similarity=0.300  Sum_probs=26.3

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+.++...|.+.+|.+||++.++...|+.
T Consensus       230 ~~l~~li~~~l~~~p~~Rp~~~~~~~~l~~  259 (262)
T cd05071         230 ESLHDLMCQCWRKEPEERPTFEYLQAFLED  259 (262)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHHHHHHH
Confidence            456778889999999999999999999864

Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor

Probab=91.51  E-value=0.21  Score=34.64  Aligned_cols=31  Identities=23%  Similarity=0.249  Sum_probs=26.6

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      ..+..+...|++.+|..||++.++++.|+..
T Consensus       248 ~~~~~li~~~l~~~p~~Rps~~~ll~~l~~~  278 (288)
T cd05061         248 ERVTDLMRMCWQFNPKMRPTFLEIVNLLKDD  278 (288)
T ss_pred             HHHHHHHHHHcCCChhHCcCHHHHHHHHHhh
Confidence            3466777899999999999999999998763

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes

Probab=91.49  E-value=0.3  Score=33.29  Aligned_cols=29  Identities=28%  Similarity=0.399  Sum_probs=24.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       231 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  259 (260)
T cd05069         231 SLHELMKLCWKKDPDERPTFEYIQSFLED  259 (260)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            34556678999999999999999998863

Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases

Probab=91.49  E-value=0.23  Score=33.26  Aligned_cols=28  Identities=29%  Similarity=0.423  Sum_probs=23.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|++.+|.+||++.+++..|+
T Consensus       235 ~~~~li~~~l~~~p~~Rps~~~l~~~l~  262 (262)
T cd00192         235 ELYELMLSCWQLDPEDRPTFSELVERLE  262 (262)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHhhC
Confidence            4666777899999999999999998763

Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors

Probab=91.42  E-value=0.28  Score=34.54  Aligned_cols=29  Identities=21%  Similarity=0.298  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|++.+|.+||++.+++..|+.
T Consensus       272 ~~~~li~~cl~~~p~~Rpt~~ell~~l~~  300 (302)
T cd05055         272 EIYDIMKTCWDADPLKRPTFKQIVQLIGK  300 (302)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHh
Confidence            45667789999999999999999999864

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases

Probab=91.34  E-value=0.22  Score=33.56  Aligned_cols=28  Identities=25%  Similarity=0.310  Sum_probs=24.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.+++..|.
T Consensus       223 ~~~~li~~~l~~~p~~Rp~~~ell~~l~  250 (251)
T cd05041         223 EIYRLMLQCWAYDPENRPSFSEIYNELQ  250 (251)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHHHHhh
Confidence            4666778899999999999999998875

Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1

Probab=91.34  E-value=0.26  Score=34.40  Aligned_cols=29  Identities=24%  Similarity=0.320  Sum_probs=25.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||++.++++.|..
T Consensus       246 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  274 (297)
T cd05089         246 EVYELMRQCWRDRPYERPPFAQISVQLSR  274 (297)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45677889999999999999999988865

Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase

Probab=91.33  E-value=0.23  Score=33.66  Aligned_cols=29  Identities=17%  Similarity=0.107  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       227 ~~~~li~~~l~~~p~~Rpt~~~l~~~l~~  255 (256)
T cd05082         227 VVYDVMKQCWHLDAATRPSFLQLREQLEH  255 (256)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHhc
Confidence            35567779999999999999999998863

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1

Probab=91.28  E-value=0.29  Score=33.76  Aligned_cols=29  Identities=24%  Similarity=0.263  Sum_probs=24.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++.+.|.+
T Consensus       254 ~~~~li~~cl~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05090         254 RMYSLMTECWQEGPSRRPRFKDIHTRLRS  282 (283)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHhhc
Confidence            34556678999999999999999988864

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase

Probab=91.27  E-value=0.29  Score=33.08  Aligned_cols=28  Identities=29%  Similarity=0.370  Sum_probs=24.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.+++..|.
T Consensus       229 ~~~~li~~~l~~~p~~Rps~~~~~~~l~  256 (257)
T cd05040         229 DIYNVMLQCWAHNPADRPTFAALREFLP  256 (257)
T ss_pred             HHHHHHHHHCCCCcccCCCHHHHHHHhc
Confidence            4566778999999999999999998874

Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase

Probab=91.16  E-value=0.31  Score=33.19  Aligned_cols=29  Identities=24%  Similarity=0.389  Sum_probs=24.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++...|+.
T Consensus       231 ~~~~~i~~~l~~~p~~Rp~~~~l~~~L~~  259 (260)
T cd05073         231 ELYNIMMRCWKNRPEERPTFEYIQSVLDD  259 (260)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHHhc
Confidence            45567789999999999999999998863

Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3

Probab=91.14  E-value=0.34  Score=33.52  Aligned_cols=30  Identities=10%  Similarity=0.024  Sum_probs=25.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|...+|..||++.+++..|...
T Consensus       239 ~~~~li~~c~~~~p~~Rps~~el~~~l~~~  268 (279)
T cd05111         239 DVYMVMVKCWMIDENVRPTFKELANEFTRM  268 (279)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            345567789999999999999999988763

Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=91.00  E-value=0.25  Score=34.23  Aligned_cols=27  Identities=22%  Similarity=0.274  Sum_probs=23.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|.+.+|.+||++.+++..|
T Consensus       247 ~~~~li~~cl~~~p~~Rps~~~il~~L  273 (274)
T cd05076         247 ELATLISQCLTYEPTQRPSFRTILRDL  273 (274)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHhh
Confidence            356677889999999999999999876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10

Probab=90.98  E-value=0.33  Score=33.29  Aligned_cols=29  Identities=21%  Similarity=0.261  Sum_probs=24.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|..||++.++.+.|..
T Consensus       236 ~~~~li~~c~~~~p~~RP~~~~i~~~l~~  264 (266)
T cd05064         236 LLHQLMLDCWQKERGERPRFSQIHSILSK  264 (266)
T ss_pred             HHHHHHHHHcCCCchhCCCHHHHHHHHHh
Confidence            45567788999999999999999998864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor

Probab=90.82  E-value=0.28  Score=35.90  Aligned_cols=28  Identities=14%  Similarity=0.328  Sum_probs=24.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++++|+.
T Consensus       344 l~~li~~cl~~dp~~RPs~~~l~~~l~~  371 (374)
T cd05106         344 IYSIMKMCWNLEPTERPTFSQISQLIQR  371 (374)
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            4556678999999999999999999975

Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk

Probab=90.79  E-value=0.33  Score=33.02  Aligned_cols=28  Identities=21%  Similarity=0.375  Sum_probs=24.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.++...|+
T Consensus       231 ~~~~li~~~l~~~p~~Rp~~~~l~~~l~  258 (260)
T cd05067         231 ELYELMRLCWKEKPEERPTFEYLRSVLE  258 (260)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHhh
Confidence            4666777999999999999999999885

Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4

Probab=90.65  E-value=0.38  Score=33.91  Aligned_cols=30  Identities=20%  Similarity=0.207  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.+++..|...
T Consensus       264 ~l~~li~~cl~~~p~~Rps~~~ll~~l~~~  293 (314)
T cd05099         264 ELYMLMRECWHAVPTQRPTFKQLVEALDKV  293 (314)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            455677899999999999999999988754

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases

Probab=90.00  E-value=0.45  Score=32.23  Aligned_cols=29  Identities=24%  Similarity=0.379  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|..||++.++...|+.
T Consensus       232 ~~~~~i~~~l~~~p~~Rp~~~~l~~~l~~  260 (261)
T cd05034         232 ELYDLMLQCWDKDPEERPTFEYLQSFLED  260 (261)
T ss_pred             HHHHHHHHHcccCcccCCCHHHHHHHHhc
Confidence            46667789999999999999999988863

Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A

Probab=89.89  E-value=0.38  Score=33.24  Aligned_cols=27  Identities=15%  Similarity=0.165  Sum_probs=23.6

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      +..+...|.+.+|.+||++.++...|+
T Consensus       253 ~~~li~~cl~~~P~~Rp~~~~l~~~l~  279 (280)
T cd05092         253 VYAIMQGCWQREPQQRMVIKDIHSRLQ  279 (280)
T ss_pred             HHHHHHHHccCChhhCCCHHHHHHHHh
Confidence            456678899999999999999998875

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2

Probab=89.87  E-value=0.38  Score=33.79  Aligned_cols=29  Identities=24%  Similarity=0.397  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|..||++.+++..|..
T Consensus       251 ~~~~li~~~l~~~p~~Rp~~~~il~~l~~  279 (303)
T cd05088         251 EVYDLMRQCWREKPYERPSFAQILVSLNR  279 (303)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35667789999999999999999998864

Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=89.79  E-value=0.33  Score=32.68  Aligned_cols=28  Identities=21%  Similarity=0.207  Sum_probs=24.1

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      ..+..+...|...+|.+||++.++++.|
T Consensus       231 ~~~~~li~~~l~~~p~~Rpt~~~il~~l  258 (259)
T cd05037         231 AELANLINQCWTYDPTKRPSFRAILRDL  258 (259)
T ss_pred             hHHHHHHHHHhccChhhCCCHHHHHHhc
Confidence            4566777889999999999999999876

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3

Probab=89.49  E-value=0.49  Score=33.71  Aligned_cols=30  Identities=20%  Similarity=0.173  Sum_probs=26.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.+++..|...
T Consensus       264 ~l~~li~~cl~~~p~~Rps~~ell~~l~~~  293 (334)
T cd05100         264 ELYMIMRECWHAVPSQRPTFKQLVEDLDRV  293 (334)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHHH
Confidence            455677899999999999999999999754

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>smart00219 TyrKc Tyrosine kinase, catalytic domain

Probab=89.27  E-value=0.43  Score=31.98  Aligned_cols=27  Identities=30%  Similarity=0.496  Sum_probs=22.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+.++...|+..+|.+||++.+++..|
T Consensus       232 ~~~~~i~~~l~~~p~~Rpt~~~ll~~l  258 (258)
T smart00219      232 EIYKLMLQCWAEDPEDRPTFSELVEIL  258 (258)
T ss_pred             HHHHHHHHHCcCChhhCcCHHHHHhhC
Confidence            456677899999999999999988764

Phosphotransferases. Tyrosine-specific kinase subfamily.

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor

Probab=89.21  E-value=0.49  Score=33.39  Aligned_cols=29  Identities=10%  Similarity=0.183  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|..||++.+++..|..
T Consensus       239 ~~~~li~~cl~~~p~~Rps~~~l~~~l~~  267 (316)
T cd05108         239 DVYMIMVKCWMIDADSRPKFRELIIEFSK  267 (316)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            45667789999999999999999998864

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha

Probab=89.19  E-value=0.39  Score=35.75  Aligned_cols=29  Identities=14%  Similarity=0.294  Sum_probs=25.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++++|+.
T Consensus       368 ~l~~li~~cl~~dP~~RPt~~~l~~~l~~  396 (400)
T cd05105         368 EVYDIMVKCWNSEPEKRPSFLHLSDIVES  396 (400)
T ss_pred             HHHHHHHHHCccCHhHCcCHHHHHHHHHH
Confidence            46678889999999999999999999975

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2

Probab=89.16  E-value=0.44  Score=31.99  Aligned_cols=25  Identities=16%  Similarity=0.213  Sum_probs=21.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|++.+|.+||++.+|++
T Consensus       237 ~~~~l~~~~l~~~p~~Rp~~~~il~  261 (265)
T cd08217         237 ELNEVIKSMLNVDPDKRPSTEELLQ  261 (265)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhh
Confidence            4566777899999999999999875

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=88.84  E-value=0.44  Score=32.67  Aligned_cols=27  Identities=19%  Similarity=0.325  Sum_probs=22.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|.+.+|.+||++.+++..+
T Consensus       235 ~~~~li~~cl~~dp~~Rp~~~~il~~~  261 (262)
T cd05077         235 ELADLMTHCMNYDPNQRPFFRAIMRDI  261 (262)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHhc
Confidence            345667789999999999999998765

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain

Probab=88.48  E-value=0.55  Score=30.78  Aligned_cols=26  Identities=15%  Similarity=0.088  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+..+..+|+..+|.+||++.++++
T Consensus       215 ~~~~~~i~~~l~~~p~~Rp~~~~~~~  240 (244)
T smart00220      215 PEAKDLIRKLLVKDPEKRLTAEEALQ  240 (244)
T ss_pred             HHHHHHHHHHccCCchhccCHHHHhh
Confidence            35677888999999999999999875

Phosphotransferases. Serine or threonine-specific kinase subfamily.

