Query         038108
Match_columns 67
No_of_seqs    49 out of 51
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:40:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038108.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038108hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13005 zf-IS66:  zinc-finger   95.1   0.049 1.1E-06   29.7   3.7   41   20-60      2-47  (47)
  2 PF10601 zf-LITAF-like:  LITAF-  94.9   0.017 3.7E-07   34.5   1.7   52   15-67      2-72  (73)
  3 PRK00464 nrdR transcriptional   94.1   0.044 9.5E-07   38.0   2.5   39   22-66      2-41  (154)
  4 PF14690 zf-ISL3:  zinc-finger   93.9   0.099 2.1E-06   28.2   3.2   38   20-59      2-47  (47)
  5 PF04216 FdhE:  Protein involve  93.6   0.035 7.5E-07   40.4   1.2   43   19-61    171-219 (290)
  6 PF12760 Zn_Tnp_IS1595:  Transp  92.9    0.14   3E-06   28.4   2.7   28   21-62     19-46  (46)
  7 PF06906 DUF1272:  Protein of u  91.7   0.084 1.8E-06   32.2   0.9   13   20-32     41-53  (57)
  8 COG1998 RPS31 Ribosomal protei  91.1    0.11 2.3E-06   31.2   1.0   36    9-62     11-46  (51)
  9 COG3813 Uncharacterized protei  91.1   0.087 1.9E-06   34.2   0.6   18   19-36     40-57  (84)
 10 PF13248 zf-ribbon_3:  zinc-rib  90.4   0.089 1.9E-06   26.5   0.2    9   22-30      4-12  (26)
 11 PF13240 zinc_ribbon_2:  zinc-r  90.0   0.089 1.9E-06   26.2  -0.0    9   23-31      2-10  (23)
 12 PF11672 DUF3268:  Protein of u  90.0    0.18   4E-06   33.2   1.4   39   20-63      2-41  (102)
 13 smart00714 LITAF Possible memb  89.4    0.24 5.1E-06   29.1   1.5   48   18-66      1-65  (67)
 14 TIGR03831 YgiT_finger YgiT-typ  89.3    0.87 1.9E-05   23.9   3.6   42   23-64      1-43  (46)
 15 PRK12775 putative trifunctiona  89.0    0.13 2.8E-06   43.7   0.2   30    5-34    822-852 (1006)
 16 TIGR03830 CxxCG_CxxCG_HTH puta  88.6     1.1 2.4E-05   27.9   4.2   41   23-64      1-42  (127)
 17 PF07282 OrfB_Zn_ribbon:  Putat  88.2     0.4 8.8E-06   27.7   1.9   30   19-63     27-56  (69)
 18 smart00661 RPOL9 RNA polymeras  87.9    0.35 7.5E-06   26.5   1.4   29   22-63      2-30  (52)
 19 TIGR03655 anti_R_Lar restricti  87.4    0.47   1E-05   27.0   1.8   35   22-64      3-37  (53)
 20 PF01927 Mut7-C:  Mut7-C RNAse   87.4     0.6 1.3E-05   31.1   2.6   45   19-63     90-134 (147)
 21 PF14369 zf-RING_3:  zinc-finge  87.2    0.52 1.1E-05   25.5   1.8   27    4-30      5-31  (35)
 22 PRK00398 rpoP DNA-directed RNA  87.1    0.87 1.9E-05   25.0   2.7   13   20-32     21-33  (46)
 23 PF01599 Ribosomal_S27:  Riboso  87.0    0.85 1.8E-05   26.6   2.7   38    5-60      6-45  (47)
 24 PRK00432 30S ribosomal protein  86.7    0.78 1.7E-05   26.4   2.5   37    7-63     11-47  (50)
 25 COG0675 Transposase and inacti  86.0    0.47   1E-05   32.5   1.5   24   19-62    308-331 (364)
 26 cd00729 rubredoxin_SM Rubredox  85.8    0.98 2.1E-05   24.0   2.4   20   11-30      9-28  (34)
 27 PRK10445 endonuclease VIII; Pr  85.7    0.95 2.1E-05   32.9   3.1   29   19-60    234-262 (263)
 28 PRK14810 formamidopyrimidine-D  85.4     0.8 1.7E-05   33.4   2.5   26   22-60    246-271 (272)
 29 TIGR01562 FdhE formate dehydro  84.9    0.38 8.2E-06   36.6   0.7   45   18-62    182-233 (305)
 30 PRK13945 formamidopyrimidine-D  84.5     0.9   2E-05   33.3   2.5   27   21-60    255-281 (282)
 31 PRK00420 hypothetical protein;  84.3    0.87 1.9E-05   30.4   2.2   30   19-64     22-51  (112)
 32 PRK03564 formate dehydrogenase  82.4     0.8 1.7E-05   35.0   1.6   43   19-61    186-234 (309)
 33 PF12773 DZR:  Double zinc ribb  82.2    0.36 7.8E-06   26.5  -0.3   14   50-63     26-39  (50)
 34 PRK09678 DNA-binding transcrip  82.1     1.6 3.6E-05   27.1   2.6   38   22-66      3-42  (72)
 35 TIGR00577 fpg formamidopyrimid  82.0     1.3 2.9E-05   32.3   2.5   26   21-59    246-271 (272)
 36 TIGR01206 lysW lysine biosynth  81.8     1.6 3.6E-05   25.7   2.5   32   21-65      3-34  (54)
 37 PF08271 TF_Zn_Ribbon:  TFIIB z  81.7     1.5 3.2E-05   23.8   2.1   29   22-64      2-30  (43)
 38 PF14803 Nudix_N_2:  Nudix N-te  81.6     1.1 2.4E-05   24.3   1.5   29   22-61      2-30  (34)
 39 PRK01103 formamidopyrimidine/5  81.0     1.7 3.6E-05   31.6   2.7   28   21-61    246-273 (274)
 40 PF09297 zf-NADH-PPase:  NADH p  80.6     1.1 2.3E-05   23.2   1.2   17   21-37      4-20  (32)
 41 PF14354 Lar_restr_allev:  Rest  80.5     1.8 3.9E-05   24.4   2.3   33   22-61      5-37  (61)
 42 PRK14811 formamidopyrimidine-D  79.1     1.8   4E-05   31.6   2.5   28   21-61    236-263 (269)
 43 COG1645 Uncharacterized Zn-fin  77.9     2.1 4.6E-05   29.5   2.3   27   21-64     29-55  (131)
 44 COG3464 Transposase and inacti  77.8     3.5 7.5E-05   31.9   3.7   47   17-63     35-87  (402)
 45 TIGR00310 ZPR1_znf ZPR1 zinc f  76.2     2.9 6.2E-05   29.9   2.7   38   22-63      2-40  (192)
 46 COG1592 Rubrerythrin [Energy p  75.4     2.3   5E-05   30.1   2.1   23    6-29    136-158 (166)
 47 PF05129 Elf1:  Transcription e  75.4     3.5 7.5E-05   25.7   2.6   38   18-65     20-58  (81)
 48 PF06827 zf-FPG_IleRS:  Zinc fi  75.1     4.5 9.8E-05   20.3   2.6   14   22-35      3-16  (30)
 49 TIGR00622 ssl1 transcription f  74.0     1.6 3.4E-05   29.4   0.9   25   22-65      3-27  (112)
 50 TIGR00373 conserved hypothetic  73.6    0.88 1.9E-05   31.0  -0.4   31   21-65    110-140 (158)
 51 cd00350 rubredoxin_like Rubred  72.8     3.8 8.2E-05   21.3   2.0   14   17-30     14-27  (33)
 52 PF08792 A2L_zn_ribbon:  A2L zi  71.5     5.4 0.00012   21.3   2.5   26   22-62      5-30  (33)
 53 PF09723 Zn-ribbon_8:  Zinc rib  71.4     6.3 0.00014   21.5   2.8   12   17-28     23-34  (42)
 54 smart00531 TFIIE Transcription  70.9     2.2 4.8E-05   28.4   1.0   14   21-34    124-137 (147)
 55 smart00834 CxxC_CXXC_SSSS Puta  70.8     6.3 0.00014   20.3   2.6   12   18-29     24-35  (41)
 56 smart00709 Zpr1 Duplicated dom  70.5     5.4 0.00012   27.6   2.9   35   22-63      2-39  (160)
 57 TIGR00340 zpr1_rel ZPR1-relate  70.4     4.6  0.0001   28.2   2.6   35   23-62      1-37  (163)
 58 smart00659 RPOLCX RNA polymera  69.8       5 0.00011   22.5   2.2   27    5-31      3-30  (44)
 59 PRK06266 transcription initiat  69.8     1.1 2.3E-05   31.4  -0.7   32   20-65    117-148 (178)
 60 PF03119 DNA_ligase_ZBD:  NAD-d  69.5     3.3 7.2E-05   21.3   1.3   18   22-39      1-18  (28)
 61 PF14255 Cys_rich_CPXG:  Cystei  69.5     3.6 7.9E-05   24.1   1.6   11   22-32      2-12  (52)
 62 COG1656 Uncharacterized conser  68.3     1.6 3.5E-05   31.1  -0.0   45   17-63     94-140 (165)
 63 PRK09401 reverse gyrase; Revie  66.9     2.2 4.8E-05   37.4   0.5   14   20-33      7-20  (1176)
 64 PF04606 Ogr_Delta:  Ogr/Delta-  66.4     3.8 8.2E-05   22.8   1.2   13   22-34      1-13  (47)
 65 PF09862 DUF2089:  Protein of u  66.0     4.7  0.0001   27.0   1.8   14   23-36      1-14  (113)
 66 TIGR00244 transcriptional regu  65.4       5 0.00011   28.1   1.9   39   22-66      2-41  (147)
 67 TIGR02098 MJ0042_CXXC MJ0042 f  65.0     5.2 0.00011   20.8   1.5   13   52-64     24-36  (38)
 68 COG1110 Reverse gyrase [DNA re  64.9     2.9 6.2E-05   37.5   0.8   20   20-39      8-27  (1187)
 69 PF05191 ADK_lid:  Adenylate ki  64.4     4.5 9.7E-05   21.9   1.2   15   17-31     18-32  (36)
 70 PF07038 DUF1324:  Protein of u  63.5     5.9 0.00013   24.0   1.8   15   37-51      7-21  (59)
 71 COG1996 RPC10 DNA-directed RNA  63.4     3.7   8E-05   24.1   0.8   29    5-33      7-37  (49)
 72 PF14787 zf-CCHC_5:  GAG-polypr  62.6     3.5 7.5E-05   23.1   0.6   10   20-29      2-11  (36)
 73 PF09947 DUF2180:  Uncharacteri  62.2     1.4 3.1E-05   27.4  -1.1   57    4-63      3-66  (68)
 74 COG1933 Archaeal DNA polymeras  62.0     1.5 3.2E-05   33.3  -1.3   24    7-30    141-164 (253)
 75 PF06221 zf-C2HC5:  Putative zi  62.0       4 8.7E-05   24.4   0.8   24   11-34     25-49  (57)
 76 PF13894 zf-C2H2_4:  C2H2-type   61.4     4.6 9.9E-05   17.9   0.8   12   54-65      1-12  (24)
 77 smart00778 Prim_Zn_Ribbon Zinc  61.2     4.7  0.0001   22.2   0.9   10   20-29      3-12  (37)
 78 TIGR01054 rgy reverse gyrase.   61.1     3.5 7.6E-05   36.1   0.7   14   20-33      7-20  (1171)
 79 PRK09710 lar restriction allev  60.3      14  0.0003   22.9   3.0   30   21-62      7-36  (64)
 80 PF14353 CpXC:  CpXC protein     60.0     7.7 0.00017   24.8   2.0   35   12-46     30-70  (128)
 81 PF01396 zf-C4_Topoisom:  Topoi  60.0     6.6 0.00014   21.3   1.4   13   21-33      2-14  (39)
 82 PF06677 Auto_anti-p27:  Sjogre  59.5     5.4 0.00012   22.3   1.0   17   44-60     25-41  (41)
 83 TIGR01384 TFS_arch transcripti  59.5     5.2 0.00011   24.8   1.0    9   22-30      2-10  (104)
 84 PRK12380 hydrogenase nickel in  59.0     6.6 0.00014   25.5   1.5   18   11-28     61-78  (113)
 85 PRK11827 hypothetical protein;  58.9     8.1 0.00018   23.3   1.8   27   22-63     10-36  (60)
 86 PF08273 Prim_Zn_Ribbon:  Zinc-  58.1     3.9 8.4E-05   22.8   0.3   31   20-60      3-33  (40)
