BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038071
(93 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1HKS|A Chain A, Solution Structure Of The Dna-Binding Domain Of
Drosophila Heat Shock Transcription Factor
pdb|1HKT|A Chain A, Solution Structure Of The Dna-Binding Domain Of
Drosophila Heat Shock Transcription Factor
Length = 106
Score = 28.9 bits (63), Expect = 0.77, Method: Compositional matrix adjust.
Identities = 10/24 (41%), Positives = 16/24 (66%)
Query: 39 GSPPFLRKIYEMVEDLETNPAVSW 62
G P FL K++ +V+D +TN + W
Sbjct: 3 GVPAFLAKLWRLVDDADTNRLICW 26
>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex
With A Breakdown Product Of The Udp-Glucose
pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications
Length = 816
Score = 28.1 bits (61), Expect = 1.1, Method: Composition-based stats.
Identities = 10/34 (29%), Positives = 20/34 (58%)
Query: 44 LRKIYEMVEDLETNPAVSWISSATEESRQSDSKR 77
++K+Y+++E+ + N WISS + R + R
Sbjct: 626 MKKMYDLIEEYKLNGQFRWISSQMDRVRNGELYR 659
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2
pdb|2SHP|B Chain B, Tyrosine Phosphatase Shp-2
Length = 525
Score = 26.6 bits (57), Expect = 3.3, Method: Composition-based stats.
Identities = 13/49 (26%), Positives = 25/49 (51%)
Query: 37 EVGSPPFLRKIYEMVEDLETNPAVSWISSATEESRQSDSKRINSKEIRS 85
+VG + ++VE + NP V + + + + ++ RIN+ EI S
Sbjct: 180 DVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIES 228
>pdb|3S27|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications.
pdb|3S27|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From
Arabidopsis Thaliana And Its Functional Implications
Length = 816
Score = 26.6 bits (57), Expect = 4.0, Method: Composition-based stats.
Identities = 10/33 (30%), Positives = 18/33 (54%)
Query: 45 RKIYEMVEDLETNPAVSWISSATEESRQSDSKR 77
+K Y+++E+ + N WISS + R + R
Sbjct: 627 KKXYDLIEEYKLNGQFRWISSQXDRVRNGELYR 659
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant
Homeodomain Of Uhrf1 With Histone H3k9me3
pdb|4GY5|B Chain B, Crystal Structure Of The Tandem Tudor Domain And Plant
Homeodomain Of Uhrf1 With Histone H3k9me3
pdb|4GY5|C Chain C, Crystal Structure Of The Tandem Tudor Domain And Plant
Homeodomain Of Uhrf1 With Histone H3k9me3
pdb|4GY5|D Chain D, Crystal Structure Of The Tandem Tudor Domain And Plant
Homeodomain Of Uhrf1 With Histone H3k9me3
Length = 241
Score = 25.4 bits (54), Expect = 8.4, Method: Compositional matrix adjust.
Identities = 12/39 (30%), Positives = 22/39 (56%)
Query: 38 VGSPPFLRKIYEMVEDLETNPAVSWISSATEESRQSDSK 76
+GSP FL K+ E V+ +TN + + +R++ S+
Sbjct: 3 LGSPEFLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSR 41
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.130 0.390
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,495,859
Number of Sequences: 62578
Number of extensions: 82323
Number of successful extensions: 116
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 108
Number of HSP's gapped (non-prelim): 9
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)