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4

Probab=88.37  E-value=0.65  Score=31.72  Aligned_cols=28  Identities=25%  Similarity=0.350  Sum_probs=24.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|++.+|..||++.+++..|.
T Consensus       247 ~l~~~i~~~l~~~p~~Rp~~~~~l~~l~  274 (275)
T cd05046         247 RLYKLMTRCWAVNPKDRPSFSELVSALG  274 (275)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHhc
Confidence            4667888999999999999999998874

Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4

Probab=88.35  E-value=0.65  Score=32.54  Aligned_cols=29  Identities=10%  Similarity=0.092  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|...+|..||++.+++..|..
T Consensus       239 ~~~~li~~c~~~~p~~Rp~~~~l~~~l~~  267 (303)
T cd05110         239 DVYMVMVKCWMIDADSRPKFKELAAEFSR  267 (303)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45667788999999999999999999875

Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases

Probab=87.72  E-value=0.46  Score=32.61  Aligned_cols=25  Identities=16%  Similarity=0.101  Sum_probs=21.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|++.+|.+||++.+++.
T Consensus       255 ~~~~li~~~l~~~P~~Rpt~~~il~  279 (283)
T cd07835         255 DGLDLLSKMLVYDPAKRISAKAALQ  279 (283)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhc
Confidence            4667888999999999999998874

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1

Probab=87.25  E-value=0.74  Score=31.59  Aligned_cols=25  Identities=20%  Similarity=0.208  Sum_probs=21.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|.+||+|.+++.
T Consensus       228 ~~~~li~~~l~~~p~~Rp~~~~il~  252 (277)
T cd06642         228 PFKEFVEACLNKDPRFRPTAKELLK  252 (277)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHH
Confidence            4566778899999999999999986

Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta

Probab=87.23  E-value=0.63  Score=34.69  Aligned_cols=29  Identities=10%  Similarity=0.069  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|..||++.+++..|+.
T Consensus       370 ~l~~li~~cl~~~P~~RPs~~ell~~L~~  398 (401)
T cd05107         370 EIYEIMQKCWEEKFEIRPDFSQLVHLVGD  398 (401)
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            34556678999999999999999999875

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D

>smart00750 KIND kinase non-catalytic C-lobe domain

Probab=87.19  E-value=0.73  Score=29.46  Aligned_cols=28  Identities=7%  Similarity=-0.003  Sum_probs=24.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+.++...|.+.+|..||++.+++..+.
T Consensus       140 ~~~~~i~~cl~~~p~~Rp~~~~ll~~~~  167 (176)
T smart00750      140 SFADFMRVCASRLPQRREAANHYLAHCR  167 (176)
T ss_pred             hHHHHHHHHHhcccccccCHHHHHHHHH
Confidence            4677888999999999999999987764

It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains

Probab=87.09  E-value=0.73  Score=30.95  Aligned_cols=25  Identities=16%  Similarity=0.103  Sum_probs=21.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++...|++.+|.+||++.++++
T Consensus       228 ~~~~~i~~~l~~~p~~Rp~~~~ll~  252 (256)
T cd08529         228 QLAQLIDQCLTKDYRQRPDTFQLLR  252 (256)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHhh
Confidence            4666778999999999999998875

Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3

Probab=87.08  E-value=0.61  Score=32.00  Aligned_cols=25  Identities=24%  Similarity=0.414  Sum_probs=21.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|.+||++.+++.
T Consensus       258 ~~~~li~~~l~~~P~~Rp~~~~il~  282 (286)
T cd07846         258 LVLDLAKQCLRIDPDDRPSSSQLLH  282 (286)
T ss_pred             HHHHHHHHHhcCCcccchhHHHHhc
Confidence            4667888999999999999998764

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa

Probab=86.89  E-value=0.87  Score=31.05  Aligned_cols=29  Identities=14%  Similarity=-0.018  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++-..|.+.+|.+||++.+|.+.|+.
T Consensus       226 ~l~~li~~c~~~~~~~Rp~~~~i~~~l~~  254 (257)
T cd05115         226 EMYALMKDCWIYKWEDRPNFAKVEERMRT  254 (257)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHhh
Confidence            34456778999999999999999999865

Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase

Probab=86.77  E-value=0.87  Score=31.06  Aligned_cols=29  Identities=17%  Similarity=0.204  Sum_probs=24.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|+..+|.+||++.+++..|+.
T Consensus       236 ~~~~li~~~l~~~P~~Rpt~~~~~~~l~~  264 (270)
T cd05056         236 TLYSLMTKCWAYDPSKRPRFTELKAQLSD  264 (270)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35556678999999999999999998875

Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2

Probab=86.71  E-value=0.93  Score=31.14  Aligned_cols=30  Identities=13%  Similarity=0.062  Sum_probs=25.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|..||++.+++..|...
T Consensus       239 ~~~~li~~~l~~dp~~Rp~~~~l~~~l~~~  268 (279)
T cd05109         239 DVYMIMVKCWMIDSECRPRFRELVDEFSRM  268 (279)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            455677789999999999999999888653

Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1

Probab=86.70  E-value=0.67  Score=31.26  Aligned_cols=24  Identities=21%  Similarity=0.394  Sum_probs=20.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|..||+|.+|+.
T Consensus       229 ~~~li~~~l~~~p~~Rp~~~~vl~  252 (256)
T cd08218         229 LRNLVSQLFKRNPRDRPSVNSILE  252 (256)
T ss_pred             HHHHHHHHhhCChhhCcCHHHHhh
Confidence            455666899999999999999975

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases

Probab=86.40  E-value=0.82  Score=31.31  Aligned_cols=26  Identities=19%  Similarity=0.258  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+..+...|.+.+|.+||++.+++.
T Consensus       254 ~~~~~li~~cl~~~p~~Rpt~~ei~~  279 (283)
T cd07830         254 PEAIDLIKDMLRWDPKKRPTASQALQ  279 (283)
T ss_pred             HHHHHHHHHhcccCcccCCCHHHHhh
Confidence            35778888999999999999998864

Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases

Probab=86.13  E-value=0.94  Score=31.36  Aligned_cols=25  Identities=20%  Similarity=0.220  Sum_probs=21.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|++.+|.+||++.+++.
T Consensus       241 ~~~~li~~~l~~~p~~Rpt~~eil~  265 (287)
T cd06621         241 EFKDFIKQCLEKDPTRRPTPWDMLE  265 (287)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHh
Confidence            4567778999999999999998875

Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases

Probab=85.51  E-value=0.92  Score=30.93  Aligned_cols=26  Identities=12%  Similarity=0.047  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..++++...|++.+|.+||++.+++.
T Consensus       258 ~~~~~~i~~~l~~~P~~Rp~~~~~l~  283 (287)
T cd07840         258 PSALDLLDKLLTLDPKKRISADQALQ  283 (287)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHhh
Confidence            35677888999999999999998874

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases

Probab=85.29  E-value=0.73  Score=31.80  Aligned_cols=27  Identities=19%  Similarity=0.209  Sum_probs=22.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVL   42 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L   42 (97)
                      .+..+...|++.+|..||++.++....
T Consensus       241 ~~~~li~~~l~~dp~~Rpt~~e~~~~~  267 (284)
T cd06620         241 DLRDFVDACLLKDPTERPTPQQLCAMP  267 (284)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhcCc
Confidence            355666789999999999999998764

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4

Probab=85.18  E-value=0.9  Score=30.57  Aligned_cols=25  Identities=20%  Similarity=0.283  Sum_probs=21.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++...|++.+|.+||++.+++.
T Consensus       229 ~~~~li~~~l~~~p~~Rp~~~~~l~  253 (257)
T cd08223         229 ELGELIATMLSKRPEKRPSVKSILR  253 (257)
T ss_pred             HHHHHHHHHhccCcccCCCHHHHhc
Confidence            4566778899999999999998864

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase

Probab=84.99  E-value=1.1  Score=30.51  Aligned_cols=25  Identities=16%  Similarity=0.219  Sum_probs=20.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|++.+|.+||++.+++.
T Consensus       240 ~~~~li~~~l~~~p~~Rpt~~~ll~  264 (268)
T cd06624         240 EAKNFILRCFEPDPDKRASAHDLLQ  264 (268)
T ss_pred             HHHHHHHHHcCCCchhCCCHHHHHh
Confidence            3556678999999999999998764

Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8

Probab=84.69  E-value=0.91  Score=30.48  Aligned_cols=24  Identities=25%  Similarity=0.439  Sum_probs=20.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       229 l~~li~~~l~~~p~~Rpt~~~ll~  252 (256)
T cd08220         229 LRQLILSMLNLDPSKRPQLSQIMA  252 (256)
T ss_pred             HHHHHHHHccCChhhCCCHHHHhh
Confidence            556668899999999999998874

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2

Probab=84.18  E-value=0.88  Score=30.54  Aligned_cols=25  Identities=20%  Similarity=0.278  Sum_probs=20.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++-..|.+.+|..||++.+++.
T Consensus       228 ~~~~~i~~~l~~~P~~Rps~~~il~  252 (256)
T cd06612         228 EFNDFVKKCLVKDPEERPSAIQLLQ  252 (256)
T ss_pred             HHHHHHHHHHhcChhhCcCHHHHhc
Confidence            3455667899999999999998874

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase

Probab=84.14  E-value=1.2  Score=29.50  Aligned_cols=25  Identities=20%  Similarity=0.365  Sum_probs=20.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+..+|++.+|..||++.+++.
T Consensus       232 ~l~~~i~~~l~~~p~~Rp~~~~ll~  256 (260)
T cd06606         232 EAKDFLRKCLRRDPKKRPTADELLQ  256 (260)
T ss_pred             HHHHHHHHhCcCChhhCCCHHHHhh
Confidence            3555667899999999999998874

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases

Probab=84.00  E-value=1.3  Score=30.23  Aligned_cols=25  Identities=12%  Similarity=0.170  Sum_probs=21.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|..||++.+++.
T Consensus       255 ~~~~~i~~~l~~~P~~Rp~~~~ll~  279 (283)
T cd05118         255 QALDLLSQMLHYDPHKRITAEQALA  279 (283)
T ss_pred             HHHHHHHHHhccCcccCcCHHHHhh
Confidence            4667788999999999999998874

Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases

Probab=83.86  E-value=0.85  Score=31.25  Aligned_cols=25  Identities=16%  Similarity=0.258  Sum_probs=21.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|+..+|.+||++.+++.
T Consensus       260 ~~~~li~~~l~~~p~~Rps~~~il~  284 (288)
T cd07833         260 PALDFLKACLRMDPKERLTCDELLQ  284 (288)
T ss_pred             HHHHHHHHHhccCchhcccHHHHhc
Confidence            4667778899999999999988764

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin

Probab=83.67  E-value=1.4  Score=30.20  Aligned_cols=25  Identities=16%  Similarity=0.158  Sum_probs=20.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      +..+...|.+.+|.+||++.+++.-
T Consensus       259 ~~~li~~~l~~~p~~Rps~~ell~~  283 (286)
T cd06638         259 FNDFIRKCLTKDYEKRPTVSDLLQH  283 (286)
T ss_pred             HHHHHHHHccCCcccCCCHHHHhhc
Confidence            5556678999999999999998753

Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases

Probab=83.17  E-value=1.2  Score=31.03  Aligned_cols=25  Identities=12%  Similarity=0.100  Sum_probs=21.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++...|++.+|.+||++.+++.
T Consensus       288 ~~~~~i~~~l~~~P~~Rps~~eil~  312 (316)
T cd07842         288 QGFDLLRKLLEYDPTKRITAEEALE  312 (316)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhc
Confidence            4677888999999999999988864

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2

Probab=82.91  E-value=1.5  Score=30.08  Aligned_cols=21  Identities=14%  Similarity=0.156  Sum_probs=17.1

Q ss_pred             HhhCCCCCCCCCCHHHHHHHhh
Q 038066           22 LLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        22 l~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      ..|. .+|.+||++.++++.|.
T Consensus       247 ~~c~-~~P~~Rp~~~~i~~~l~  267 (268)
T cd05086         247 QFCW-LSPEKRATAEEVHRLLT  267 (268)
T ss_pred             HHHh-hCcccCCCHHHHHHHhc
Confidence            4576 56999999999998873

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage

>cd00180 PKc Catalytic domain of Protein Kinases

Probab=82.82  E-value=1.3  Score=28.02  Aligned_cols=27  Identities=22%  Similarity=0.236  Sum_probs=23.3

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      ..+.++...|.+.+|..||++.+++..
T Consensus       188 ~~~~~~l~~~l~~~p~~R~~~~~l~~~  214 (215)
T cd00180         188 PELKDLIRKMLQKDPEKRPSAKEILEH  214 (215)
T ss_pred             HHHHHHHHHHhhCCcccCcCHHHHhhC
Confidence            577788899999999999999988753

Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases

Probab=82.56  E-value=1.2  Score=29.43  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=20.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++...|++.+|..||++.+++.
T Consensus       226 ~~~~~i~~~l~~~p~~R~t~~~~l~  250 (253)
T cd05122         226 EFKDFLKKCLQKNPEKRPTAEQLLK  250 (253)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhc
Confidence            3555667899999999999988764

Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7

Probab=82.48  E-value=1.4  Score=30.45  Aligned_cols=26  Identities=8%  Similarity=0.043  Sum_probs=22.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      .+.++...|++.+|..||++.+++..
T Consensus       257 ~~~~li~~~l~~~P~~R~s~~e~l~~  282 (298)
T cd07841         257 DALDLLQRLLTLNPNKRITARQALEH  282 (298)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhhC
Confidence            45667788999999999999999864

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4

Probab=82.44  E-value=1.6  Score=30.00  Aligned_cols=27  Identities=19%  Similarity=0.144  Sum_probs=22.2

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      ..+..+...|.+.+|..||++.+++..
T Consensus       227 ~~~~~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06640         227 KPFKEFIDACLNKDPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHhC
Confidence            346677789999999999999998643