 87 TIGR02605 CxxC_CxxC_SSSS putat  57.5      28  0.0006   19.0   3.7   11   18-28     24-34  (52)
 88 PF13453 zf-TFIIB:  Transcripti  57.2      12 0.00027   20.0   2.2   13   23-35      2-14  (41)
 89 PF04438 zf-HIT:  HIT zinc fing  57.1     4.3 9.4E-05   21.2   0.3   21   40-63      3-23  (30)
 90 COG4391 Uncharacterized protei  57.1     9.2  0.0002   23.6   1.8   46   11-65     15-60  (62)
 91 PF04828 GFA:  Glutathione-depe  56.7     7.1 0.00015   22.4   1.3   19   47-65     42-60  (92)
 92 PF10263 SprT-like:  SprT-like   56.0      12 0.00025   24.2   2.3   14   52-65    142-155 (157)
 93 PF13465 zf-H2C2_2:  Zinc-finge  55.1     6.8 0.00015   19.2   0.9   14   50-63     11-24  (26)
 94 PRK00241 nudC NADH pyrophospha  54.2     9.2  0.0002   27.8   1.8   13   20-32     99-111 (256)
 95 TIGR00100 hypA hydrogenase nic  53.6     9.3  0.0002   24.8   1.6   18   11-28     61-78  (115)
 96 PF09538 FYDLN_acid:  Protein o  53.3     6.5 0.00014   25.8   0.8   15   19-33     25-39  (108)
 97 PF07754 DUF1610:  Domain of un  53.2     6.2 0.00013   20.1   0.5   10   18-27     14-23  (24)
 98 PRK14701 reverse gyrase; Provi  52.6     6.4 0.00014   36.0   0.9   17   20-36      6-22  (1638)
 99 PRK04023 DNA polymerase II lar  52.5     7.3 0.00016   34.9   1.2   37   21-65    639-675 (1121)
100 PF12171 zf-C2H2_jaz:  Zinc-fin  51.9     4.6  0.0001   19.6  -0.1   13   53-65      1-13  (27)
101 PRK05580 primosome assembly pr  51.6      12 0.00026   30.6   2.2   11   21-31    391-401 (679)
102 PRK14892 putative transcriptio  51.0      17 0.00036   23.7   2.4   33   18-62     19-51  (99)
103 smart00132 LIM Zinc-binding do  50.9     6.8 0.00015   19.1   0.5   36   22-64      1-38  (39)
104 PHA00626 hypothetical protein   50.8      19 0.00041   22.1   2.5   32   22-63      2-33  (59)
105 PF06750 DiS_P_DiS:  Bacterial   50.7     1.8 3.9E-05   27.4  -2.1   39   19-65     32-70  (92)
106 PF03604 DNA_RNApol_7kD:  DNA d  50.4      12 0.00025   20.0   1.4   13   18-30     15-27  (32)
107 PF02701 zf-Dof:  Dof domain, z  50.2     6.8 0.00015   24.3   0.5   36   18-61      3-38  (63)
108 PRK14873 primosome assembly pr  50.0      14 0.00029   30.8   2.3   11   22-32    394-404 (665)
109 COG1571 Predicted DNA-binding   49.8      12 0.00025   30.2   1.9   34   16-65    346-379 (421)
110 COG2093 DNA-directed RNA polym  49.7      10 0.00022   23.6   1.2   16   22-37     20-44  (64)
111 PF10571 UPF0547:  Uncharacteri  48.8     9.2  0.0002   19.4   0.8   13   18-30     12-24  (26)
112 PRK04351 hypothetical protein;  47.7      21 0.00046   24.4   2.6   16   50-65    129-144 (149)
113 PF06689 zf-C4_ClpX:  ClpX C4-t  47.1       7 0.00015   21.4   0.2   10   54-63      2-11  (41)
114 PRK03824 hypA hydrogenase nick  47.0      15 0.00033   24.5   1.8   50   11-62     61-116 (135)
115 PF03966 Trm112p:  Trm112p-like  46.7      29 0.00063   20.3   2.8   16   49-64     49-64  (68)
116 COG1675 TFA1 Transcription ini  46.4     7.7 0.00017   27.6   0.3   14   21-34    133-146 (176)
117 PRK03681 hypA hydrogenase nick  46.3      16 0.00036   23.6   1.8   18   11-28     61-78  (114)
118 PF00096 zf-C2H2:  Zinc finger,  45.9      12 0.00027   17.0   0.9   11   54-64      1-11  (23)
119 PF12172 DUF35_N:  Rubredoxin-l  45.8      23 0.00049   18.4   2.0   22    5-28     12-33  (37)
120 PF05605 zf-Di19:  Drought indu  45.5      10 0.00022   21.2   0.7   37   22-63      4-41  (54)
121 TIGR00155 pqiA_fam integral me  45.3      12 0.00026   29.1   1.2   30   22-64     15-44  (403)
122 COG1867 TRM1 N2,N2-dimethylgua  44.8      19 0.00041   28.7   2.3   30    3-32    239-269 (380)
123 PRK00762 hypA hydrogenase nick  44.5      10 0.00022   25.0   0.7    9   21-29     93-101 (124)
124 COG1439 Predicted nucleic acid  44.4      22 0.00047   25.6   2.4   15   18-32    151-165 (177)
125 PRK00423 tfb transcription ini  42.8      22 0.00047   26.4   2.3   31   20-64     11-41  (310)
126 cd04476 RPA1_DBD_C RPA1_DBD_C:  42.8      15 0.00032   24.3   1.2   11   52-62     50-60  (166)
127 PF03367 zf-ZPR1:  ZPR1 zinc-fi  42.3      30 0.00065   23.8   2.8   37   22-63      3-40  (161)
128 PF05280 FlhC:  Flagellar trans  42.1      14 0.00031   26.0   1.1   26   22-60    136-161 (175)
129 PF02150 RNA_POL_M_15KD:  RNA p  42.0      24 0.00051   18.8   1.8   13   23-35      4-16  (35)
130 PF01485 IBR:  IBR domain;  Int  41.8     4.6  0.0001   22.0  -1.1   25   15-39     13-39  (64)
131 PF07503 zf-HYPF:  HypF finger;  41.2     9.5 0.00021   20.7   0.1   18   17-34     18-35  (35)
132 TIGR00354 polC DNA polymerase,  41.1      19  0.0004   32.4   1.9   20   14-33   1022-1041(1095)
133 COG1779 C4-type Zn-finger prot  41.1      29 0.00063   25.6   2.7   42   18-64     12-54  (201)
134 COG2260 Predicted Zn-ribbon RN  40.5      12 0.00025   23.0   0.4   12   21-32     18-29  (59)
135 COG5349 Uncharacterized protei  40.5      14  0.0003   25.6   0.8   12   18-29     19-30  (126)
136 PRK04023 DNA polymerase II lar  40.3      20 0.00042   32.3   1.9   20   14-33   1047-1066(1121)
137 PRK05320 rhodanese superfamily  40.0      19 0.00042   26.2   1.6   28    4-31    226-255 (257)
138 PF09855 DUF2082:  Nucleic-acid  40.0      69  0.0015   19.3   3.8   11   52-62     35-45  (64)
139 PF06054 CoiA:  Competence prot  39.7      20 0.00044   27.4   1.7   16   18-33     28-43  (375)
140 PRK00564 hypA hydrogenase nick  39.3      14 0.00031   24.0   0.8   17   11-27     62-78  (117)
141 PRK14714 DNA polymerase II lar  38.4      21 0.00046   32.7   1.9   20   14-33   1263-1282(1337)
142 cd00730 rubredoxin Rubredoxin;  38.3      27 0.00059   20.1   1.8   13   18-30     32-44  (50)
143 PRK15103 paraquat-inducible me  38.1      21 0.00045   28.0   1.6   31   21-64     11-41  (419)
144 PF07213 DAP10:  DAP10 membrane  38.0      15 0.00032   23.6   0.7   15   14-28     16-30  (79)
145 PF13395 HNH_4:  HNH endonuclea  37.9      11 0.00023   21.3   0.0   13   23-35      1-13  (54)
146 PF04423 Rad50_zn_hook:  Rad50   37.7      12 0.00026   21.0   0.2   13   18-30     18-30  (54)
147 PF01096 TFIIS_C:  Transcriptio  37.4      23 0.00049   19.1   1.3   36   22-62      2-37  (39)
148 PF09889 DUF2116:  Uncharacteri  37.3      15 0.00034   22.0   0.6   11   21-31      4-14  (59)
149 TIGR00375 conserved hypothetic  37.2      16 0.00034   28.6   0.8   11   20-31    259-269 (374)
150 PRK14715 DNA polymerase II lar  37.1      23  0.0005   33.0   1.9   20   14-33   1551-1570(1627)
151 PRK05978 hypothetical protein;  36.6      18 0.00038   25.2   0.9   35   18-66     31-65  (148)
152 COG1405 SUA7 Transcription ini  36.3      30 0.00066   26.0   2.2   30   21-64      2-31  (285)
153 PF11793 FANCL_C:  FANCL C-term  36.2      15 0.00033   21.9   0.5   16   17-32     52-67  (70)
154 smart00019 SF_P Pulmonary surf  35.9      15 0.00033   26.8   0.5   21    5-25    102-122 (191)
155 PRK06393 rpoE DNA-directed RNA  35.9      21 0.00046   21.9   1.1    9   21-29     18-26  (64)
156 PF06957 COPI_C:  Coatomer (COP  35.6      29 0.00063   27.7   2.1   30   35-65    360-392 (422)
157 PF12874 zf-met:  Zinc-finger o  35.4      22 0.00048   16.4   0.9   12   54-65      1-12  (25)
158 PF03884 DUF329:  Domain of unk  35.0     9.8 0.00021   22.8  -0.5   13   22-34      4-16  (57)
159 PF12660 zf-TFIIIC:  Putative z  34.8      20 0.00044   22.8   0.9   14   17-30     85-98  (99)
160 PHA02942 putative transposase;  34.7      23 0.00051   27.2   1.4   28   20-63    325-352 (383)
161 PF08394 Arc_trans_TRASH:  Arch  34.7      18  0.0004   20.0   0.6   30   23-63      1-33  (37)
162 KOG3456 NADH:ubiquinone oxidor  34.6      17 0.00036   25.0   0.5   12   17-28    101-112 (120)
163 PF08209 Sgf11:  Sgf11 (transcr  34.6      16 0.00034   19.7   0.3   13   22-34      6-18  (33)
164 PRK08173 DNA topoisomerase III  34.6      37  0.0008   29.1   2.6   14   17-30    723-736 (862)
165 PF04879 Molybdop_Fe4S4:  Molyb  34.1      11 0.00023   20.8  -0.4   13   17-29      2-14  (55)
166 PF01155 HypA:  Hydrogenase exp  34.0     8.7 0.00019   24.7  -0.9   21   11-31     61-81  (113)
167 PF02591 DUF164:  Putative zinc  33.9      20 0.00043   20.2   0.7   35   20-63     22-56  (56)
168 COG1096 Predicted RNA-binding   33.4      37  0.0008   24.8   2.2   25   21-62    150-174 (188)
169 PF14375 Cys_rich_CWC:  Cystein  33.4      21 0.00045   20.0   0.7   11   23-33      1-11  (50)
170 COG1594 RPB9 DNA-directed RNA   33.1      45 0.00098   21.8   2.4   11   22-32      4-14  (113)
171 cd04467 S1_aIF5A S1_aIF5A: Arc  32.9      25 0.00055   20.9   1.0   15   27-41     13-27  (57)
172 PRK14559 putative protein seri  32.7      18 0.00038   30.2   0.5   10   55-64     43-52  (645)
173 PRK06260 threonine synthase; V  32.6      41 0.00089   25.4   2.4   28    6-33      5-32  (397)
174 PF05741 zf-nanos:  Nanos RNA b  32.5      16 0.00034   21.8   0.1   11   52-62     32-42  (55)
175 TIGR00595 priA primosomal prot  32.2      25 0.00055   27.8   1.2   14   16-29    249-262 (505)
176 PRK08351 DNA-directed RNA poly  32.2      20 0.00042   21.8   0.5    8   22-29     17-24  (61)
