Citrus Sinensis ID: 038077

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

MACFMDHYSLCRAHATQFLFLLLMFSLSIVNSTACSNGNCQVLDSCAAATDCGPGLYCGNCPALGKNRPICTRGQATIPTTIIGDLPFNKYSWLVTHNSFSIVDTPALPGVQRLTFYNQEDMVTNQLRNGVRGLMLDMYDFNGDIWLCHSFRGNQPAINTLREVEAFLSQYPTEIVTIIIEDYVQTPKGLTSLFVRAGLDKYFFPVSKMPKKGEDWPTVTEMVQKNYRLLVFSSVASKEAEEGIAYQWRYILENESGDPGVKAGSCPHRKESQPLNSRKASLFLQNYFPTYPVEEDACKEHSTPLAEMVGTCYKAAGNLLPNFLAVNFYMRSDGGGVFDVLDKMNGQTLCGCSTVLACQSGAPFGSCKNIAVPRGSQTNNNSAGSFSGSVQFSRSASAVHSPNCMVFYSFYLPLVVFSLMSVIDKIWV

cccccccccccccccHHHHHHHHHHHHHHHHHcccccccCEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccEEEEEEEcccccEEEEccccccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccHHHHHHHcccccCECcccccccccccccHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEECccccccccHHcccccccHHHHHHHHHHHcccccccEEEEEcEEccccccHHHHHHHHccCEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc

**CFMDHYSLCRAHATQFLFLLLMFSLSIVNSTACSNGNCQVLDSCAAATDCGPGLYCGNCPALGKNRPICTRGQATIPTTIIGDLPFNKYSWLVTHNSFSIVDTPALPGVQRLTFYNQEDMVTNQLRNGVRGLMLDMYDFNGDIWLCHSFRGNQPAINTLREVEAFLSQYPTEIVTIIIEDYVQTPKGLTSLFVRAGLDKYFFPVSKMPKKGEDWPTVTEMVQKNYRLLVFSSVASKEAEEGIAYQWRYILENESGDPGVKAGSCPHRK*******RKASLFLQNYFPTYPVEEDACKEHSTPLAEMVGTCYKAAGNLLPNFLAVNFYMRSDGGGVFDVLDKMNGQTLCGCSTVLACQSGAPF*****************************R*ASAVHSPNCMVFYSFYLPLVVFSLMSVIDKIWV

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
PI-PLC X domain-containing protein At5g67130		confident	Q93XX5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PLC, chain A
Confidence level:very confident
Coverage over the Query: 76-337
View the alignment between query and template
View the model in PyMOL

Template: 3EA1, chain A
Confidence level:confident
Coverage over the Query: 68-349
View the alignment between query and template
View the model in PyMOL