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases

Probab=82.40  E-value=1.2  Score=30.02  Aligned_cols=25  Identities=16%  Similarity=0.203  Sum_probs=20.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+.++-..|+..+|..||++.+++.
T Consensus       247 ~~~~li~~~l~~dp~~Rpt~~~ll~  271 (275)
T cd06608         247 KFNDFISECLIKNYEQRPFMEELLE  271 (275)
T ss_pred             HHHHHHHHHhhcChhhCcCHHHHhc
Confidence            3456667899999999999998874

Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5

Probab=82.34  E-value=1.3  Score=29.66  Aligned_cols=24  Identities=21%  Similarity=0.319  Sum_probs=19.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +.++-.+|.+.+|.+||++.+++.
T Consensus       230 ~~~~i~~~l~~~p~~Rpt~~~ll~  253 (257)
T cd08225         230 LRSLISQLFKVSPRDRPSITSILK  253 (257)
T ss_pred             HHHHHHHHhccChhhCcCHHHHhh
Confidence            445556899999999999998864

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase

Probab=82.31  E-value=1.5  Score=29.94  Aligned_cols=26  Identities=12%  Similarity=0.096  Sum_probs=21.6

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+.++...|++.+|.+||++.+++.
T Consensus       253 ~~~~~li~~~l~~~P~~R~~~~~~l~  278 (282)
T cd07831         253 AEGLDLLKKLLAYDPDERITAKQALR  278 (282)
T ss_pred             HHHHHHHHHHhccCcccccCHHHHhh
Confidence            45667778899999999999988764

Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4

Probab=82.27  E-value=1.4  Score=30.14  Aligned_cols=25  Identities=12%  Similarity=0.155  Sum_probs=20.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|..||++.+++.
T Consensus       258 ~~~~li~~~l~~~p~~Rp~~~eil~  282 (286)
T cd07847         258 PALSFLKGCLQMDPTERLSCEELLE  282 (286)
T ss_pred             HHHHHHHHHhcCCccccCCHHHHhc
Confidence            3567778999999999999988764

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase

Probab=81.76  E-value=1.3  Score=31.20  Aligned_cols=25  Identities=12%  Similarity=0.158  Sum_probs=21.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      +.++..+|++.+|.+||++.+++..
T Consensus       263 ~~~li~~~l~~~P~~Rpt~~~ll~~  287 (308)
T cd06615         263 FQDFVDKCLKKNPKERADLKELTKH  287 (308)
T ss_pred             HHHHHHHHccCChhhCcCHHHHhcC
Confidence            5577789999999999999988754

Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase

Probab=81.49  E-value=1.7  Score=29.57  Aligned_cols=25  Identities=12%  Similarity=0.157  Sum_probs=20.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+-..|.+.+|.+||++.+++.
T Consensus       244 ~~~~li~~~l~~~p~~Rpt~~~il~  268 (272)
T cd06637         244 KFQSFIESCLVKNHSQRPTTEQLMK  268 (272)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHhh
Confidence            3455667899999999999988764

Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3

Probab=81.39  E-value=1.8  Score=29.73  Aligned_cols=26  Identities=15%  Similarity=0.162  Sum_probs=21.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLV   41 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~   41 (97)
                      .+..+...|.+.+|..||++.+++..
T Consensus       228 ~~~~~i~~~l~~~p~~Rp~~~~~l~~  253 (277)
T cd06641         228 PLKEFVEACLNKEPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHhC
Confidence            35567788999999999999998863

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein

Probab=81.22  E-value=1.6  Score=30.54  Aligned_cols=25  Identities=20%  Similarity=0.392  Sum_probs=21.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|.+||++.+++.
T Consensus       270 ~~~~li~~~l~~~P~~Rpt~~~ll~  294 (314)
T cd08216         270 HFHQFVELCLQRDPESRPSASQLLN  294 (314)
T ss_pred             HHHHHHHHHhhcCCCcCcCHHHHhc
Confidence            4556777899999999999988874

Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3

Probab=80.65  E-value=1.8  Score=29.71  Aligned_cols=23  Identities=13%  Similarity=0.089  Sum_probs=19.1

Q ss_pred             HHHHHhhCCCCCCCCCCHHHHHH
Q 038066           18 MHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        18 ~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+-..|.+.+|.+||++.+++.
T Consensus       258 ~~li~~~l~~~P~~Rpt~~~~l~  280 (284)
T cd07860         258 RDLLSQMLHYDPNKRISAKAALA  280 (284)
T ss_pred             HHHHHHhcCCCcccCCCHHHHhc
Confidence            35667899999999999988863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin

Probab=80.52  E-value=1.5  Score=30.29  Aligned_cols=25  Identities=20%  Similarity=0.178  Sum_probs=20.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|.+.+|..||++.+++.
T Consensus       262 ~l~~li~~~l~~~p~~Rps~~~il~  286 (291)
T cd06639         262 SFNHFISQCLIKDFEARPSVTHLLE  286 (291)
T ss_pred             HHHHHHHHHhhcChhhCcCHHHHhc
Confidence            3556778899999999999998764

Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases

Probab=80.51  E-value=1.8  Score=29.61  Aligned_cols=24  Identities=25%  Similarity=0.403  Sum_probs=20.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|+..+|.+||++.+++.
T Consensus       227 ~~~~l~~~l~~~p~~Rpt~~~il~  250 (274)
T cd06609         227 FKDFVSLCLNKDPKERPSAKELLK  250 (274)
T ss_pred             HHHHHHHHhhCChhhCcCHHHHhh
Confidence            455667899999999999999865

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5

Probab=80.31  E-value=1.5  Score=30.27  Aligned_cols=24  Identities=25%  Similarity=0.429  Sum_probs=20.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +.++...|.+.+|..||++.+++.
T Consensus       229 ~~~li~~~l~~~P~~Rp~~~eil~  252 (279)
T cd06619         229 FVHFITQCMRKQPKERPAPENLMD  252 (279)
T ss_pred             HHHHHHHHhhCChhhCCCHHHHhc
Confidence            456667899999999999988864

Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases

Probab=80.21  E-value=1.9  Score=29.40  Aligned_cols=24  Identities=8%  Similarity=0.030  Sum_probs=20.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIV   39 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv   39 (97)
                      .+.++...|++.+|..||++.+++
T Consensus       259 ~~~~li~~~l~~dp~~Rp~~~~il  282 (287)
T cd07838         259 EGLDLLKKMLTFNPHKRISAFEAL  282 (287)
T ss_pred             HHHHHHHHHhccCCccCCCHHHHh
Confidence            345667789999999999999876

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity

Probab=80.16  E-value=1.5  Score=29.39  Aligned_cols=26  Identities=19%  Similarity=0.249  Sum_probs=21.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+.++-..|++.+|.+||++.++++
T Consensus       231 ~~l~~li~~~l~~~p~~R~~~~~l~~  256 (260)
T PF00069_consen  231 EELRDLIKKMLSKDPEQRPSAEELLK  256 (260)
T ss_dssp             HHHHHHHHHHSSSSGGGSTTHHHHHT
T ss_pred             HHHHHHHHHHccCChhHCcCHHHHhc
Confidence            35666677899999999999998874

Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta

Probab=80.01  E-value=2.8  Score=29.68  Aligned_cols=26  Identities=19%  Similarity=0.363  Sum_probs=22.1

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+..+...|.+.+|.+||++.++++
T Consensus       282 ~~~~~li~~~l~~dP~~Rpta~e~l~  307 (328)
T cd08226         282 PAFQNLVELCLQQDPEKRPSASSLLS  307 (328)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHhh
Confidence            35677888999999999999999864

Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	97
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	2e-05

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307

 Score = 40.2 bits (95), Expect = 2e-05
 Identities = 4/38 (10%), Positives = 11/38 (28%)

Query: 9   FSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSYS 46
                V     +    + +    RP +  +  +L   +
Sbjct: 268 ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 305

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	97
3uim_A	326	Brassinosteroid insensitive 1-associated receptor;	96.9
2qkw_B	321	Protein kinase; three-helix bundle motif, AVRPTO-P	96.29
3hmm_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	95.8
3omv_A	307	RAF proto-oncogene serine/threonine-protein kinas;	95.48
4aoj_A	329	High affinity nerve growth factor receptor; transf	95.26
4gt4_A	308	Tyrosine-protein kinase transmembrane receptor RO;	95.24
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	95.07
4asz_A	299	BDNF/NT-3 growth factors receptor; transferase, TR	94.4
3gxj_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	94.24
3q4u_A	301	Activin receptor type-1; structural genomics conso	93.81
3soc_A	322	Activin receptor type-2A; structural genomics cons	93.59
1b6c_B	342	TGF-B superfamily receptor type I; complex (isomer	93.46
2eva_A	307	TAK1 kinase - TAB1 chimera fusion protein; transfe	93.34
2y4i_B	319	KSR2, HKSR2, kinase suppressor of RAS 2; transfera	93.19
3poz_A	327	Epidermal growth factor receptor; kinase domain, a	93.17
4ase_A	353	Vascular endothelial growth factor receptor 2; tra	93.13
3mdy_A	337	Bone morphogenetic protein receptor type-1B; compl	93.03
2qol_A	373	Ephrin receptor; receptor tyrosine kinase, juxtame	92.74
3ugc_A	295	Tyrosine-protein kinase JAK2; small molecule inhib	92.7
3uzp_A	296	CKI-delta, CKID, casein kinase I isoform delta; CK	92.33
3dtc_A	271	Mitogen-activated protein kinase kinase kinase 9;	92.33
2v62_A	345	Serine/threonine-protein kinase VRK2; transferase,	92.29
3lb7_A	307	RAF proto-oncogene serine/threonine-protein kinas;	92.22
4hgt_A	296	Casein kinase I isoform delta; CK1D, inhibitor, tr	92.22
3lxp_A	318	Non-receptor tyrosine-protein kinase TYK2; JAK3, i	92.21
3kul_A	325	Ephrin type-A receptor 8; ATP-binding, kinase, nuc	92.17
3lxl_A	327	Tyrosine-protein kinase JAK3; TYK2, inflammation,	92.09
3g2f_A	336	Bone morphogenetic protein receptor type-2; kinase	92.05
1xbb_A	291	Tyrosine-protein kinase SYK; gleevec, STI-571, ima	92.05
3s95_A	310	LIMK-1, LIM domain kinase 1; structural genomics,	91.84
3sxs_A	268	Cytoplasmic tyrosine-protein kinase BMX; transfera	91.8
3vhe_A	359	Vascular endothelial growth factor receptor 2; kin	91.8
2w1i_A	326	JAK2; chromosomal rearrangement, nucleotide-bindin	91.78
1mqb_A	333	Ephrin type-A receptor 2; tyrosine protein kinase,	91.77
2buj_A	317	Serine/threonine-protein kinase 16; transferase, A	91.75
3og7_A	289	AKAP9-BRAF fusion protein; proto-oncogene, V600E,	91.67
1csn_A	298	Casein kinase-1; phosphotransferase; HET: ATP; 2.0	91.58
4e5w_A	302	Tyrosine-protein kinase JAK1; kinase domain, trans	91.49
4f0f_A	287	Serine/threonine-protein kinase ROCO4; LRRK2, ATP-	91.4
1t46_A	313	HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom	91.4
1qpc_A	279	LCK kinase; alpha beta fold, transferase; HET: PTR	91.39
3t9t_A	267	Tyrosine-protein kinase ITK/TSK; kinase domain, al	91.38
4hcu_A	269	Tyrosine-protein kinase ITK/TSK; transferase-trans	91.22
3kmu_A	271	ILK, integrin-linked kinase; cell adhesion, ANK re	91.13
3f66_A	298	Hepatocyte growth factor receptor; C-Met, protein	91.12
2i1m_A	333	Macrophage colony-stimulating factor 1 receptor; k	91.11
2wqm_A	310	Serine/threonine-protein kinase NEK7; ATP-binding,	91.06
1u46_A	291	ACK-1, activated CDC42 kinase 1; tyrosine kinase,	91.01
3tt0_A	382	Basic fibroblast growth factor receptor 1; kinase	90.97
2ivs_A	314	Proto-oncogene tyrosine-protein kinase receptor RE	90.95
2jii_A	352	Serine/threonine-protein kinase VRK3 molecule: VA	90.69
3cbl_A	377	C-FES, proto-oncogene tyrosine-protein kinase FES/	90.68
1fmk_A	452	C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros	90.57
3kfa_A	288	Tyrosine-protein kinase ABL1; CML, drug resistance	90.57
1byg_A	278	CSK, protein (C-terminal SRC kinase); protein kina	90.57
3cc6_A	281	Protein tyrosine kinase 2 beta; focal adhesion kin	90.55
3gen_A	283	Tyrosine-protein kinase BTK; bruton'S tyrosine kin	90.48
2xir_A	316	Vascular endothelial growth factor receptor 2; ang	90.46
3pls_A	298	Macrophage-stimulating protein receptor; protein k	90.43
1qcf_A	454	Haematopoetic cell kinase (HCK); tyrosine kinase-i	90.33
1mp8_A	281	Focal adhesion kinase 1; tyrosine protein kinase,	90.21
1luf_A	343	Muscle-specific tyrosine kinase receptor MUSK; pho	90.09
1opk_A	495	P150, C-ABL, proto-oncogene tyrosine-protein kinas	90.0
2pvf_A	334	Fibroblast growth factor receptor 2; kinase domain	89.85
3kex_A	325	Receptor tyrosine-protein kinase ERBB-3; kinase do	89.82
3brb_A	313	Proto-oncogene tyrosine-protein kinase MER; ATP-bi	89.81
3p86_A	309	Serine/threonine-protein kinase CTR1; ETR1, ERS1,	89.74
4fvq_A	289	Tyrosine-protein kinase JAK2; janus protein kinase	89.67
3lzb_A	327	Epidermal growth factor receptor; epidermal growth	89.56
3qup_A	323	Tyrosine-protein kinase receptor TYRO3; protein ki	89.46
3l9p_A	367	Anaplastic lymphoma kinase; kinase domain, ATP-bin	89.42
1p4o_A	322	Insulin-like growth factor I receptor protein; IGF	89.28
2psq_A	370	Fibroblast growth factor receptor 2; kinase domain	88.95
2yfx_A	327	Tyrosine-protein kinase receptor; nucleotide-bindi	88.89
1rjb_A	344	FL cytokine receptor; kinase, structure, autoinhib	88.87
2a19_B	284	Interferon-induced, double-stranded RNA-activated	88.72
1u59_A	287	Tyrosine-protein kinase ZAP-70; transferase; HET:	88.69
3op5_A	364	Serine/threonine-protein kinase VRK1; adenosine tr	88.55
3c1x_A	373	Hepatocyte growth factor receptor; receptor tyrosi	88.48
1fvr_A	327	Tyrosine-protein kinase TIE-2; tyrosine kinase, tr	87.8
2ozo_A	613	Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t	87.62
3sv0_A	483	Casein kinase I-like; typical kinase domain fold,	86.85
2h8h_A	535	Proto-oncogene tyrosine-protein kinase SRC; SRC ki	86.75
3ll6_A	337	Cyclin G-associated kinase; transferase, protein k	86.73
1k9a_A	450	Carboxyl-terminal SRC kinase; COOH-terminal SRC ki	86.7
4fl3_A	635	Tyrosine-protein kinase SYK; transferase; HET: ANP	86.31
2izr_A	330	Casein kinase I isoform gamma-3; serine/threonine-	85.05
4agu_A	311	Cyclin-dependent kinase-like 1; transferase, phosp	84.51
3is5_A	285	Calcium-dependent protein kinase; CDPK, structural	83.94
3dbq_A	343	Dual specificity protein kinase TTK; MPS1 structur	83.52
3p1a_A	311	MYT1 kinase, membrane-associated tyrosine- and thr	83.13
2w5a_A	279	Serine/threonine-protein kinase NEK2; Ser/Thr prot	83.11
1wak_A	397	Serine/threonine-protein kinase SPRK1; SRPK, trans	82.83
2iwi_A	312	Serine/threonine-protein kinase PIM-2; nucleotide-	82.48
3cek_A	313	Dual specificity protein kinase TTK; HMPS1, PYT, E	82.06
1z57_A	339	Dual specificity protein kinase CLK1; protein tyro	82.02
2h6d_A	276	5'-AMP-activated protein kinase catalytic subunit	82.02
1zy4_A	303	Serine/threonine-protein kinase GCN2; translation	81.87
2clq_A	295	Mitogen-activated protein kinase kinase kinase 5;	81.62
1x8b_A	289	WEE1HU, WEE1-like protein kinase; cell cycle, tran	81.48
3fme_A	290	Dual specificity mitogen-activated protein kinase;	81.44
2vx3_A	382	Dual specificity tyrosine-phosphorylation- regula	81.24
1q8y_A	373	SR protein kinase; transferase; HET: ADP ADE; 2.05	80.93
2zmd_A	390	Dual specificity protein kinase TTK; MPS1, T686A,	80.89
2j0j_A	656	Focal adhesion kinase 1; cell migration, FERM, tra	80.81
2wtk_C	305	Serine/threonine-protein kinase 11; transferase-me	80.72
2vwi_A	303	Serine/threonine-protein kinase OSR1; STE kinase,	80.47
2ac3_A	316	MAP kinase-interacting serine/threonine kinase 2;	80.38
2dyl_A	318	Dual specificity mitogen-activated protein kinase	80.36