177 KOG0402 60S ribosomal protein   32.0      12 0.00027   24.6  -0.4   11   52-62     35-45  (92)
178 KOG1598 Transcription initiati  32.0      26 0.00056   29.1   1.3   29   22-64      2-30  (521)
179 TIGR00308 TRM1 tRNA(guanine-26  31.7      34 0.00075   26.4   1.9   16   15-30    247-262 (374)
180 PLN03086 PRLI-interacting fact  31.7     8.1 0.00017   32.0  -1.6   45   19-63    452-514 (567)
181 PF00301 Rubredoxin:  Rubredoxi  31.1      24 0.00052   20.1   0.7    8   22-29     36-43  (47)
182 smart00440 ZnF_C2C2 C2C2 Zinc   31.0      41 0.00088   18.2   1.6   36   22-62      2-37  (40)
183 smart00507 HNHc HNH nucleases.  30.9      27 0.00058   17.6   0.8   11   21-31     11-21  (52)
184 KOG4317 Predicted Zn-finger pr  30.6      22 0.00047   28.5   0.7   22   43-64      9-30  (383)
185 PRK01343 zinc-binding protein;  29.9      18 0.00039   21.8   0.1   12   20-31      9-20  (57)
186 PRK12722 transcriptional activ  29.5      28  0.0006   25.1   1.0   14   21-34    135-148 (187)
187 smart00647 IBR In Between Ring  29.4      50  0.0011   17.9   1.8   16   19-34     17-34  (64)
188 PF13966 zf-RVT:  zinc-binding   29.4      29 0.00063   20.6   0.9   15   17-31     56-70  (86)
189 smart00064 FYVE Protein presen  29.1      35 0.00076   19.3   1.2   14   50-63     23-36  (68)
190 PF09845 DUF2072:  Zn-ribbon co  28.9      23 0.00051   24.5   0.5    8   22-29     21-28  (131)
191 PF09334 tRNA-synt_1g:  tRNA sy  28.5      28 0.00061   26.7   0.9   21    7-27    123-143 (391)
192 PRK06450 threonine synthase; V  28.5      52  0.0011   24.7   2.3   16   18-33     16-31  (338)
193 COG3582 Predicted nucleic acid  28.5      30 0.00064   24.6   1.0   20   14-33    104-123 (162)
194 PF03117 Herpes_UL49_1:  UL49 f  28.4      42 0.00092   25.4   1.8   26    4-29    134-161 (245)
195 TIGR03031 cas_csx12 CRISPR-ass  28.2      27 0.00058   30.3   0.8   13   18-30    758-770 (802)
196 COG2888 Predicted Zn-ribbon RN  27.8      24 0.00052   21.8   0.4   12   16-27     46-57  (61)
197 TIGR02443 conserved hypothetic  27.6      36 0.00079   20.7   1.1   18   14-31      3-20  (59)
198 COG1198 PriA Primosomal protei  27.2      47   0.001   28.3   2.1   13   17-29    472-484 (730)
199 COG3809 Uncharacterized protei  27.1      32  0.0007   22.5   0.9    7   22-28     23-29  (88)
200 COG4311 SoxD Sarcosine oxidase  27.1      28  0.0006   23.2   0.6    7   22-28      5-11  (97)
201 COG1885 Uncharacterized protei  27.1 1.1E+02  0.0024   20.9   3.5   30   20-49     49-78  (115)
202 cd04482 RPA2_OBF_like RPA2_OBF  27.0      37  0.0008   20.9   1.1   10   18-27     82-91  (91)
203 TIGR02300 FYDLN_acid conserved  26.9      34 0.00073   23.7   1.0   15   18-32     24-38  (129)
204 cd01407 SIR2-fam SIR2 family o  26.7      30 0.00066   24.0   0.8   11   20-30    133-143 (218)
205 TIGR02159 PA_CoA_Oxy4 phenylac  26.3      30 0.00065   23.6   0.7   10   20-29    105-114 (146)
206 PRK00481 NAD-dependent deacety  26.3      30 0.00066   24.4   0.7    9   22-30    144-152 (242)
207 PRK12860 transcriptional activ  26.2      34 0.00073   24.8   0.9   13   21-33    135-147 (189)
208 PF06044 DRP:  Dam-replacing fa  26.2      63  0.0014   24.7   2.4   34   20-65     31-65  (254)
209 PF13912 zf-C2H2_6:  C2H2-type   26.0      40 0.00086   15.8   0.9   12   54-65      2-13  (27)
210 PF15616 TerY-C:  TerY-C metal   25.9      50  0.0011   22.6   1.7   38   21-64     78-116 (131)
211 COG4888 Uncharacterized Zn rib  25.9      43 0.00094   22.5   1.3   16   50-65     19-34  (104)
212 PF13408 Zn_ribbon_recom:  Reco  25.8      41 0.00088   18.1   1.0   11   22-32      7-17  (58)
213 cd01412 SIRT5_Af1_CobB SIRT5_A  25.5      33 0.00072   23.7   0.8   11   20-30    130-140 (224)
214 PRK13130 H/ACA RNA-protein com  25.5      24 0.00053   21.0   0.1   12   20-31     17-28  (56)
215 KOG3799 Rab3 effector RIM1 and  25.4      23 0.00049   25.5  -0.1   26   22-62     91-116 (169)
216 KOG2807 RNA polymerase II tran  25.3      39 0.00085   27.1   1.2   28   19-65    275-302 (378)
217 PRK14724 DNA topoisomerase III  25.1      43 0.00094   29.2   1.5   14   17-30    752-765 (987)
218 PF09856 DUF2083:  Predicted tr  25.1      66  0.0014   22.4   2.2   25    2-26     12-44  (156)
219 COG1933 Archaeal DNA polymeras  25.0      42  0.0009   25.6   1.3   24   10-33    173-196 (253)
220 PRK14138 NAD-dependent deacety  24.8      38 0.00082   24.3   1.0   11   20-30    143-153 (244)
221 PF13913 zf-C2HC_2:  zinc-finge  24.8      35 0.00075   16.8   0.6   10   22-31      4-13  (25)
222 PF05876 Terminase_GpA:  Phage   24.7      57  0.0012   26.3   2.1   38   21-63    201-239 (557)
223 KOG2906 RNA polymerase III sub  24.7      41  0.0009   22.7   1.1   22    8-29     53-74  (105)
224 PF02176 zf-TRAF:  TRAF-type zi  24.7      11 0.00024   20.7  -1.4   39   19-64      8-53  (60)
225 PF05015 Plasmid_killer:  Plasm  24.3      75  0.0016   19.6   2.1   19   28-46     62-80  (93)
226 PF04400 DUF539:  Protein of un  24.0      22 0.00048   20.5  -0.3   24   13-40      2-25  (45)
227 PF08063 PADR1:  PADR1 (NUC008)  24.0      39 0.00084   19.7   0.8   17   18-34     12-28  (55)
228 PF11023 DUF2614:  Protein of u  23.8      27 0.00058   23.8   0.1   21    7-30     75-95  (114)
229 COG3024 Uncharacterized protei  23.7      30 0.00065   21.6   0.2   15   20-34      7-21  (65)
230 PF08772 NOB1_Zn_bind:  Nin one  23.7      31 0.00067   21.4   0.3   11   19-29     23-33  (73)
231 PRK04338 N(2),N(2)-dimethylgua  23.7      67  0.0015   24.7   2.2   13   18-30    259-271 (382)
232 PF01780 Ribosomal_L37ae:  Ribo  23.5      32 0.00069   22.4   0.4   13   51-63     33-45  (90)
233 PF14447 Prok-RING_4:  Prokaryo  23.3      31 0.00067   20.7   0.2   16   20-35     39-54  (55)
234 PF07295 DUF1451:  Protein of u  23.1      96  0.0021   21.3   2.7    8   21-28    131-138 (146)
235 PF04981 NMD3:  NMD3 family ;    23.1      38 0.00082   24.1   0.7   41   23-64      1-46  (236)
236 TIGR01374 soxD sarcosine oxida  23.1      37 0.00081   21.7   0.6    6   22-27      3-8   (84)
237 cd07973 Spt4 Transcription elo  22.5      39 0.00085   21.9   0.6    9   19-27     19-27  (98)
238 KOG3362 Predicted BBOX Zn-fing  22.5      27 0.00058   25.0  -0.2   16   50-65    126-141 (156)
239 PRK05333 NAD-dependent deacety  22.4      40 0.00088   24.6   0.8   10   21-30    180-189 (285)
240 smart00451 ZnF_U1 U1-like zinc  22.4      39 0.00084   16.6   0.5   12   53-64      3-14  (35)
241 TIGR02646 conserved hypothetic  22.3      26 0.00057   23.1  -0.2   17   17-33     21-37  (144)
242 cd01411 SIR2H SIR2H: Uncharact  22.3      43 0.00092   23.6   0.8   11   20-30    136-146 (225)
243 PRK00415 rps27e 30S ribosomal   22.2      62  0.0013   19.6   1.4   21   45-65     22-42  (59)
244 PF01258 zf-dskA_traR:  Prokary  22.2      64  0.0014   16.7   1.3   14   20-33      3-16  (36)
245 PRK07956 ligA NAD-dependent DN  22.1      74  0.0016   26.5   2.3   15   19-33    403-417 (665)
246 PF04194 PDCD2_C:  Programmed c  22.1      42 0.00091   22.8   0.8   11   20-30     97-107 (164)
247 PF04135 Nop10p:  Nucleolar RNA  22.1      42 0.00092   19.8   0.7   12   21-32     18-29  (53)
248 PF09526 DUF2387:  Probable met  21.9      51  0.0011   20.2   1.0   15   16-30      4-18  (71)
249 PF13719 zinc_ribbon_5:  zinc-r  21.8      37 0.00081   18.0   0.4   31   22-62      4-34  (37)
250 PF14206 Cys_rich_CPCC:  Cystei  21.7      42 0.00091   21.1   0.6   11   22-32      3-13  (78)
251 PF10825 DUF2752:  Protein of u  21.7      38 0.00083   19.2   0.4    8   22-29     11-18  (52)
252 smart00532 LIGANc Ligase N fam  21.7      80  0.0017   25.1   2.3   16   19-34    398-413 (441)
253 TIGR00575 dnlj DNA ligase, NAD  21.4      79  0.0017   26.2   2.3   15   19-33    391-405 (652)
254 PF00130 C1_1:  Phorbol esters/  21.3 1.2E+02  0.0025   16.2   2.3   31   16-62      7-37  (53)
255 COG0266 Nei Formamidopyrimidin  21.3      75  0.0016   24.1   2.0   17   20-36    245-261 (273)
256 COG4049 Uncharacterized protei  21.3      37  0.0008   21.1   0.3    9   20-28     17-25  (65)
257 TIGR00280 L37a ribosomal prote  21.1      36 0.00079   22.2   0.3   11   51-61     33-43  (91)
258 PF01363 FYVE:  FYVE zinc finge  21.1      49  0.0011   18.7   0.8   14   50-63     22-35  (69)
259 PF09012 FeoC:  FeoC like trans  21.0      96  0.0021   17.8   2.0   12   20-31     54-65  (69)
260 cd01413 SIR2_Af2 SIR2_Af2: Arc  20.8      46 0.00099   23.4   0.7   10   21-30    137-146 (222)
261 KOG0373 Serine/threonine speci  20.5      83  0.0018   24.5   2.1   26   13-38    253-278 (306)
262 PRK14351 ligA NAD-dependent DN  20.3      80  0.0017   26.6   2.1   15   18-32    421-435 (689)
263 COG2835 Uncharacterized conser  20.2 1.2E+02  0.0026   18.5   2.4   27   22-63     10-36  (60)
264 PRK03976 rpl37ae 50S ribosomal  20.0      39 0.00086   21.9   0.3   11   51-61     34-44  (90)
265 COG3043 NapB Nitrate reductase  20.0      45 0.00098   23.8   0.6   13   48-60    121-133 (155)