>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A*

Probab=96.90  E-value=0.0017  Score=44.68  Aligned_cols=40  Identities=25%  Similarity=0.494  Sum_probs=34.5

Q ss_pred             CCcCCHHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066            6 SDSFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus         6 ~~~~~~~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      ...+.......+.++...|++.+|.+||++.++++.|++.
T Consensus       270 ~~~~~~~~~~~l~~li~~cl~~dP~~Rps~~ell~~L~~~  309 (326)
T 3uim_A          270 QGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGD  309 (326)
T ss_dssp             TTSCCHHHHHHHHHHHHHHTCSCGGGSCCHHHHHHHHHTS
T ss_pred             ccccCHHHHHHHHHHHHHHhCcCCccCCCHHHHHHHhcCc
Confidence            3445567778899999999999999999999999999875

>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A*

Probab=96.29  E-value=0.0062  Score=41.92  Aligned_cols=38  Identities=13%  Similarity=0.181  Sum_probs=31.9

Q ss_pred             cCCHHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066            8 SFSRNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus         8 ~~~~~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .........+..+...|.+.+|.+||++.++++.|+..
T Consensus       276 ~~~~~~~~~l~~li~~~l~~dP~~Rps~~ell~~L~~~  313 (321)
T 2qkw_B          276 KIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYA  313 (321)
T ss_dssp             CSCHHHHHHHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             ccCHHHHHHHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            34556667788888999999999999999999998753

>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A*

Probab=95.80  E-value=0.0074  Score=42.08  Aligned_cols=33  Identities=12%  Similarity=-0.071  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           12 NEVIRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        12 ~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +....+.++...|.+.+|.+||+|.+|++.|+.
T Consensus       262 ~~~~~l~~li~~cl~~dP~~RPt~~ei~~~L~~  294 (303)
T 3hmm_A          262 EALRVMAKIMRECWYANGAARLTALRIKKTLSQ  294 (303)
T ss_dssp             HHHHHHHHHHHTTCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            344567788899999999999999999999875

>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens}

Probab=95.48  E-value=0.014  Score=41.15  Aligned_cols=29  Identities=21%  Similarity=0.283  Sum_probs=24.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +.++...|.+.+|.+||+|.+|+..|+..
T Consensus       270 l~~li~~cl~~dP~~RPs~~ei~~~Le~l  298 (307)
T 3omv_A          270 MKRLVADCVKKVKEERPLFPQILSSIELL  298 (307)
T ss_dssp             HHHHHHHHTCSSSTTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            55566789999999999999999888753

>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens}

Probab=95.26  E-value=0.017  Score=40.88  Aligned_cols=30  Identities=10%  Similarity=0.130  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||+|.+|+..|+..
T Consensus       288 ~~~~li~~cl~~dP~~RPs~~ei~~~L~~l  317 (329)
T 4aoj_A          288 EVYAIMRGCWQREPQQRHSIKDVHARLQAL  317 (329)
T ss_dssp             HHHHHHHHHCCSSTTTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCcChhHCcCHHHHHHHHHHH
Confidence            355677899999999999999999999764

>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A

Probab=95.24  E-value=0.012  Score=41.37  Aligned_cols=29  Identities=17%  Similarity=0.153  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||+|.+|+..|+.
T Consensus       275 ~~~~li~~C~~~dP~~RPs~~ei~~~L~a  303 (308)
T 4gt4_A          275 WVYALMIECWNEFPSRRPRFKDIHSRLRA  303 (308)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            35567789999999999999999999975

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A*

Probab=95.07  E-value=0.054  Score=36.66  Aligned_cols=35  Identities=11%  Similarity=0.148  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           11 RNEVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        11 ~~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      ......+..+...|++.+|.+||++.+++..|+..
T Consensus       270 ~~~~~~l~~li~~cl~~~p~~Rps~~~l~~~L~~l  304 (307)
T 2nru_A          270 STSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEM  304 (307)
T ss_dssp             HHHHHHHHHHHHHHTCSSTTTSCCHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            33445677888899999999999999999999763

>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A*

Probab=94.40  E-value=0.029  Score=39.25  Aligned_cols=29  Identities=17%  Similarity=0.204  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       258 ~~~~li~~cl~~dP~~RPs~~~i~~~L~~  286 (299)
T 4asz_A          258 EVYELMLGCWQREPHMRKNIKGIHTLLQN  286 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35567789999999999999999999875

>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A*

Probab=93.81  E-value=0.058  Score=36.28  Aligned_cols=31  Identities=13%  Similarity=0.050  Sum_probs=27.1

Q ss_pred             HHHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           14 VIRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        14 l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ...+.++...|.+.+|.+||++.++++.|+.
T Consensus       269 ~~~l~~li~~cl~~dP~~Rps~~~i~~~L~~  299 (301)
T 3q4u_A          269 LTSLAKLMKECWYQNPSARLTALRIKKTLTK  299 (301)
T ss_dssp             HHHHHHHHHHHCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhcChhhCCCHHHHHHHHhc
Confidence            3457778889999999999999999999975

>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A*

Probab=93.59  E-value=0.064  Score=36.91  Aligned_cols=30  Identities=7%  Similarity=-0.167  Sum_probs=26.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ..+..+...|.+.+|.+||++.++++.|+.
T Consensus       286 ~~l~~li~~cl~~dP~~Rps~~ell~~L~~  315 (322)
T 3soc_A          286 AMLCETIEECWDHDAEARLSAGCVGERITQ  315 (322)
T ss_dssp             HHHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            347778889999999999999999999875

>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A*

Probab=93.46  E-value=0.07  Score=36.59  Aligned_cols=32  Identities=13%  Similarity=-0.083  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           13 EVIRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        13 ~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      ....+.++...|.+.+|.+||++.+++..|+.
T Consensus       302 ~~~~l~~li~~cl~~dp~~Rps~~~i~~~L~~  333 (342)
T 1b6c_B          302 ALRVMAKIMRECWYANGAARLTALRIKKTLSQ  333 (342)
T ss_dssp             HHHHHHHHHHHHCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhccChhhCCCHHHHHHHHHH
Confidence            34567778889999999999999999999875

>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens}

Probab=93.34  E-value=0.077  Score=36.27  Aligned_cols=35  Identities=26%  Similarity=0.325  Sum_probs=27.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhcCCCCCC
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSYSIILPV   51 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~~~~~~~   51 (97)
                      +..+...|.+.+|.+||++.++++.|+.....++.
T Consensus       233 l~~li~~~l~~dp~~Rps~~ell~~L~~~~~~~~~  267 (307)
T 2eva_A          233 IESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPG  267 (307)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHHGGGCCC
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHHHHHHHhccC
Confidence            45566789999999999999999999764333333

>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens}

Probab=93.19  E-value=0.071  Score=36.19  Aligned_cols=29  Identities=14%  Similarity=0.264  Sum_probs=25.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|...+|.+||++.+++..|+..
T Consensus       272 l~~li~~~l~~~p~~Rpt~~~l~~~l~~l  300 (319)
T 2y4i_B          272 ISDILLFCWAFEQEERPTFTKLMDMLEKL  300 (319)
T ss_dssp             HHHHHHHHHCSSTTTSCCHHHHHHHHTTC
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHHHHH
Confidence            45666789999999999999999999764

>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ...

Probab=93.17  E-value=0.062  Score=37.09  Aligned_cols=29  Identities=10%  Similarity=0.183  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       247 ~~~~li~~~l~~~p~~Rps~~ell~~l~~  275 (327)
T 3poz_A          247 DVYMIMVKCWMIDADSRPKFRELIIEFSK  275 (327)
T ss_dssp             HHHHHHHHHTCSCGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            46677789999999999999999998864

>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A*

Probab=93.13  E-value=0.06  Score=38.52  Aligned_cols=28  Identities=21%  Similarity=0.297  Sum_probs=24.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||++.++++.|+.
T Consensus       317 ~~~li~~c~~~dP~~RPt~~eil~~L~~  344 (353)
T 4ase_A          317 MYQTMLDCWHGEPSQRPTFSELVEHLGN  344 (353)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCcChhHCcCHHHHHHHHHH
Confidence            4556678999999999999999988764

>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7

Probab=93.03  E-value=0.091  Score=35.87  Aligned_cols=33  Identities=12%  Similarity=0.012  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           13 EVIRCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        13 ~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      ....+.++...|.+.+|.+||++.++++.|+..
T Consensus       297 ~~~~l~~li~~~l~~dP~~Rps~~ell~~L~~l  329 (337)
T 3mdy_A          297 CLRQMGKLMTECWAHNPASRLTALRVKKTLAKM  329 (337)
T ss_dssp             HHHHHHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhhhChhhCCCHHHHHHHHHHH
Confidence            344577788899999999999999999998753

>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ...

Probab=92.74  E-value=0.08  Score=37.53  Aligned_cols=29  Identities=31%  Similarity=0.399  Sum_probs=25.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       278 ~l~~li~~cl~~dp~~RPs~~~i~~~L~~  306 (373)
T 2qol_A          278 ALYQLMLDCWQKDRNNRPKFEQIVSILDK  306 (373)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhCcChhhCcCHHHHHHHHHH
Confidence            45677789999999999999999999875

>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ...

Probab=92.70  E-value=0.087  Score=35.49  Aligned_cols=29  Identities=14%  Similarity=0.170  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       260 ~l~~li~~~l~~dp~~Rps~~el~~~L~~  288 (295)
T 3ugc_A          260 EIYMIMTECWNNNVNQRPSFRDLALRVDQ  288 (295)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            35567778999999999999999999875

>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A

Probab=92.33  E-value=0.13  Score=34.34  Aligned_cols=29  Identities=7%  Similarity=-0.022  Sum_probs=25.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       249 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~  277 (296)
T 3uzp_A          249 EFATYLNFCRSLRFDDKPDYSYLRQLFRN  277 (296)
T ss_dssp             HHHHHHHHHHTSCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCcCcCCCHHHHHHHHHH
Confidence            35667788999999999999999999875

>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0

Probab=92.33  E-value=0.1  Score=34.60  Aligned_cols=28  Identities=21%  Similarity=0.228  Sum_probs=24.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||++.++++.|+.
T Consensus       243 ~~~li~~~l~~~p~~Rps~~e~l~~L~~  270 (271)
T 3dtc_A          243 FAKLMEDCWNPDPHSRPSFTNILDQLTT  270 (271)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHC
T ss_pred             HHHHHHHHhcCCcccCcCHHHHHHHHhc
Confidence            5566678999999999999999999864

>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens}

Probab=92.29  E-value=0.24  Score=34.36  Aligned_cols=30  Identities=7%  Similarity=0.087  Sum_probs=25.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+-..|.+.+|.+||++.+++..|+..
T Consensus       297 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~~  326 (345)
T 2v62_A          297 EIAQFLVCAHSLAYDEKPNYQALKKILNPH  326 (345)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHCTT
T ss_pred             HHHHHHHHHhhcCcccCCCHHHHHHHHhcc
Confidence            355566789999999999999999999764

>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A

Probab=92.22  E-value=0.13  Score=34.34  Aligned_cols=29  Identities=7%  Similarity=-0.022  Sum_probs=25.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       249 ~l~~li~~~l~~~p~~Rpt~~~l~~~l~~  277 (296)
T 4hgt_A          249 EFATYLNFCRSLRFDDKPDYSYLRQLFRN  277 (296)
T ss_dssp             HHHHHHHHHHTSCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCCCCCHHHHHHHHHH
Confidence            45667778999999999999999999875

>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A*

Probab=92.21  E-value=0.098  Score=35.87  Aligned_cols=29  Identities=14%  Similarity=0.269  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|++.+|.+||++.+++..|+.
T Consensus       279 ~l~~li~~~l~~dP~~Rps~~ell~~L~~  307 (318)
T 3lxp_A          279 EVYHLMKNCWETEASFRPTFENLIPILKT  307 (318)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHH
Confidence            35566778999999999999999999875

>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens}

Probab=92.17  E-value=0.099  Score=36.13  Aligned_cols=30  Identities=37%  Similarity=0.404  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||++.+++..|+..
T Consensus       282 ~l~~li~~~l~~dp~~Rps~~eil~~L~~l  311 (325)
T 3kul_A          282 ALHQLMLDCWHKDRAQRPRFSQIVSVLDAL  311 (325)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            355677889999999999999999999864

>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A*

Probab=92.09  E-value=0.11  Score=35.60  Aligned_cols=30  Identities=23%  Similarity=0.286  Sum_probs=26.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|++.+|.+||++.++++.|+..
T Consensus       272 ~l~~li~~~l~~dP~~Rps~~ell~~L~~~  301 (327)
T 3lxl_A          272 EVHELMKLCWAPSPQDRPSFSALGPQLDML  301 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHC
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            356677789999999999999999999864

>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens}

Probab=92.05  E-value=0.11  Score=35.65  Aligned_cols=30  Identities=7%  Similarity=-0.215  Sum_probs=26.3

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.++++.|+..
T Consensus       287 ~l~~li~~cl~~dP~~Rps~~e~l~~L~~l  316 (336)
T 3g2f_A          287 SLKETIEDCWDQDAEARLTAQXAEERMAEL  316 (336)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCcchHHHHHHHHHH
Confidence            467777899999999999999999998763

>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A*

Probab=92.05  E-value=0.18  Score=33.92  Aligned_cols=29  Identities=24%  Similarity=0.233  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       248 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~  276 (291)
T 1xbb_A          248 EMYDLMNLCWTYDVENRPGFAAVELRLRN  276 (291)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35566678999999999999999999875

>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens}

Probab=91.84  E-value=0.11  Score=35.35  Aligned_cols=29  Identities=17%  Similarity=0.305  Sum_probs=25.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.++++.|+..
T Consensus       252 l~~li~~~l~~dP~~Rps~~~l~~~L~~l  280 (310)
T 3s95_A          252 FFPITVRCCDLDPEKRPSFVKLEHWLETL  280 (310)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            55677889999999999999999998753

>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A*

Probab=91.80  E-value=0.13  Score=34.03  Aligned_cols=29  Identities=10%  Similarity=0.226  Sum_probs=25.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +.++...|.+.+|.+||++.++++.|+..
T Consensus       234 l~~li~~~l~~~p~~Rps~~~ll~~L~~l  262 (268)
T 3sxs_A          234 IYQIMYSCWHELPEKRPTFQQLLSSIEPL  262 (268)
T ss_dssp             HHHHHHHTTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            55666789999999999999999999764

>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A*

Probab=91.80  E-value=0.12  Score=35.80  Aligned_cols=28  Identities=21%  Similarity=0.297  Sum_probs=24.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|++.+|.+||++.+++..|+.
T Consensus       325 l~~li~~~l~~dP~~Rps~~ell~~L~~  352 (359)
T 3vhe_A          325 MYQTMLDCWHGEPSQRPTFSELVEHLGN  352 (359)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCCCHHHHHHHHHH
Confidence            5566678999999999999999999875

>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens}

Probab=91.78  E-value=0.13  Score=35.33  Aligned_cols=29  Identities=14%  Similarity=0.170  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       291 ~l~~li~~cl~~dP~~Rps~~el~~~L~~  319 (326)
T 2w1i_A          291 EIYMIMTECWNNNVNQRPSFRDLALRVDQ  319 (326)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35567778999999999999999999875

>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=91.77  E-value=0.19  Score=34.71  Aligned_cols=29  Identities=28%  Similarity=0.405  Sum_probs=25.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|..||++.+++..|+.
T Consensus       278 ~l~~li~~~l~~~p~~Rps~~~l~~~L~~  306 (333)
T 1mqb_A          278 AIYQLMMQCWQQERARRPKFADIVSILDK  306 (333)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35566778999999999999999999875

>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens}

Probab=91.75  E-value=0.18  Score=34.19  Aligned_cols=29  Identities=17%  Similarity=0.292  Sum_probs=25.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.+++..|+..
T Consensus       276 l~~li~~~l~~dp~~Rps~~~ll~~L~~~  304 (317)
T 2buj_A          276 LWQLLNSMMTVDPHQRPHIPLLLSQLEAL  304 (317)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHhhcChhhCCCHHHHHHHhhhc
Confidence            55566789999999999999999999874

>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ...

Probab=91.67  E-value=0.13  Score=34.55  Aligned_cols=30  Identities=17%  Similarity=0.311  Sum_probs=25.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||++.++++.|+..
T Consensus       257 ~l~~li~~~l~~~p~~Rps~~ell~~L~~l  286 (289)
T 3og7_A          257 RMKRLMAECLKKKRDERPSFPRILAEIEEL  286 (289)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHHH
Confidence            355666789999999999999999999763

>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A*

Probab=91.58  E-value=0.15  Score=34.16  Aligned_cols=29  Identities=3%  Similarity=-0.119  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       252 ~l~~li~~~l~~dp~~RP~~~~l~~~l~~  280 (298)
T 1csn_A          252 EFYKYMHYARNLAFDATPDYDYLQGLFSK  280 (298)
T ss_dssp             HHHHHHHHHHHCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHHHHHHH
Confidence            35567778999999999999999999875

>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A*

Probab=91.49  E-value=0.15  Score=34.32  Aligned_cols=29  Identities=7%  Similarity=0.146  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||++.++++.|+.
T Consensus       271 ~l~~li~~~l~~dp~~Rps~~~ll~~L~~  299 (302)
T 4e5w_A          271 EVYQLMRKCWEFQPSNRTSFQNLIEGFEA  299 (302)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCCCCCCCHHHHHHHHHH
Confidence            35567778999999999999999999875

>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A*

Probab=91.40  E-value=0.14  Score=34.23  Aligned_cols=28  Identities=29%  Similarity=0.287  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||++.++++.|+.
T Consensus       259 l~~li~~~l~~dp~~Rps~~~ll~~L~~  286 (287)
T 4f0f_A          259 LRNVIELCWSGDPKKRPHFSYIVKELSE  286 (287)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHT
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHHHh
Confidence            5566678999999999999999999864

>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A*

Probab=91.40  E-value=0.15  Score=34.41  Aligned_cols=29  Identities=21%  Similarity=0.330  Sum_probs=25.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|++.+|.+||++.++++.|+.
T Consensus       276 ~l~~li~~~l~~dp~~Rps~~ell~~L~~  304 (313)
T 1t46_A          276 EMYDIMKTCWDADPLKRPTFKQIVQLIEK  304 (313)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHH
Confidence            35566678999999999999999999875

>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ...

Probab=91.39  E-value=0.15  Score=33.92  Aligned_cols=29  Identities=24%  Similarity=0.387  Sum_probs=24.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       238 ~l~~li~~~l~~~p~~Rps~~~l~~~l~~  266 (279)
T 1qpc_A          238 ELYQLMRLCWKERPEDRPTFDYLRSVLED  266 (279)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhccChhhCCCHHHHHHHHHH
Confidence            35566678999999999999999998875

>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=91.38  E-value=0.14  Score=33.70  Aligned_cols=28  Identities=21%  Similarity=0.339  Sum_probs=24.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||++.+++..|..
T Consensus       234 l~~li~~~l~~~p~~Rps~~~ll~~L~~  261 (267)
T 3t9t_A          234 VYQIMNHCWRERPEDRPAFSRLLRQLAE  261 (267)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            4566678999999999999999999875

>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=91.22  E-value=0.16  Score=33.64  Aligned_cols=28  Identities=21%  Similarity=0.339  Sum_probs=24.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.++++.|+.
T Consensus       236 ~~~li~~~l~~~p~~Rps~~~ll~~l~~  263 (269)
T 4hcu_A          236 VYQIMNHCWRERPEDRPAFSRLLRQLAE  263 (269)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCCcccCcCHHHHHHHHHH
Confidence            4556678999999999999999999875

>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A*

Probab=91.13  E-value=0.16  Score=33.44  Aligned_cols=29  Identities=28%  Similarity=0.493  Sum_probs=24.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.++++.|+..
T Consensus       240 ~~~li~~~l~~~p~~Rps~~~il~~L~~l  268 (271)
T 3kmu_A          240 VSKLMKICMNEDPAKRPKFDMIVPILEKM  268 (271)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            44556689999999999999999999753

>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ...

Probab=91.12  E-value=0.15  Score=34.23  Aligned_cols=29  Identities=14%  Similarity=0.141  Sum_probs=24.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +.++...|.+.+|.+||++.++++.|+..
T Consensus       261 l~~li~~~l~~~p~~Rps~~ell~~L~~~  289 (298)
T 3f66_A          261 LYEVMLKCWHPKAEMRPSFSELVSRISAI  289 (298)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            55566789999999999999999999763

>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A*

Probab=91.11  E-value=0.16  Score=34.71  Aligned_cols=28  Identities=18%  Similarity=0.237  Sum_probs=24.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|+.
T Consensus       296 l~~li~~~l~~~p~~Rps~~~l~~~L~~  323 (333)
T 2i1m_A          296 IYSIMQACWALEPTHRPTFQQICSFLQE  323 (333)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhccChhhCcCHHHHHHHHHH
Confidence            5566678999999999999999999874

>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A*

Probab=91.06  E-value=0.17  Score=34.29  Aligned_cols=29  Identities=17%  Similarity=0.242  Sum_probs=24.7

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.+++..|+..
T Consensus       267 l~~li~~~l~~dp~~Rps~~~il~~l~~l  295 (310)
T 2wqm_A          267 LRQLVNMCINPDPEKRPDVTYVYDVAKRM  295 (310)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCCCHHHHHHHHHHH
Confidence            55566789999999999999999998753

>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B*

Probab=91.01  E-value=0.17  Score=33.70  Aligned_cols=29  Identities=17%  Similarity=0.188  Sum_probs=25.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.++++.|+..
T Consensus       254 l~~li~~~l~~~p~~Rps~~~l~~~l~~~  282 (291)
T 1u46_A          254 IYNVMVQCWAHKPEDRPTFVALRDFLLEA  282 (291)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCCcccCcCHHHHHHHHHHh
Confidence            55666789999999999999999999764

>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens}

Probab=90.97  E-value=0.15  Score=35.93  Aligned_cols=29  Identities=24%  Similarity=0.186  Sum_probs=25.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.++++.|+..
T Consensus       322 l~~li~~~l~~dP~~Rps~~ell~~L~~~  350 (382)
T 3tt0_A          322 LYMMMRDCWHAVPSQRPTFKQLVEDLDRI  350 (382)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            55666789999999999999999999764

>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A*

Probab=90.95  E-value=0.18  Score=34.07  Aligned_cols=29  Identities=24%  Similarity=0.417  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       280 ~~~~li~~~l~~dp~~Rps~~~l~~~l~~  308 (314)
T 2ivs_A          280 EMYRLMLQCWKQEPDKRPVFADISKDLEK  308 (314)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            35566678999999999999999999875

>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens}

Probab=90.69  E-value=0.24  Score=34.36  Aligned_cols=28  Identities=11%  Similarity=0.061  Sum_probs=24.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|+.
T Consensus       306 l~~li~~~l~~dp~~Rps~~~l~~~L~~  333 (352)
T 2jii_A          306 LQKYLKVVMALTYEEKPPYAMLRNNLEA  333 (352)
T ss_dssp             HHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhCChhhCCCHHHHHHHHHH
Confidence            4556678999999999999999999875

>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A*

Probab=90.68  E-value=0.17  Score=35.69  Aligned_cols=28  Identities=25%  Similarity=0.299  Sum_probs=24.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|+.
T Consensus       344 l~~li~~cl~~dP~~Rps~~~i~~~L~~  371 (377)
T 3cbl_A          344 VFRLMEQCWAYEPGQRPSFSTIYQELQS  371 (377)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCchhCcCHHHHHHHHHH
Confidence            4456678999999999999999999875

>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ...