No 1  
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=95.07  E-value=0.049  Score=29.70  Aligned_cols=41  Identities=32%  Similarity=0.688  Sum_probs=29.2

Q ss_pred             CCCCCCCCcceEEEEec-eeeeEEEeeeEeeec----ceEEecccc
Q 038108           20 PGSCPYCGGKVLAIDFE-SQCRFCFLPICYNIK----KKYFCSLCS   60 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dve-s~~rfCflP~~~k~k----r~~~Ct~C~   60 (67)
                      +.+||.||+.+.-+-.+ .+-.|=++|.-+...    -+|.|+-|+
T Consensus         2 ~~~C~~Cg~~l~~ig~~~~~q~l~~~p~~~~V~e~~~~~y~C~~C~   47 (47)
T PF13005_consen    2 PRACPDCGGELKEIGEEKVRQVLDLPPAKPEVTEHVRHKYACPCCG   47 (47)
T ss_pred             CCcCCCCCceeeECCceeeEEEEeecccceEEEEEEeceEECCCCC
Confidence            56899999999866555 556666778666543    367777775


No 2  
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=94.93  E-value=0.017  Score=34.45  Aligned_cols=52  Identities=27%  Similarity=0.640  Sum_probs=38.4

Q ss_pred             eeecCCCCCCCCCcceEEEEecee-----------------eeEEEeeeEeee--cceEEeccccceeeeeC
Q 038108           15 GRQQAPGSCPYCGGKVLAIDFESQ-----------------CRFCFLPICYNI--KKKYFCSLCSRRLELYH   67 (67)
Q Consensus        15 ~~~~ApG~Cp~CGG~v~a~Dves~-----------------~rfCflP~~~k~--kr~~~Ct~C~r~L~~~~   67 (67)
                      +++|..-.||+||-.+. +.+|.+                 |-+|+||++.+.  ...++|+.|++.|-.|+
T Consensus         2 ~~~p~~~~CP~C~~~~~-T~v~~~~g~~t~~~~~~l~~~~~~~~~~iP~~~~~~kd~~H~Cp~C~~~lg~~~   72 (73)
T PF10601_consen    2 GPEPVRIYCPYCQQQVQ-TRVEYKSGTMTYICAALLCLFGCWPCCCIPFCCDSCKDVYHYCPNCGAFLGTYK   72 (73)
T ss_pred             CCCceeeECCCCCCEEE-EEEEEEeChHHHHHHHHHHHHHHHHHhhHhhccccccCceEECCCCCCEeEEEe
Confidence            46788889999998764 334422                 345789999854  45799999999998763


No 3  
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=94.12  E-value=0.044  Score=38.01  Aligned_cols=39  Identities=26%  Similarity=0.617  Sum_probs=26.4

Q ss_pred             CCCCCCcce-EEEEeceeeeEEEeeeEeeecceEEeccccceeeee
Q 038108           22 SCPYCGGKV-LAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELY   66 (67)
Q Consensus        22 ~Cp~CGG~v-~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~~   66 (67)
                      .|||||++. .|.|=+.      ++==.-.+|++.|..||++..+|
T Consensus         2 ~cp~c~~~~~~~~~s~~------~~~~~~~~~~~~c~~c~~~f~~~   41 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRP------AEDGNAIRRRRECLACGKRFTTF   41 (154)
T ss_pred             cCCCCCCCCCEeEeccc------cCCCCceeeeeeccccCCcceEe
Confidence            499999976 5555331      11112367779999999987765


No 4  
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=93.90  E-value=0.099  Score=28.23  Aligned_cols=38  Identities=34%  Similarity=0.729  Sum_probs=23.3

Q ss_pred             CCCCCCCCcceEEE--EeceeeeEEEeee-----Eee-ecceEEeccc
Q 038108           20 PGSCPYCGGKVLAI--DFESQCRFCFLPI-----CYN-IKKKYFCSLC   59 (67)
Q Consensus        20 pG~Cp~CGG~v~a~--Dves~~rfCflP~-----~~k-~kr~~~Ct~C   59 (67)
                      |-.||+||..-..-  -.+..|+  .+|+     +.+ .+++|.|..|
T Consensus         2 ~~~Cp~Cg~~~~~~~g~~~r~i~--~l~~~~~~~~L~i~~~R~~C~~C   47 (47)
T PF14690_consen    2 PPRCPHCGSPSVHRHGYKTRRIR--HLPIGGRPVYLRIRKRRYRCKNC   47 (47)
T ss_pred             CccCCCcCCCceECCceEEEEEe--ecccCCEEEEEEEEeEEEECcCC
Confidence            56899999776332  2334444  4444     433 3678998876


No 5  
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=93.58  E-value=0.035  Score=40.37  Aligned_cols=43  Identities=21%  Similarity=0.542  Sum_probs=24.2

Q ss_pred             CCCCCCCCCcceEEEEecee----eeEEEeeeEeeecc--eEEeccccc
Q 038108           19 APGSCPYCGGKVLAIDFESQ----CRFCFLPICYNIKK--KYFCSLCSR   61 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~----~rfCflP~~~k~kr--~~~Ct~C~r   61 (67)
                      ..|.||-||+.-++.-++..    .|+.+=.+|.-.|+  |..|+.||.
T Consensus       171 ~~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R~~Cp~Cg~  219 (290)
T PF04216_consen  171 QRGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVRIKCPYCGN  219 (290)
T ss_dssp             T-SS-TTT---EEEEEEE------EEEEEETTT--EEE--TTS-TTT--
T ss_pred             cCCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecCCCCcCCCC
Confidence            35999999999888877764    58887788765553  567888885


No 6  
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=92.87  E-value=0.14  Score=28.40  Aligned_cols=28  Identities=25%  Similarity=0.772  Sum_probs=20.8

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      -.||+||.. .+.-+.+             ...|.|..|+++
T Consensus        19 ~~CP~Cg~~-~~~~~~~-------------~~~~~C~~C~~q   46 (46)
T PF12760_consen   19 FVCPHCGST-KHYRLKT-------------RGRYRCKACRKQ   46 (46)
T ss_pred             CCCCCCCCe-eeEEeCC-------------CCeEECCCCCCc
Confidence            469999997 5555554             677888888764


No 7  
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=91.66  E-value=0.084  Score=32.18  Aligned_cols=13  Identities=46%  Similarity=1.313  Sum_probs=11.1

Q ss_pred             CCCCCCCCcceEE
Q 038108           20 PGSCPYCGGKVLA   32 (67)
Q Consensus        20 pG~Cp~CGG~v~a   32 (67)
                      .|.||+|||.++.
T Consensus        41 ~~~CPNCgGelv~   53 (57)
T PF06906_consen   41 NGVCPNCGGELVR   53 (57)
T ss_pred             cCcCcCCCCcccc
Confidence            6999999998763


No 8  
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=91.15  E-value=0.11  Score=31.16  Aligned_cols=36  Identities=28%  Similarity=0.702  Sum_probs=25.2

Q ss_pred             CceeeeeeecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108            9 EEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus         9 e~~kv~~~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      +.+||++.++   -||+||-++-.+|               ++.|+.|-.||-.
T Consensus        11 ~~~kv~rk~~---~CPrCG~gvfmA~---------------H~dR~~CGkCgyT   46 (51)
T COG1998          11 DDEKVKRKNR---FCPRCGPGVFMAD---------------HKDRWACGKCGYT   46 (51)
T ss_pred             cCCcEEEccc---cCCCCCCcchhhh---------------cCceeEeccccce
Confidence            3455666554   6999998877666               4457888888754


No 9  
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=91.12  E-value=0.087  Score=34.16  Aligned_cols=18  Identities=39%  Similarity=0.927  Sum_probs=14.5

Q ss_pred             CCCCCCCCCcceEEEEec
Q 038108           19 APGSCPYCGGKVLAIDFE   36 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dve   36 (67)
                      -.|.||+|||.+++--++
T Consensus        40 l~g~CPnCGGelv~RP~R   57 (84)
T COG3813          40 LHGLCPNCGGELVARPIR   57 (84)
T ss_pred             hcCcCCCCCchhhcCcCC
Confidence            469999999999875554


No 10 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=90.43  E-value=0.089  Score=26.46  Aligned_cols=9  Identities=44%  Similarity=1.398  Sum_probs=6.7

Q ss_pred             CCCCCCcce
Q 038108           22 SCPYCGGKV   30 (67)
Q Consensus        22 ~Cp~CGG~v   30 (67)
                      .||+||-.+
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            588998743


No 11 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=90.03  E-value=0.089  Score=26.22  Aligned_cols=9  Identities=44%  Similarity=1.398  Sum_probs=6.5

Q ss_pred             CCCCCcceE
Q 038108           23 CPYCGGKVL   31 (67)
Q Consensus        23 Cp~CGG~v~   31 (67)
                      ||+||-.+.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            778887664


No 12 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=89.97  E-value=0.18  Score=33.18  Aligned_cols=39  Identities=33%  Similarity=0.686  Sum_probs=24.6

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecc-eEEecccccee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKK-KYFCSLCSRRL   63 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr-~~~Ct~C~r~L   63 (67)
                      |-.||||||.+.-+|= +..    -|=-...+. -|.|+.|++-.
T Consensus         2 p~~CpYCg~~~~l~~~-~~i----Yg~~~~~~~~~y~C~~C~AyV   41 (102)
T PF11672_consen    2 PIICPYCGGPAELVDG-SEI----YGHRYDDGPYLYVCTPCDAYV   41 (102)
T ss_pred             CcccCCCCCeeEEccc-chh----cCccCCCCceeEECCCCCcee
Confidence            5689999999998772 221    131111123 39999998754


No 13 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=89.40  E-value=0.24  Score=29.09  Aligned_cols=48  Identities=27%  Similarity=0.591  Sum_probs=31.7

Q ss_pred             cCCCCCCCCCcceEEEEeceee---------------eEEEeeeEeee--cceEEeccccceeeee
Q 038108           18 QAPGSCPYCGGKVLAIDFESQC---------------RFCFLPICYNI--KKKYFCSLCSRRLELY   66 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dves~~---------------rfCflP~~~k~--kr~~~Ct~C~r~L~~~   66 (67)
                      |+.-.||+||.-++ +.+|.+.               =+|+||++.+.  ...++|+.|++.|-.|
T Consensus         1 p~~i~Cp~C~~~~~-T~v~~~~g~~t~~~~~ll~~~~~~~~iP~~~~~~kd~~H~Cp~C~~~lg~~   65 (67)
T smart00714        1 PYQLFCPRCQNNVT-TRVETETGVCAWLICCLLFLLCFCCCLPCCLDSFKDVNHYCPNCGAFLGTY   65 (67)
T ss_pred             CcceECCCCCCEEE-EEEEEEeChHHHHHHHHHHHHHHHHHHHHhcccccCccEECCCCCCEeEEe
Confidence            34557999987543 4444322               24568986443  4468999999998776


No 14 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=89.32  E-value=0.87  Score=23.95  Aligned_cols=42  Identities=21%  Similarity=0.361  Sum_probs=25.0

Q ss_pred             CCCCCcceEEEEeceeeeEEE-eeeEeeecceEEeccccceee
Q 038108           23 CPYCGGKVLAIDFESQCRFCF-LPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        23 Cp~CGG~v~a~Dves~~rfCf-lP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      ||-|||....-++++.+.--- -=+..+.=..+.|+.||..+-
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~~~~~~i~~vp~~~C~~CGE~~~   43 (46)
T TIGR03831         1 CPICGGEELEGKTTTETYEYGGELIVIENVPALVCPQCGEEYL   43 (46)
T ss_pred             CCCCCCceecceEEEEEEEeCCEEEEEeCCCccccccCCCEee
Confidence            888988877777754432111 112233445667999987664


No 15 
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=88.96  E-value=0.13  Score=43.66  Aligned_cols=30  Identities=37%  Similarity=0.805  Sum_probs=22.5

Q ss_pred             EEcCCceeeeeeecCC-CCCCCCCcceEEEE
Q 038108            5 YVCSEEERELGRQQAP-GSCPYCGGKVLAID   34 (67)
Q Consensus         5 ~vcde~~kv~~~~~Ap-G~Cp~CGG~v~a~D   34 (67)
                      +=||.-+||----.+| |.||+|||.+++.|
T Consensus       822 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  852 (1006)
T PRK12775        822 WRCDDCGKVSEGFAFPYGMCPACGGKLQALD  852 (1006)
T ss_pred             eehhhhccccccccCCcCcCcccccchhhhh
Confidence            3466666665555667 99999999998876