Probab=90.57  E-value=0.36  Score=35.02  Aligned_cols=29  Identities=24%  Similarity=0.433  Sum_probs=25.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       410 l~~li~~cl~~dP~~Rpt~~~l~~~L~~~  438 (452)
T 1fmk_A          410 LHDLMCQCWRKEPEERPTFEYLQAFLEDY  438 (452)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHTT
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            45566789999999999999999999864

>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ...

Probab=90.57  E-value=0.2  Score=33.39  Aligned_cols=28  Identities=21%  Similarity=0.329  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.++++.|+.
T Consensus       241 l~~li~~~l~~dp~~Rps~~~~~~~l~~  268 (288)
T 3kfa_A          241 VYELMRACWQWNPSDRPSFAEIHQAFET  268 (288)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhCCChhhCcCHHHHHHHHHH
Confidence            5566678999999999999999998864

>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A*

Probab=90.57  E-value=0.19  Score=33.51  Aligned_cols=28  Identities=18%  Similarity=0.082  Sum_probs=24.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+-..|.+.+|.+||++.+++..|+.
T Consensus       243 l~~li~~~l~~~p~~Rps~~~l~~~L~~  270 (278)
T 1byg_A          243 VYEVMKNCWHLDAAMRPSFLQLREQLEH  270 (278)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhcCChhhCCCHHHHHHHHHH
Confidence            4455678999999999999999999875

>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A*

Probab=90.55  E-value=0.2  Score=33.38  Aligned_cols=28  Identities=25%  Similarity=0.328  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|+.
T Consensus       243 l~~li~~~l~~~p~~Rps~~ell~~L~~  270 (281)
T 3cc6_A          243 LYTLMTRCWDYDPSDRPRFTELVCSLSD  270 (281)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCCchhCcCHHHHHHHHHH
Confidence            5556678999999999999999998864

>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A

Probab=90.48  E-value=0.21  Score=33.26  Aligned_cols=28  Identities=7%  Similarity=0.116  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|..
T Consensus       250 l~~li~~~l~~~p~~Rps~~~ll~~L~~  277 (283)
T 3gen_A          250 VYTIMYSCWHEKADERPTFKILLSNILD  277 (283)
T ss_dssp             HHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhHCcCHHHHHHHHHH
Confidence            5566678999999999999999998864

>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ...

Probab=90.46  E-value=0.19  Score=33.92  Aligned_cols=28  Identities=21%  Similarity=0.297  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|+.
T Consensus       280 l~~li~~~l~~dp~~Rps~~ell~~L~~  307 (316)
T 2xir_A          280 MYQTMLDCWHGEPSQRPTFSELVEHLGN  307 (316)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            5556678999999999999999998875

>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7

Probab=90.43  E-value=0.19  Score=33.58  Aligned_cols=29  Identities=21%  Similarity=0.221  Sum_probs=24.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       257 l~~li~~~l~~~p~~Rps~~~ll~~l~~~  285 (298)
T 3pls_A          257 LYQVMQQCWEADPAVRPTFRVLVGEVEQI  285 (298)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            55666789999999999999999998753

>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B

Probab=90.33  E-value=0.2  Score=36.31  Aligned_cols=30  Identities=23%  Similarity=0.432  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       413 ~l~~li~~cl~~dp~~RPt~~~i~~~L~~~  442 (454)
T 1qcf_A          413 ELYNIMMRCWKNRPEERPTFEYIQSVLDDF  442 (454)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHHH
Confidence            355667889999999999999999999864

>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A*

Probab=90.21  E-value=0.21  Score=33.39  Aligned_cols=28  Identities=18%  Similarity=0.216  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|+.
T Consensus       246 l~~li~~~l~~~p~~Rps~~~l~~~l~~  273 (281)
T 1mp8_A          246 LYSLMTKCWAYDPSRRPRFTELKAQLST  273 (281)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            4556678999999999999999999875

>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7

Probab=90.09  E-value=0.21  Score=34.16  Aligned_cols=30  Identities=30%  Similarity=0.367  Sum_probs=25.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       304 ~l~~li~~~l~~~p~~Rps~~~~~~~L~~~  333 (343)
T 1luf_A          304 ELYNLMRLCWSKLPADRPSFCSIHRILQRM  333 (343)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcccCcccCCCHHHHHHHHHHH
Confidence            355666789999999999999999999864

>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A

Probab=90.00  E-value=0.22  Score=36.66  Aligned_cols=30  Identities=20%  Similarity=0.335  Sum_probs=25.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||++.++++.|+..
T Consensus       447 ~l~~li~~cl~~dP~~RPs~~el~~~L~~~  476 (495)
T 1opk_A          447 KVYELMRACWQWNPSDRPSFAEIHQAFETM  476 (495)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHHcCcChhHCcCHHHHHHHHHHH
Confidence            345566789999999999999999999764

>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ...

Probab=89.85  E-value=0.23  Score=34.19  Aligned_cols=29  Identities=24%  Similarity=0.186  Sum_probs=24.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       288 l~~li~~~l~~dp~~Rps~~ell~~L~~l  316 (334)
T 2pvf_A          288 LYMMMRDCWHAVPSQRPTFKQLVEDLDRI  316 (334)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            45566789999999999999999998753

>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A*

Probab=89.82  E-value=0.21  Score=34.31  Aligned_cols=29  Identities=10%  Similarity=0.017  Sum_probs=24.6

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       246 ~~~li~~~l~~dp~~Rps~~el~~~l~~~  274 (325)
T 3kex_A          246 VYMVMVKCWMIDENIRPTFKELANEFTRM  274 (325)
T ss_dssp             TTHHHHHHTCSCTTTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            44566789999999999999999998753

>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A*

Probab=89.81  E-value=0.24  Score=33.59  Aligned_cols=30  Identities=27%  Similarity=0.417  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|++.+|..||++.+++..|+..
T Consensus       277 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~l  306 (313)
T 3brb_A          277 ELYEIMYSCWRTDPLDRPTFSVLRLQLEKL  306 (313)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            355666789999999999999999998753

>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A*

Probab=89.74  E-value=0.23  Score=34.01  Aligned_cols=29  Identities=24%  Similarity=0.216  Sum_probs=24.7

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.++++.|+..
T Consensus       268 l~~li~~~l~~dP~~Rps~~~ll~~L~~~  296 (309)
T 3p86_A          268 VAAIIEGCWTNEPWKRPSFATIMDLLRPL  296 (309)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            45566789999999999999999998763

>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A*

Probab=89.67  E-value=0.18  Score=33.64  Aligned_cols=29  Identities=21%  Similarity=0.266  Sum_probs=24.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.++++.|+..
T Consensus       245 l~~li~~~l~~dp~~Rps~~~ll~~l~~l  273 (289)
T 4fvq_A          245 LANLINNCMDYEPDHRPSFRAIIRDLNSL  273 (289)
T ss_dssp             THHHHHHHSCSSGGGSCCHHHHHHHHHTC
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            44566789999999999999999999863

>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens}

Probab=89.56  E-value=0.24  Score=34.13  Aligned_cols=29  Identities=10%  Similarity=0.139  Sum_probs=24.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.+++..|...
T Consensus       248 l~~li~~~l~~dp~~Rps~~ell~~L~~~  276 (327)
T 3lzb_A          248 VYMIMRKCWMIDADSRPKFRELIIEFSKM  276 (327)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            55566789999999999999999998753

>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus}

Probab=89.46  E-value=0.28  Score=33.36  Aligned_cols=30  Identities=17%  Similarity=0.313  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|++.+|.+||++.++++.|+..
T Consensus       267 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~~  296 (323)
T 3qup_A          267 EVYDLMYQCWSADPKQRPSFTCLRMELENI  296 (323)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            456677889999999999999999998753

>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens}

Probab=89.42  E-value=0.25  Score=34.79  Aligned_cols=28  Identities=21%  Similarity=0.312  Sum_probs=24.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.++++.|+.
T Consensus       315 l~~li~~~l~~dP~~Rps~~eil~~l~~  342 (367)
T 3l9p_A          315 VYRIMTQCWQHQPEDRPNFAIILERIEY  342 (367)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            5567788999999999999999998864

>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ...

Probab=89.28  E-value=0.31  Score=33.08  Aligned_cols=29  Identities=14%  Similarity=0.214  Sum_probs=24.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+-..|++.+|..||++.+++..|+..
T Consensus       269 l~~li~~~l~~dp~~Rps~~e~l~~L~~~  297 (322)
T 1p4o_A          269 LFELMRMCWQYNPKMRPSFLEIISSIKEE  297 (322)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHcCCCcccCcCHHHHHHHHHHh
Confidence            45566789999999999999999999764

>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A

Probab=88.95  E-value=0.28  Score=34.57  Aligned_cols=29  Identities=24%  Similarity=0.198  Sum_probs=24.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       333 ~l~~li~~~l~~dP~~Rpt~~ell~~L~~  361 (370)
T 2psq_A          333 ELYMMMRDCWHAVPSQRPTFKQLVEDLDR  361 (370)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            34556678999999999999999999875

>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A*

Probab=88.89  E-value=0.29  Score=33.47  Aligned_cols=28  Identities=21%  Similarity=0.312  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|..
T Consensus       274 l~~li~~~l~~dp~~Rps~~~ll~~l~~  301 (327)
T 2yfx_A          274 VYRIMTQCWQHQPEDRPNFAIILERIEY  301 (327)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHHHH
Confidence            4566678999999999999999998864

>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7

Probab=88.87  E-value=0.32  Score=33.39  Aligned_cols=30  Identities=13%  Similarity=0.071  Sum_probs=25.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|++.+|.+||++.+++..|...
T Consensus       303 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~~  332 (344)
T 1rjb_A          303 EIYIIMQSCWAFDSRKRPSFPNLTSFLGCQ  332 (344)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHHH
Confidence            355566789999999999999999999764

>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B*

Probab=88.72  E-value=0.34  Score=32.08  Aligned_cols=29  Identities=24%  Similarity=0.323  Sum_probs=24.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.+++..|...
T Consensus       244 ~~~li~~~l~~dp~~Rps~~e~l~~l~~~  272 (284)
T 2a19_B          244 EKTLLQKLLSKKPEDRPNTSEILRTLTVW  272 (284)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            34556789999999999999999998764

>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=88.69  E-value=0.32  Score=32.54  Aligned_cols=28  Identities=14%  Similarity=-0.047  Sum_probs=24.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|..
T Consensus       242 l~~li~~~l~~~p~~Rps~~~l~~~l~~  269 (287)
T 1u59_A          242 LYALMSDCWIYKWEDRPDFLTVEQRMRA  269 (287)
T ss_dssp             HHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            4456678999999999999999998875

>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A

Probab=88.55  E-value=0.44  Score=33.22  Aligned_cols=28  Identities=14%  Similarity=0.055  Sum_probs=23.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|+.
T Consensus       299 ~~~li~~cl~~~p~~RP~~~~l~~~l~~  326 (364)
T 3op5_A          299 IAKYMETVKLLDYTEKPLYENLRDILLQ  326 (364)
T ss_dssp             HHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHhcCCCCCCCCHHHHHHHHHH
Confidence            4556678999999999999999998864

>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7

Probab=88.48  E-value=0.31  Score=34.50  Aligned_cols=29  Identities=14%  Similarity=0.141  Sum_probs=24.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.++++.|+..
T Consensus       325 l~~li~~cl~~dp~~RPs~~ell~~L~~i  353 (373)
T 3c1x_A          325 LYEVMLKCWHPKAEMRPSFSELVSRISAI  353 (373)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            45566789999999999999999999763

>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A*

Probab=87.80  E-value=0.38  Score=32.86  Aligned_cols=28  Identities=25%  Similarity=0.406  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|++.+|.+||++.+++..|..
T Consensus       270 l~~li~~~l~~dp~~Rps~~ell~~L~~  297 (327)
T 1fvr_A          270 VYDLMRQCWREKPYERPSFAQILVSLNR  297 (327)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            4556678999999999999999998875

>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens}

Probab=87.62  E-value=0.54  Score=35.65  Aligned_cols=29  Identities=14%  Similarity=-0.041  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       567 ~l~~li~~cl~~dP~~RPs~~~l~~~L~~  595 (613)
T 2ozo_A          567 ELYALMSDCWIYKWEDRPDFLTVEQRMRA  595 (613)
T ss_dssp             HHHHHHHHTTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35566788999999999999999999875