No 16 
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=88.64  E-value=1.1  Score=27.89  Aligned_cols=41  Identities=24%  Similarity=0.541  Sum_probs=30.9

Q ss_pred             CCCCCcceEEEEecee-eeEEEeeeEeeecceEEeccccceee
Q 038108           23 CPYCGGKVLAIDFESQ-CRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        23 Cp~CGG~v~a~Dves~-~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      ||.||++....++++. +.+.-.-+-+ .-..+.|+.||..+.
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~G~~~~v-~~~~~~C~~CGe~~~   42 (127)
T TIGR03830         1 CPICGSGELVRDVKDEPYTYKGESITI-GVPGWYCPACGEELL   42 (127)
T ss_pred             CCCCCCccceeeeecceEEEcCEEEEE-eeeeeECCCCCCEEE
Confidence            8999976666777764 4677777777 667788999998654


No 17 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=88.16  E-value=0.4  Score=27.71  Aligned_cols=30  Identities=20%  Similarity=0.598  Sum_probs=23.0

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      ..-.||.||.....               ..+.|.|.|+.||...
T Consensus        27 TSq~C~~CG~~~~~---------------~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK---------------RRSGRVFTCPNCGFEM   56 (69)
T ss_pred             CccCccCccccccc---------------ccccceEEcCCCCCEE
Confidence            35579999987765               4577889999998753


No 18 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=87.87  E-value=0.35  Score=26.48  Aligned_cols=29  Identities=24%  Similarity=0.732  Sum_probs=18.3

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      -||.||..+..-+.+.             ..++.|+.||...
T Consensus         2 FCp~Cg~~l~~~~~~~-------------~~~~vC~~Cg~~~   30 (52)
T smart00661        2 FCPKCGNMLIPKEGKE-------------KRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCCccccccCCC-------------CCEEECCcCCCeE
Confidence            4899998665443331             2367888888543


No 19 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=87.38  E-value=0.47  Score=26.97  Aligned_cols=35  Identities=23%  Similarity=0.603  Sum_probs=19.2

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      -||.|||......-.  ..      -...+.-+.|+.||....
T Consensus         3 PCPfCGg~~~~~~~~--~~------~~~~~~~~~C~~Cga~~~   37 (53)
T TIGR03655         3 PCPFCGGADVYLRRG--FD------PLDLSHYFECSTCGASGP   37 (53)
T ss_pred             CCCCCCCcceeeEec--cC------CCCCEEEEECCCCCCCcc
Confidence            499999987733210  00      011122236899987653


No 20 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=87.36  E-value=0.6  Score=31.08  Aligned_cols=45  Identities=16%  Similarity=0.270  Sum_probs=31.2

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      ....||.|+|.++.++-|....----.++..+..=+.|+.||+.+
T Consensus        90 ~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   90 IFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            348999999999888766554442223334455678899999864


No 21 
>PF14369 zf-RING_3:  zinc-finger
Probab=87.18  E-value=0.52  Score=25.45  Aligned_cols=27  Identities=22%  Similarity=0.423  Sum_probs=15.7

Q ss_pred             EEEcCCceeeeeeecCCCCCCCCCcce
Q 038108            4 VYVCSEEERELGRQQAPGSCPYCGGKV   30 (67)
Q Consensus         4 ~~vcde~~kv~~~~~ApG~Cp~CGG~v   30 (67)
                      +.-|++.=.+.......-+||+|+|+-
T Consensus         5 Ch~C~~~V~~~~~~~~~~~CP~C~~gF   31 (35)
T PF14369_consen    5 CHQCNRFVRIAPSPDSDVACPRCHGGF   31 (35)
T ss_pred             CccCCCEeEeCcCCCCCcCCcCCCCcE
Confidence            344444434433444555799999975


No 22 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.08  E-value=0.87  Score=25.02  Aligned_cols=13  Identities=46%  Similarity=1.111  Sum_probs=8.0

Q ss_pred             CCCCCCCCcceEE
Q 038108           20 PGSCPYCGGKVLA   32 (67)
Q Consensus        20 pG~Cp~CGG~v~a   32 (67)
                      +..||+||+.+..
T Consensus        21 ~~~Cp~CG~~~~~   33 (46)
T PRK00398         21 GVRCPYCGYRILF   33 (46)
T ss_pred             ceECCCCCCeEEE
Confidence            4567777666553


No 23 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=86.95  E-value=0.85  Score=26.57  Aligned_cols=38  Identities=26%  Similarity=0.690  Sum_probs=25.5

Q ss_pred             EEcCCceeeeeeecCCCCCC--CCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108            5 YVCSEEERELGRQQAPGSCP--YCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus         5 ~vcde~~kv~~~~~ApG~Cp--~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      +=+|+++||.+.+   -.||  +||.+|-.++-               +.|++|-.||
T Consensus         6 Ykvd~~Gkv~r~r---k~CP~~~CG~GvFMA~H---------------~dR~~CGKCg   45 (47)
T PF01599_consen    6 YKVDENGKVKRLR---KECPSPRCGAGVFMAEH---------------KDRHYCGKCG   45 (47)
T ss_dssp             CEEETTTEEEESS---EE-TSTTTTSSSEEEE----------------SSEEEETTTS
T ss_pred             EEECCCCcEEEhh---hcCCCcccCCceEeeec---------------CCCccCCCcc
Confidence            3468888887644   4699  99999865543               4577777776


No 24 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=86.67  E-value=0.78  Score=26.45  Aligned_cols=37  Identities=19%  Similarity=0.504  Sum_probs=23.3

Q ss_pred             cCCceeeeeeecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108            7 CSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus         7 cde~~kv~~~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      +|.+ +|....+   -||+||..+.+.                ++.++.|..||...
T Consensus        11 v~~~-~v~~~~~---fCP~Cg~~~m~~----------------~~~r~~C~~Cgyt~   47 (50)
T PRK00432         11 VDGG-KVKRKNK---FCPRCGSGFMAE----------------HLDRWHCGKCGYTE   47 (50)
T ss_pred             ECCC-EEEEccC---cCcCCCcchhec----------------cCCcEECCCcCCEE
Confidence            3543 6654443   899999752222                23688899998653


No 25 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=85.96  E-value=0.47  Score=32.49  Aligned_cols=24  Identities=25%  Similarity=0.689  Sum_probs=19.2

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      ..-.||.||.                    .+.|.+.|+.||..
T Consensus       308 tS~~C~~cg~--------------------~~~r~~~C~~cg~~  331 (364)
T COG0675         308 TSKTCPCCGH--------------------LSGRLFKCPRCGFV  331 (364)
T ss_pred             CcccccccCC--------------------ccceeEECCCCCCe
Confidence            3357999999                    45788999999964


No 26 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=85.75  E-value=0.98  Score=24.05  Aligned_cols=20  Identities=30%  Similarity=0.640  Sum_probs=14.1

Q ss_pred             eeeeeeecCCCCCCCCCcce
Q 038108           11 ERELGRQQAPGSCPYCGGKV   30 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG~v   30 (67)
                      +-+.....+|..||-||.+-
T Consensus         9 G~i~~g~~~p~~CP~Cg~~~   28 (34)
T cd00729           9 GYIHEGEEAPEKCPICGAPK   28 (34)
T ss_pred             CCEeECCcCCCcCcCCCCch
Confidence            33434456899999999864


No 27 
>PRK10445 endonuclease VIII; Provisional
Probab=85.74  E-value=0.95  Score=32.92  Aligned_cols=29  Identities=28%  Similarity=0.728  Sum_probs=21.4

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      +...||+||+.+.-+.+-.             ...|+|+.|-
T Consensus       234 ~g~~Cp~Cg~~I~~~~~~g-------------R~t~~CP~CQ  262 (263)
T PRK10445        234 DGEACERCGGIIEKTTLSS-------------RPFYWCPGCQ  262 (263)
T ss_pred             CCCCCCCCCCEeEEEEECC-------------CCcEECCCCc
Confidence            4456999999999887753             5567777663


No 28 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=85.35  E-value=0.8  Score=33.45  Aligned_cols=26  Identities=15%  Similarity=0.583  Sum_probs=20.1

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      .||+||+.+.-..+..             ...|+|+.|-
T Consensus       246 pCprCG~~I~~~~~~g-------------R~t~~CP~CQ  271 (272)
T PRK14810        246 PCLNCKTPIRRVVVAG-------------RSSHYCPHCQ  271 (272)
T ss_pred             cCCCCCCeeEEEEECC-------------CccEECcCCc
Confidence            5999999998777753             5667777774


No 29 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=84.91  E-value=0.38  Score=36.58  Aligned_cols=45  Identities=24%  Similarity=0.499  Sum_probs=34.2

Q ss_pred             cCCCCCCCCCcceEEEEe-----ceeeeEEEeeeEeeecc--eEEeccccce
Q 038108           18 QAPGSCPYCGGKVLAIDF-----ESQCRFCFLPICYNIKK--KYFCSLCSRR   62 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dv-----es~~rfCflP~~~k~kr--~~~Ct~C~r~   62 (67)
                      ...|.||-||+.-++.-+     +...|+..=++|.--|+  |..|+.||..
T Consensus       182 ~~~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~  233 (305)
T TIGR01562       182 ESRTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYVRVKCSHCEES  233 (305)
T ss_pred             CCCCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCcccccCccCCCCCCC
Confidence            457799999999766555     34568888888876664  7899999864


No 30 
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=84.49  E-value=0.9  Score=33.27  Aligned_cols=27  Identities=22%  Similarity=0.688  Sum_probs=20.5