>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group}

Probab=86.85  E-value=0.6  Score=34.53  Aligned_cols=29  Identities=7%  Similarity=-0.050  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++.+|+.
T Consensus       247 ~l~~li~~cl~~dP~~RPs~~el~~~L~~  275 (483)
T 3sv0_A          247 EFASYFHYCRSLRFDDKPDYSYLKRLFRD  275 (483)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHH
Confidence            46677788999999999999999988763

>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7

Probab=86.75  E-value=0.85  Score=33.86  Aligned_cols=29  Identities=24%  Similarity=0.433  Sum_probs=25.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+-..|.+.+|.+||++.+++..|+..
T Consensus       493 l~~li~~cl~~dP~~RPt~~~l~~~L~~~  521 (535)
T 2h8h_A          493 LHDLMCQCWRKEPEERPTFEYLQAFLEDY  521 (535)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            45566789999999999999999999864

>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens}

Probab=86.73  E-value=0.37  Score=32.62  Aligned_cols=29  Identities=17%  Similarity=0.228  Sum_probs=24.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|++.+|.+||++.++++.|...
T Consensus       278 ~~~li~~~l~~~p~~Rps~~e~l~~l~~~  306 (337)
T 3ll6_A          278 FHSLIRAMLQVNPEERLSIAEVVHQLQEI  306 (337)
T ss_dssp             GHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            44566789999999999999999998753

>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A

Probab=86.70  E-value=0.45  Score=34.43  Aligned_cols=28  Identities=18%  Similarity=0.127  Sum_probs=24.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++-..|.+.+|.+||++.+++..|+.
T Consensus       415 l~~li~~cl~~dp~~Rpt~~~l~~~L~~  442 (450)
T 1k9a_A          415 VYDVMKNCWHLDAATRPTFLQLREQLEH  442 (450)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            4455678999999999999999998875

>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A*

Probab=86.31  E-value=0.74  Score=35.12  Aligned_cols=28  Identities=25%  Similarity=0.236  Sum_probs=24.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+++..|+.
T Consensus       601 l~~li~~cl~~dP~~RPs~~~l~~~L~~  628 (635)
T 4fl3_A          601 MYDLMNLCWTYDVENRPGFAAVELRLRN  628 (635)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            4556678999999999999999999875

>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A*

Probab=85.05  E-value=0.67  Score=31.69  Aligned_cols=28  Identities=11%  Similarity=0.005  Sum_probs=24.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.++++.|+
T Consensus       250 ~~~~li~~~l~~~p~~RP~~~~l~~~l~  277 (330)
T 2izr_A          250 EMATYLRYVRRLDFFEKPDYDYLRKLFT  277 (330)
T ss_dssp             HHHHHHHHHHHCCTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCCCCCHHHHHHHHH
Confidence            4556677899999999999999999886

>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens}

Probab=84.51  E-value=0.79  Score=30.84  Aligned_cols=24  Identities=13%  Similarity=0.187  Sum_probs=20.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.++++
T Consensus       261 ~~~li~~~L~~dP~~Rpt~~ell~  284 (311)
T 4agu_A          261 ALGLLKGCLHMDPTERLTCEQLLH  284 (311)
T ss_dssp             HHHHHHHHCCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhcCCHHHHhc
Confidence            556778899999999999999874

>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii}

Probab=83.94  E-value=0.82  Score=30.58  Aligned_cols=24  Identities=25%  Similarity=0.409  Sum_probs=20.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       255 ~~~li~~~L~~dP~~Rps~~e~l~  278 (285)
T 3is5_A          255 AVDLLKQMLTKDPERRPSAAQVLH  278 (285)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCcCHHHHhc
Confidence            445667899999999999999874

>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens}

Probab=83.52  E-value=0.89  Score=31.35  Aligned_cols=24  Identities=13%  Similarity=0.246  Sum_probs=20.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       250 l~~li~~~L~~dp~~Rpt~~e~l~  273 (343)
T 3dbq_A          250 LQDVLKCCLKRDPKQRISIPELLA  273 (343)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHcCCChhHCCCHHHHHh
Confidence            456667899999999999999975

>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens}

Probab=83.13  E-value=0.97  Score=30.71  Aligned_cols=25  Identities=12%  Similarity=0.212  Sum_probs=20.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      .+..+...|++.+|.+||++.++++
T Consensus       280 ~l~~li~~~L~~dP~~Rpt~~ell~  304 (311)
T 3p1a_A          280 ELRSVLVMMLEPDPKLRATAEALLA  304 (311)
T ss_dssp             HHHHHHHHHSCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHh
Confidence            3556677899999999999998874

>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A*

Probab=83.11  E-value=0.55  Score=31.06  Aligned_cols=27  Identities=11%  Similarity=-0.049  Sum_probs=22.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      +..+-..|++.+|.+||++.+++..+.
T Consensus       244 l~~li~~~l~~~p~~Rps~~~ll~~~~  270 (279)
T 2w5a_A          244 LNEIITRMLNLKDYHRPSVEEILENPL  270 (279)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHTSTT
T ss_pred             HHHHHHHHcCCCcccCCCHHHHHhChh
Confidence            455667899999999999999987664

>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A*

Probab=82.83  E-value=0.98  Score=31.29  Aligned_cols=29  Identities=17%  Similarity=0.110  Sum_probs=23.8

Q ss_pred             HHHHHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           12 NEVIRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        12 ~~l~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..-..+..+...|++.+|.+||++.++++
T Consensus       363 ~~~~~~~~li~~~L~~dP~~Rpt~~e~l~  391 (397)
T 1wak_A          363 EEAAGFTDFLLPMLELIPEKRATAAECLR  391 (397)
T ss_dssp             HHHHHHHHHHGGGGCSSGGGSCCHHHHHT
T ss_pred             hhHHHHHHHHHHHhccChhhcCCHHHHhh
Confidence            33456777888999999999999998874

>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens}

Probab=82.48  E-value=1.2  Score=29.91  Aligned_cols=24  Identities=25%  Similarity=0.509  Sum_probs=20.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       260 ~~~li~~~l~~~p~~Rps~~e~l~  283 (312)
T 2iwi_A          260 CCALIRRCLAPKPSSRPSLEEILL  283 (312)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHhc
Confidence            455667899999999999999986

>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A*

Probab=82.06  E-value=1.1  Score=30.21  Aligned_cols=24  Identities=13%  Similarity=0.246  Sum_probs=20.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       269 l~~li~~~l~~dp~~Rps~~ell~  292 (313)
T 3cek_A          269 LQDVLKCCLKRDPKQRISIPELLA  292 (313)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCCcccCcCHHHHhc
Confidence            445566899999999999999875

>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A*

Probab=82.02  E-value=0.89  Score=30.66  Aligned_cols=26  Identities=19%  Similarity=0.189  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           15 IRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        15 ~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ..+..+...|++.+|.+||++.++++
T Consensus       303 ~~l~~li~~~L~~dP~~Rpt~~ell~  328 (339)
T 1z57_A          303 ERLFDLIQKMLEYDPAKRITLREALK  328 (339)
T ss_dssp             HHHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHHHhCcCcccccCHHHHhc
Confidence            45667778999999999999998863

>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A*

Probab=82.02  E-value=0.95  Score=29.81  Aligned_cols=24  Identities=17%  Similarity=0.238  Sum_probs=20.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       238 l~~li~~~l~~~p~~Rps~~~~l~  261 (276)
T 2h6d_A          238 VATLLMHMLQVDPLKRATIKDIRE  261 (276)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHccCChhhCCCHHHHHh
Confidence            455667899999999999999976

>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A

Probab=81.87  E-value=0.96  Score=29.96  Aligned_cols=24  Identities=25%  Similarity=0.314  Sum_probs=20.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       260 ~~~li~~~l~~dp~~Rps~~~ll~  283 (303)
T 1zy4_A          260 EKKIIRLLIDHDPNKRPGARTLLN  283 (303)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHHhcCcccCcCHHHHhC
Confidence            455667899999999999998875

>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens}

Probab=81.62  E-value=1.2  Score=29.50  Aligned_cols=24  Identities=17%  Similarity=0.259  Sum_probs=19.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|.+.+|.+||++.+++.
T Consensus       255 ~~~li~~~l~~dp~~Rps~~~ll~  278 (295)
T 2clq_A          255 AKAFILKCFEPDPDKRACANDLLV  278 (295)
T ss_dssp             HHHHHHHTTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCCCHHHHhc
Confidence            445667899999999999998874

>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A*

Probab=81.48  E-value=0.74  Score=30.24  Aligned_cols=24  Identities=21%  Similarity=0.365  Sum_probs=19.6

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+-..|++.+|.+||++.++++
T Consensus       256 ~~~li~~~l~~dp~~Rps~~~ll~  279 (289)
T 1x8b_A          256 FTELLKVMIHPDPERRPSAMALVK  279 (289)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHhCCCcccCCCHHHHhh
Confidence            445566899999999999988764

>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A

Probab=81.44  E-value=0.59  Score=31.03  Aligned_cols=24  Identities=13%  Similarity=0.322  Sum_probs=20.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.++++
T Consensus       243 ~~~li~~~l~~~p~~Rpt~~e~l~  266 (290)
T 3fme_A          243 FVDFTSQCLKKNSKERPTYPELMQ  266 (290)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHhhcChhhCcCHHHHHh
Confidence            455667899999999999999865

>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A*

Probab=81.24  E-value=1.5  Score=30.76  Aligned_cols=27  Identities=15%  Similarity=0.098  Sum_probs=22.5

Q ss_pred             HHHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           14 VIRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        14 l~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      ...+..+-..|++.+|.+||++.++++
T Consensus       346 ~~~~~dli~~mL~~dP~~Rpta~e~L~  372 (382)
T 2vx3_A          346 YLKFKDLILRMLDYDPKTRIQPYYALQ  372 (382)
T ss_dssp             HHHHHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             hHHHHHHHHHhcCCChhhCCCHHHHhc
Confidence            345677788999999999999998864

>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A

Probab=80.93  E-value=1.7  Score=29.82  Aligned_cols=27  Identities=15%  Similarity=0.075  Sum_probs=22.8

Q ss_pred             HHHHHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           14 VIRCMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        14 l~~~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      -..+..+-..|++.+|.+||++.+++.
T Consensus       307 ~~~~~~li~~~L~~dP~~Rpt~~ell~  333 (373)
T 1q8y_A          307 AKEISDFLSPMLQLDPRKRADAGGLVN  333 (373)
T ss_dssp             HHHHHHHHGGGGCSSTTTCBCHHHHHT
T ss_pred             HHHHHHHHHHHhccCccccCCHHHHhh
Confidence            345667778999999999999999875

>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A*

Probab=80.89  E-value=1.2  Score=31.47  Aligned_cols=24  Identities=13%  Similarity=0.246  Sum_probs=20.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       297 ~~~li~~~L~~dP~~Rps~~ell~  320 (390)
T 2zmd_A          297 LQDVLKCCLKRDPKQRISIPELLA  320 (390)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHcccChhhCCCHHHHhh
Confidence            455667899999999999999974

>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A*

Probab=80.81  E-value=1.1  Score=34.35  Aligned_cols=29  Identities=17%  Similarity=0.206  Sum_probs=24.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|..
T Consensus       620 ~l~~li~~~l~~dP~~RPs~~el~~~L~~  648 (656)
T 2j0j_A          620 TLYSLMTKCWAYDPSRRPRFTELKAQLST  648 (656)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35566678999999999999999998875

>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens}

Probab=80.72  E-value=1.6  Score=29.17  Aligned_cols=24  Identities=17%  Similarity=0.062  Sum_probs=20.5

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.++++
T Consensus       240 l~~li~~~l~~dp~~Rps~~~ll~  263 (305)
T 2wtk_C          240 LSDLLKGMLEYEPAKRFSIRQIRQ  263 (305)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHccCChhhCCCHHHHhc
Confidence            445667899999999999999985

>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A*

Probab=80.47  E-value=0.91  Score=30.21  Aligned_cols=24  Identities=33%  Similarity=0.473  Sum_probs=20.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.++++
T Consensus       264 ~~~li~~~l~~dp~~Rps~~~ll~  287 (303)
T 2vwi_A          264 FRKMISLCLQKDPEKRPTAAELLR  287 (303)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCcCHHHHhh
Confidence            455667899999999999998874

>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A

Probab=80.38  E-value=1.8  Score=29.10  Aligned_cols=24  Identities=13%  Similarity=0.097  Sum_probs=20.6

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+-..|++.+|.+||++.++++
T Consensus       272 ~~~li~~~L~~dP~~Rps~~e~l~  295 (316)
T 2ac3_A          272 AKDLISKLLVRDAKQRLSAAQVLQ  295 (316)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHhhCChhhCCCHHHHhc
Confidence            556777899999999999998875

>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens}

Probab=80.36  E-value=1  Score=30.19  Aligned_cols=24  Identities=17%  Similarity=0.130  Sum_probs=20.0

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHH
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVL   40 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~   40 (97)
                      +..+...|++.+|.+||++.+++.
T Consensus       260 l~~li~~~l~~dp~~Rps~~~ll~  283 (318)
T 2dyl_A          260 FQSFVKDCLTKDHRKRPKYNKLLE  283 (318)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             HHHHHHHHccCChhHCcCHHHHhh
Confidence            445667899999999999999864