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      ..||+||+.+.-.-+..             ...|+|+.|-
T Consensus       255 ~pC~~Cg~~I~~~~~~g-------------R~t~~CP~CQ  281 (282)
T PRK13945        255 KPCRKCGTPIERIKLAG-------------RSTHWCPNCQ  281 (282)
T ss_pred             CCCCcCCCeeEEEEECC-------------CccEECCCCc
Confidence            46999999998877754             5667777773


No 31 
>PRK00420 hypothetical protein; Validated
Probab=84.26  E-value=0.87  Score=30.42  Aligned_cols=30  Identities=20%  Similarity=0.465  Sum_probs=22.1

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      ....||.||.                |++.-...+.+|..||..+.
T Consensus        22 l~~~CP~Cg~----------------pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         22 LSKHCPVCGL----------------PLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             ccCCCCCCCC----------------cceecCCCceECCCCCCeee
Confidence            4578999985                44443667889999998764


No 32 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=82.40  E-value=0.8  Score=35.00  Aligned_cols=43  Identities=21%  Similarity=0.496  Sum_probs=32.2

Q ss_pred             CCCCCCCCCcceEEE--Ee--ceeeeEEEeeeEeeecc--eEEeccccc
Q 038108           19 APGSCPYCGGKVLAI--DF--ESQCRFCFLPICYNIKK--KYFCSLCSR   61 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~--Dv--es~~rfCflP~~~k~kr--~~~Ct~C~r   61 (67)
                      ..|.||-||+.-++.  +.  +...|++.=++|.--|+  |..|+.||.
T Consensus       186 ~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~  234 (309)
T PRK03564        186 QRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVRVKCSNCEQ  234 (309)
T ss_pred             CCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccCccCCCCCC
Confidence            579999999985433  33  34578888888876664  789999985


No 33 
>PF12773 DZR:  Double zinc ribbon
Probab=82.22  E-value=0.36  Score=26.45  Aligned_cols=14  Identities=21%  Similarity=0.418  Sum_probs=7.9

Q ss_pred             ecceEEecccccee
Q 038108           50 IKKKYFCSLCSRRL   63 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L   63 (67)
                      .....+|+.||+.+
T Consensus        26 ~~~~~~C~~Cg~~~   39 (50)
T PF12773_consen   26 DQSKKICPNCGAEN   39 (50)
T ss_pred             cCCCCCCcCCcCCC
Confidence            34455666666654


No 34 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=82.05  E-value=1.6  Score=27.08  Aligned_cols=38  Identities=21%  Similarity=0.357  Sum_probs=26.4

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEec--cccceeeee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCS--LCSRRLELY   66 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct--~C~r~L~~~   66 (67)
                      -||.||..+.+.|=+-..     +.  -..+.+.|+  .||.+.+++
T Consensus         3 ~CP~Cg~~a~irtSr~~s-----~~--~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678          3 HCPLCQHAAHARTSRYIT-----DT--TKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             cCCCCCCccEEEEChhcC-----hh--hheeeeecCCCCCCCEEEEE
Confidence            499999999665543222     22  245677899  999988775


No 35 
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=82.00  E-value=1.3  Score=32.25  Aligned_cols=26  Identities=27%  Similarity=0.733  Sum_probs=19.8

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccc
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLC   59 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C   59 (67)
                      -.||+||+.+.-.-+..             ...|+|+.|
T Consensus       246 ~pC~~Cg~~I~~~~~~g-------------R~t~~CP~C  271 (272)
T TIGR00577       246 EPCRRCGTPIEKIKVGG-------------RGTHFCPQC  271 (272)
T ss_pred             CCCCCCCCeeEEEEECC-------------CCCEECCCC
Confidence            36999999998877763             566777766


No 36 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=81.85  E-value=1.6  Score=25.74  Aligned_cols=32  Identities=28%  Similarity=0.581  Sum_probs=21.9

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      ..||.||..+..-|....             --+.|..||+.|..
T Consensus         3 ~~CP~CG~~iev~~~~~G-------------eiV~Cp~CGaeleV   34 (54)
T TIGR01206         3 FECPDCGAEIELENPELG-------------ELVICDECGAELEV   34 (54)
T ss_pred             cCCCCCCCEEecCCCccC-------------CEEeCCCCCCEEEE
Confidence            479999998766543211             13588999988875


No 37 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=81.67  E-value=1.5  Score=23.83  Aligned_cols=29  Identities=38%  Similarity=0.840  Sum_probs=20.3

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      .||+||..-...|-+              .-.++|+.||..|.
T Consensus         2 ~Cp~Cg~~~~~~D~~--------------~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPE--------------RGELVCPNCGLVLE   30 (43)
T ss_dssp             SBTTTSSSEEEEETT--------------TTEEEETTT-BBEE
T ss_pred             CCcCCcCCceEEcCC--------------CCeEECCCCCCEee
Confidence            599999987655533              34568899998775


No 38 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=81.56  E-value=1.1  Score=24.26  Aligned_cols=29  Identities=28%  Similarity=0.639  Sum_probs=13.9

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccc
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSR   61 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r   61 (67)
                      -||.||++++-.=.+-           -...|+.|+.||.
T Consensus         2 fC~~CG~~l~~~ip~g-----------d~r~R~vC~~Cg~   30 (34)
T PF14803_consen    2 FCPQCGGPLERRIPEG-----------DDRERLVCPACGF   30 (34)
T ss_dssp             B-TTT--B-EEE--TT------------SS-EEEETTTTE
T ss_pred             ccccccChhhhhcCCC-----------CCccceECCCCCC
Confidence            3999999987653311           1344567888875


No 39 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=81.00  E-value=1.7  Score=31.63  Aligned_cols=28  Identities=25%  Similarity=0.777  Sum_probs=20.7

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccc
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSR   61 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r   61 (67)
                      -.||+||+.+.-..+..             ...|+|+.|-+
T Consensus       246 ~pC~~Cg~~I~~~~~~g-------------R~t~~CP~CQ~  273 (274)
T PRK01103        246 EPCRRCGTPIEKIKQGG-------------RSTFFCPRCQK  273 (274)
T ss_pred             CCCCCCCCeeEEEEECC-------------CCcEECcCCCC
Confidence            36999999998777653             56677777753


No 40 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=80.59  E-value=1.1  Score=23.16  Aligned_cols=17  Identities=18%  Similarity=0.192  Sum_probs=9.5

Q ss_pred             CCCCCCCcceEEEEece
Q 038108           21 GSCPYCGGKVLAIDFES   37 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves   37 (67)
                      .-||+||++...++=+.
T Consensus         4 rfC~~CG~~t~~~~~g~   20 (32)
T PF09297_consen    4 RFCGRCGAPTKPAPGGW   20 (32)
T ss_dssp             SB-TTT--BEEE-SSSS
T ss_pred             cccCcCCccccCCCCcC
Confidence            56999999988766543


No 41 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=80.52  E-value=1.8  Score=24.44  Aligned_cols=33  Identities=21%  Similarity=0.587  Sum_probs=19.4

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccc
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSR   61 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r   61 (67)
                      -||-||.+....+-+..+.---.       -.+.|+.||.
T Consensus         5 PCPFCG~~~~~~~~~~~~~~~~~-------~~V~C~~Cga   37 (61)
T PF14354_consen    5 PCPFCGSADVLIRQDEGFDYGMY-------YYVECTDCGA   37 (61)
T ss_pred             CCCCCCCcceEeecccCCCCCCE-------EEEEcCCCCC
Confidence            39999777766665433210000       3467888987


No 42 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=79.13  E-value=1.8  Score=31.58  Aligned_cols=28  Identities=29%  Similarity=0.731  Sum_probs=21.2

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccc
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSR   61 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r   61 (67)
                      -.||+||+.+.-.-+-.             ...|+|+.|-+
T Consensus       236 ~pC~~Cg~~I~~~~~~g-------------R~ty~Cp~CQ~  263 (269)
T PRK14811        236 QPCPRCGTPIEKIVVGG-------------RGTHFCPQCQP  263 (269)
T ss_pred             CCCCcCCCeeEEEEECC-------------CCcEECCCCcC
Confidence            36999999998877753             56677777754


No 43 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=77.89  E-value=2.1  Score=29.50  Aligned_cols=27  Identities=33%  Similarity=0.845  Sum_probs=20.8

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      -.||.||                .||+. .--.++|+.|+.+-+
T Consensus        29 ~hCp~Cg----------------~PLF~-KdG~v~CPvC~~~~~   55 (131)
T COG1645          29 KHCPKCG----------------TPLFR-KDGEVFCPVCGYREV   55 (131)
T ss_pred             hhCcccC----------------Cccee-eCCeEECCCCCceEE
Confidence            4688888                68877 667899999996544


No 44 
>COG3464 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=77.82  E-value=3.5  Score=31.92  Aligned_cols=47  Identities=23%  Similarity=0.460  Sum_probs=31.0

Q ss_pred             ecCCCCCCCCCcceEEEEeceeeeEEEeeeEe------eecceEEecccccee
Q 038108           17 QQAPGSCPYCGGKVLAIDFESQCRFCFLPICY------NIKKKYFCSLCSRRL   63 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~------k~kr~~~Ct~C~r~L   63 (67)
                      -+....||.||++----+----..+++||+.-      =.+|+|.|+.|+..-
T Consensus        35 ~~~~~~CP~Cg~~~~~~~~~~~~~I~~L~~~~~~~~L~~r~rR~~c~~c~~~~   87 (402)
T COG3464          35 MPRKHRCPECGQRTIRRHGWRIRKIQDLPLFEVPVYLFLRKRRYKCCRCGKRF   87 (402)
T ss_pred             ecccCCCCCCCCcceeccccceeeeeecccCCeeEEEEeccceeecccCCCCc
Confidence            33349999999997111111245677886543      357899999999864


No 45 
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=76.21  E-value=2.9  Score=29.85  Aligned_cols=38  Identities=24%  Similarity=0.555  Sum_probs=24.7