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	97
d1fmka3	285	c-src tyrosine kinase {Human (Homo sapiens) [TaxId	95.94
d1mqba_	283	epha2 receptor tyrosine kinase {Human (Homo sapien	95.65
d1sm2a_	263	Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie	95.46
d1lufa_	301	Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax	95.33
d1p4oa_	308	Insulin-like growth factor 1 receptor {Human (Homo	95.2
d1t46a_	311	c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]	95.12
d1vjya_	303	Type I TGF-beta receptor R4 {Human (Homo sapiens)	95.09
d1qpca_	272	Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax	95.09
d1jpaa_	299	ephb2 receptor tyrosine kinase {Mouse (Mus musculu	95.07
d1r0pa_	311	Hepatocyte growth factor receptor, c-MET {Human (H	95.07
d1fgka_	299	Fibroblast growth factor receptor 1 {Human (Homo s	94.98
d1uwha_	276	B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}	94.51
d1fvra_	309	Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}	94.4
d1byga_	262	Carboxyl-terminal src kinase (csk) {Human (Homo sa	94.08
d1opja_	287	Abelsone tyrosine kinase (abl) {Mouse (Mus musculu	94.07
d1ywna1	299	Vascular endothelial growth factor receptor 2 (kdr	94.03
d1xbba_	277	Tyrosine-protein kinase SYK {Human (Homo sapiens)	93.99
d1rjba_	325	Fl cytokine receptor {Human (Homo sapiens) [TaxId:	93.58
d1u46a_	273	Activated CDC42 kinase 1, ACK1 {Human (Homo sapien	93.36
d1u59a_	285	Tyrosine-protein kinase ZAP-70 {Human (Homo sapien	93.16
d1xkka_	317	EGF receptor tyrosine kinase, Erbb-1 {Human (Homo	92.51
d1k2pa_	258	Bruton's tyrosine kinase (Btk) {Human (Homo sapien	92.15
d1mp8a_	273	Focal adhesion kinase 1 (fak) {Human (Homo sapiens	91.69

>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.94  E-value=0.0047  Score=41.21  Aligned_cols=30  Identities=23%  Similarity=0.417  Sum_probs=26.0

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||+|.+|+.+|+..
T Consensus       242 ~l~~li~~cl~~dP~~Rps~~~i~~~L~~~  271 (285)
T d1fmka3         242 SLHDLMCQCWRKEPEERPTFEYLQAFLEDY  271 (285)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHcccCHhHCcCHHHHHHHHhhh
Confidence            355677899999999999999999999864

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.65  E-value=0.0056  Score=40.48  Aligned_cols=29  Identities=28%  Similarity=0.405  Sum_probs=25.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++..+|.+.+|.+||+|.+|++.|+.
T Consensus       241 ~l~~li~~cl~~~p~~RPt~~eil~~L~~  269 (283)
T d1mqba_         241 AIYQLMMQCWQQERARRPKFADIVSILDK  269 (283)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHCcCCHhHCcCHHHHHHHHHH
Confidence            46677789999999999999999999875

>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.46  E-value=0.0044  Score=40.60  Aligned_cols=29  Identities=17%  Similarity=0.312  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||+|.++++.|+.
T Consensus       230 ~l~~li~~cl~~~p~~Rps~~~il~~L~~  258 (263)
T d1sm2a_         230 HVYQIMNHCWKERPEDRPAFSRLLRQLAE  258 (263)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHHHH
Confidence            45667789999999999999999999875

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Musk tyrosine kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.33  E-value=0.0053  Score=40.90  Aligned_cols=30  Identities=30%  Similarity=0.367  Sum_probs=26.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+..+...|.+.+|.+||+|.+|+++|+..
T Consensus       270 ~~~~li~~cl~~~P~~RPt~~ev~~~L~~i  299 (301)
T d1lufa_         270 ELYNLMRLCWSKLPADRPSFCSIHRILQRM  299 (301)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            466778899999999999999999999864

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Insulin-like growth factor 1 receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.20  E-value=0.0062  Score=40.77  Aligned_cols=30  Identities=13%  Similarity=0.189  Sum_probs=26.2

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||+|.+|++.|+..
T Consensus       263 ~l~~li~~cl~~~P~~RPs~~~il~~L~~~  292 (308)
T d1p4oa_         263 MLFELMRMCWQYNPKMRPSFLEIISSIKEE  292 (308)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            466677889999999999999999999764

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-KIT receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.12  E-value=0.0069  Score=40.54  Aligned_cols=29  Identities=21%  Similarity=0.330  Sum_probs=25.4

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++..+|.+.+|.+||++.+++++|++
T Consensus       276 ~l~~Li~~cl~~dP~~RPs~~~il~~L~~  304 (311)
T d1t46a_         276 EMYDIMKTCWDADPLKRPTFKQIVQLIEK  304 (311)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35566788999999999999999999975

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Type I TGF-beta receptor R4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.09  E-value=0.0084  Score=40.05  Aligned_cols=33  Identities=12%  Similarity=-0.071  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           12 NEVIRCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        12 ~~l~~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.+..+..+...|.+.+|.+||++.+|++.|..
T Consensus       262 ~~~~~l~~li~~cl~~dp~~Rps~~ei~~~L~~  294 (303)
T d1vjya_         262 EALRVMAKIMRECWYANGAARLTALRIKKTLSQ  294 (303)
T ss_dssp             HHHHHHHHHHHTTCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            344567788899999999999999999998864

>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.09  E-value=0.0071  Score=39.76  Aligned_cols=28  Identities=25%  Similarity=0.396  Sum_probs=24.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||+|.+|++.|+.
T Consensus       239 l~~li~~cl~~~P~~Rpt~~ei~~~L~~  266 (272)
T d1qpca_         239 LYQLMRLCWKERPEDRPTFDYLRSVLED  266 (272)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHhhh
Confidence            5566778999999999999999998864

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.07  E-value=0.011  Score=39.42  Aligned_cols=29  Identities=31%  Similarity=0.326  Sum_probs=25.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       261 ~l~~li~~cl~~~P~~RPs~~ei~~~L~~  289 (299)
T d1jpaa_         261 ALHQLMLDCWQKDRNHRPKFGQIVNTLDK  289 (299)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            35567789999999999999999999875

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Hepatocyte growth factor receptor, c-MET
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.07  E-value=0.0067  Score=40.81  Aligned_cols=30  Identities=13%  Similarity=0.127  Sum_probs=25.8

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||+|.+|++.|+..
T Consensus       262 ~l~~li~~cl~~dP~~RPs~~ei~~~L~~i  291 (311)
T d1r0pa_         262 PLYEVMLKCWHPKAEMRPSFSELVSRISAI  291 (311)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            355677899999999999999999998764

>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fibroblast growth factor receptor 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.98  E-value=0.0074  Score=40.15  Aligned_cols=30  Identities=23%  Similarity=0.184  Sum_probs=26.1

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++..+|.+.+|.+||++.+|+++|++.
T Consensus       265 ~l~~li~~cl~~dP~~Rps~~eil~~L~~i  294 (299)
T d1fgka_         265 ELYMMMRDCWHAVPSQRPTFKQLVEDLDRI  294 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHHHHH
Confidence            356677899999999999999999999763

>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.51  E-value=0.0093  Score=39.40  Aligned_cols=29  Identities=17%  Similarity=0.324  Sum_probs=24.8

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       242 l~~li~~cl~~dp~~RPt~~~il~~Le~l  270 (276)
T d1uwha_         242 MKRLMAECLKKKRDERPLFPQILASIELL  270 (276)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            45566789999999999999999998753

>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tie2 kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.40  E-value=0.012  Score=39.18  Aligned_cols=29  Identities=24%  Similarity=0.390  Sum_probs=24.6

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      +..+...|.+.+|.+||+|.+|+..|+..
T Consensus       255 ~~~li~~cl~~dP~~RPs~~eil~~L~~i  283 (309)
T d1fvra_         255 VYDLMRQCWREKPYERPSFAQILVSLNRM  283 (309)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            44556789999999999999999988753

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Carboxyl-terminal src kinase (csk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.08  E-value=0.016  Score=37.93  Aligned_cols=28  Identities=18%  Similarity=0.082  Sum_probs=24.2

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++-..|.+.+|.+||++.+++++|+.
T Consensus       229 ~~~li~~cl~~dP~~Rps~~~l~~~L~~  256 (262)
T d1byga_         229 VYEVMKNCWHLDAAMRPSFLQLREQLEH  256 (262)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            4455678999999999999999999875

>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.07  E-value=0.017  Score=38.18  Aligned_cols=30  Identities=20%  Similarity=0.335  Sum_probs=25.6

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhhc
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDSY   45 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~~   45 (97)
                      .+.++...|.+.+|.+||++.++++.|+..
T Consensus       244 ~l~~li~~cl~~dP~~Rps~~ei~~~L~~~  273 (287)
T d1opja_         244 KVYELMRACWQWNPSDRPSFAEIHQAFETM  273 (287)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            355677889999999999999999998753

>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Vascular endothelial growth factor receptor 2 (kdr)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.03  E-value=0.017  Score=38.15  Aligned_cols=29  Identities=21%  Similarity=0.291  Sum_probs=24.9

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+.++...|.+.+|.+||++.++++.|+.
T Consensus       265 ~l~~li~~cl~~dP~~Rpt~~eil~~L~~  293 (299)
T d1ywna1         265 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  293 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35567789999999999999999998864

>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase SYK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.99  E-value=0.026  Score=37.12  Aligned_cols=28  Identities=25%  Similarity=0.236  Sum_probs=23.9

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+|+..|+.
T Consensus       239 ~~~li~~cl~~dp~~RPs~~~i~~~L~~  266 (277)
T d1xbba_         239 MYDLMNLCWTYDVENRPGFAAVELRLRN  266 (277)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHhhC
Confidence            4456678999999999999999988864

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.58  E-value=0.023  Score=38.08  Aligned_cols=28  Identities=14%  Similarity=0.092  Sum_probs=24.1

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.++++.|..
T Consensus       296 l~~li~~cl~~dP~~RPt~~ei~~~L~~  323 (325)
T d1rjba_         296 IYIIMQSCWAFDSRKRPSFPNLTSFLGC  323 (325)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHhC
Confidence            4556678999999999999999999853

>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Activated CDC42 kinase 1, ACK1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.36  E-value=0.025  Score=37.08  Aligned_cols=28  Identities=18%  Similarity=0.221  Sum_probs=24.4

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +.++...|.+.+|.+||++.+++..|+.
T Consensus       244 l~~li~~cl~~dp~~RPt~~ei~~~L~~  271 (273)
T d1u46a_         244 IYNVMVQCWAHKPEDRPTFVALRDFLLE  271 (273)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            5567788999999999999999998864

>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase ZAP-70
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.16  E-value=0.029  Score=37.12  Aligned_cols=28  Identities=14%  Similarity=-0.047  Sum_probs=24.3

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+...|.+.+|.+||++.+|++.|+.
T Consensus       241 l~~li~~cl~~~p~~RPs~~~i~~~L~~  268 (285)
T d1u59a_         241 LYALMSDCWIYKWEDRPDFLTVEQRMRA  268 (285)
T ss_dssp             HHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            4566779999999999999999998864

>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: EGF receptor tyrosine kinase, Erbb-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.51  E-value=0.043  Score=36.56  Aligned_cols=29  Identities=10%  Similarity=0.183  Sum_probs=24.5

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      .+..+...|.+.+|.+||++.+++..|..
T Consensus       241 ~~~~li~~cl~~dP~~RPs~~eil~~l~~  269 (317)
T d1xkka_         241 DVYMIMVKCWMIDADSRPKFRELIIEFSK  269 (317)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhCCCChhhCcCHHHHHHHHHH
Confidence            35567779999999999999999988754

>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Bruton's tyrosine kinase (Btk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.15  E-value=0.052  Score=35.25  Aligned_cols=28  Identities=7%  Similarity=0.143  Sum_probs=23.7

Q ss_pred             HHHHHHHhhCCCCCCCCCCHHHHHHHhh
Q 038066           16 RCMHMRLLRVRKDPADRPLMATIVLVLD   43 (97)
Q Consensus        16 ~~~~igl~C~~~~p~~RP~m~~Vv~~L~   43 (97)
                      .+..+...|.+.+|.+||++.+++..|.
T Consensus       229 ~l~~li~~cl~~dP~~RPt~~eil~~L~  256 (258)
T d1k2pa_         229 KVYTIMYSCWHEKADERPTFKILLSNIL  256 (258)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHH
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHhh
Confidence            3556667899999999999999998874

>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Focal adhesion kinase 1 (fak)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=91.69  E-value=0.058  Score=35.02  Aligned_cols=28  Identities=18%  Similarity=0.216  Sum_probs=23.7

Q ss_pred             HHHHHHhhCCCCCCCCCCHHHHHHHhhh
Q 038066           17 CMHMRLLRVRKDPADRPLMATIVLVLDS   44 (97)
Q Consensus        17 ~~~igl~C~~~~p~~RP~m~~Vv~~L~~   44 (97)
                      +..+-..|...+|.+||++.+++..|+.
T Consensus       238 ~~~li~~cl~~dp~~Rps~~ei~~~L~~  265 (273)
T d1mp8a_         238 LYSLMTKCWAYDPSRRPRFTELKAQLST  265 (273)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            4455578999999999999999988864