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeec-ceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIK-KKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~k-r~~~Ct~C~r~L   63 (67)
                      -||.||+......+.++-    ||.+.+.= -.|.|..||-+-
T Consensus         2 ~Cp~C~~~~~~~~~~~~~----IP~F~evii~sf~C~~CGyr~   40 (192)
T TIGR00310         2 DCPSCGGECETVMKTVND----IPYFGEVLETSTICEHCGYRS   40 (192)
T ss_pred             cCCCCCCCCEEEEEEEcC----CCCcceEEEEEEECCCCCCcc
Confidence            499999875544443331    66555543 478999999663


No 46 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=75.43  E-value=2.3  Score=30.07  Aligned_cols=23  Identities=35%  Similarity=0.729  Sum_probs=15.8

Q ss_pred             EcCCceeeeeeecCCCCCCCCCcc
Q 038108            6 VCSEEERELGRQQAPGSCPYCGGK   29 (67)
Q Consensus         6 vcde~~kv~~~~~ApG~Cp~CGG~   29 (67)
                      +|-.-+-.... .||+.||-||.+
T Consensus       136 vC~vCGy~~~g-e~P~~CPiCga~  158 (166)
T COG1592         136 VCPVCGYTHEG-EAPEVCPICGAP  158 (166)
T ss_pred             EcCCCCCcccC-CCCCcCCCCCCh
Confidence            34444444444 899999999975


No 47 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=75.39  E-value=3.5  Score=25.72  Aligned_cols=38  Identities=16%  Similarity=0.510  Sum_probs=20.9

Q ss_pred             cCCCCCCCCC-cceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           18 QAPGSCPYCG-GKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        18 ~ApG~Cp~CG-G~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      +.-=.||.|| ...+.++|+..          ...-...|..||.....
T Consensus        20 ~~~F~CPfC~~~~sV~v~idkk----------~~~~~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   20 PKVFDCPFCNHEKSVSVKIDKK----------EGIGILSCRVCGESFQT   58 (81)
T ss_dssp             SS----TTT--SS-EEEEEETT----------TTEEEEEESSS--EEEE
T ss_pred             CceEcCCcCCCCCeEEEEEEcc----------CCEEEEEecCCCCeEEE
Confidence            3456799999 77777888665          33456789999876543


No 48 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=75.09  E-value=4.5  Score=20.33  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=8.5

Q ss_pred             CCCCCCcceEEEEe
Q 038108           22 SCPYCGGKVLAIDF   35 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dv   35 (67)
                      .||+||..+.-+.+
T Consensus         3 ~C~rC~~~~~~~~~   16 (30)
T PF06827_consen    3 KCPRCWNYIEDIGI   16 (30)
T ss_dssp             B-TTT--BBEEEEE
T ss_pred             cCccCCCcceEeEe
Confidence            59999999876665


No 49 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=74.05  E-value=1.6  Score=29.36  Aligned_cols=25  Identities=48%  Similarity=1.011  Sum_probs=15.3

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .||+|+.+|           |-||        ..|..||-.|+|
T Consensus         3 ~CPrC~skv-----------C~LP--------~~CpiCgLtLVs   27 (112)
T TIGR00622         3 FCPQCRAKV-----------CELP--------VECPICGLTLIL   27 (112)
T ss_pred             cCCCCCCCc-----------cCCC--------CcCCcCCCEEec
Confidence            477777765           5565        345666666554


No 50 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=73.65  E-value=0.88  Score=31.03  Aligned_cols=31  Identities=16%  Similarity=0.293  Sum_probs=19.3

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      =.||+||-..+..|.-+              .-|.|+.||..|+-
T Consensus       110 Y~Cp~c~~r~tf~eA~~--------------~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       110 FICPNMCVRFTFNEAME--------------LNFTCPRCGAMLDY  140 (158)
T ss_pred             EECCCCCcEeeHHHHHH--------------cCCcCCCCCCEeee
Confidence            35777776665555443              15777777777764


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=72.85  E-value=3.8  Score=21.33  Aligned_cols=14  Identities=43%  Similarity=1.016  Sum_probs=11.0

Q ss_pred             ecCCCCCCCCCcce
Q 038108           17 QQAPGSCPYCGGKV   30 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v   30 (67)
                      ..++-.||-||.+-
T Consensus        14 ~~~~~~CP~Cg~~~   27 (33)
T cd00350          14 EEAPWVCPVCGAPK   27 (33)
T ss_pred             CcCCCcCcCCCCcH
Confidence            34889999999764


No 52 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=71.54  E-value=5.4  Score=21.27  Aligned_cols=26  Identities=23%  Similarity=0.655  Sum_probs=18.1

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      .|+.|||...               .++.+--++|..||..
T Consensus         5 ~C~~C~~~~i---------------~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    5 KCSKCGGNGI---------------VNKEDDYEVCIFCGSS   30 (33)
T ss_pred             EcCCCCCCeE---------------EEecCCeEEcccCCcE
Confidence            5888888763               3366667777777764


No 53 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.38  E-value=6.3  Score=21.48  Aligned_cols=12  Identities=42%  Similarity=1.163  Sum_probs=10.3

Q ss_pred             ecCCCCCCCCCc
Q 038108           17 QQAPGSCPYCGG   28 (67)
Q Consensus        17 ~~ApG~Cp~CGG   28 (67)
                      +..+-.||.||+
T Consensus        23 ~~~~~~CP~Cg~   34 (42)
T PF09723_consen   23 EDDPVPCPECGS   34 (42)
T ss_pred             CCCCCcCCCCCC
Confidence            467889999999


No 54 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=70.91  E-value=2.2  Score=28.44  Aligned_cols=14  Identities=36%  Similarity=0.762  Sum_probs=12.0

Q ss_pred             CCCCCCCcceEEEE
Q 038108           21 GSCPYCGGKVLAID   34 (67)
Q Consensus        21 G~Cp~CGG~v~a~D   34 (67)
                      -.||+||+.+.-.|
T Consensus       124 f~Cp~Cg~~l~~~d  137 (147)
T smart00531      124 FTCPRCGEELEEDD  137 (147)
T ss_pred             EECCCCCCEEEEcC
Confidence            68999999998766


No 55 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=70.77  E-value=6.3  Score=20.31  Aligned_cols=12  Identities=42%  Similarity=1.179  Sum_probs=9.5

Q ss_pred             cCCCCCCCCCcc
Q 038108           18 QAPGSCPYCGGK   29 (67)
Q Consensus        18 ~ApG~Cp~CGG~   29 (67)
                      ...-.||.||+.
T Consensus        24 ~~~~~CP~Cg~~   35 (41)
T smart00834       24 DPLATCPECGGD   35 (41)
T ss_pred             CCCCCCCCCCCc
Confidence            556789999984


No 56 
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=70.47  E-value=5.4  Score=27.61  Aligned_cols=35  Identities=29%  Similarity=0.666  Sum_probs=24.8

Q ss_pred             CCCCCCcceEEEEeceeeeEE--EeeeEeeecc-eEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFC--FLPICYNIKK-KYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfC--flP~~~k~kr-~~~Ct~C~r~L   63 (67)
                      .||.||+...       +|++  =||.+.+.== .|.|..||-+-
T Consensus         2 ~Cp~C~~~~~-------~~~~~~~IP~F~evii~sf~C~~CGyk~   39 (160)
T smart00709        2 DCPSCGGNGT-------TRMLLTSIPYFREVIIMSFECEHCGYRN   39 (160)
T ss_pred             cCCCCCCCCE-------EEEEEecCCCcceEEEEEEECCCCCCcc
Confidence            5999998643       3444  3787766554 89999999653


No 57 
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=70.42  E-value=4.6  Score=28.17  Aligned_cols=35  Identities=31%  Similarity=0.833  Sum_probs=23.0

Q ss_pred             CCCCCcc-eEEEEeceeeeEEEeeeEeeec-ceEEeccccce
Q 038108           23 CPYCGGK-VLAIDFESQCRFCFLPICYNIK-KKYFCSLCSRR   62 (67)
Q Consensus        23 Cp~CGG~-v~a~Dves~~rfCflP~~~k~k-r~~~Ct~C~r~   62 (67)
                      ||.||+. +......+     =||.+.+.= -.|.|..||-+
T Consensus         1 CP~Cg~~~~~~~~~~~-----~IP~F~evii~sf~C~~CGyr   37 (163)
T TIGR00340         1 CPVCGSRTLKAVTYDY-----DIPYFGKIMLSTYICEKCGYR   37 (163)
T ss_pred             CCCCCCcceEeeeEec-----cCCCcceEEEEEEECCCCCCc
Confidence            9999996 44433322     267665543 47899999865


No 58 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=69.81  E-value=5  Score=22.54  Aligned_cols=27  Identities=33%  Similarity=0.650  Sum_probs=13.7

Q ss_pred             EEcCCceeeeee-ecCCCCCCCCCcceE
Q 038108            5 YVCSEEERELGR-QQAPGSCPYCGGKVL   31 (67)
Q Consensus         5 ~vcde~~kv~~~-~~ApG~Cp~CGG~v~   31 (67)
                      |+|.+=+..+.. ...+-.||+||..+.
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~rIl   30 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGYRIL   30 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCceEE
Confidence            444443333322 345566777776654


No 59 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=69.79  E-value=1.1  Score=31.37  Aligned_cols=32  Identities=22%  Similarity=0.313  Sum_probs=21.2

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      -=.||+||-..+..|.-+              .-|.|+.||..|+-
T Consensus       117 ~Y~Cp~C~~rytf~eA~~--------------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME--------------YGFRCPQCGEMLEE  148 (178)
T ss_pred             EEECCCCCcEEeHHHHhh--------------cCCcCCCCCCCCee
Confidence            345788777776666543              25778888877764


No 60 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=69.52  E-value=3.3  Score=21.27  Aligned_cols=18  Identities=33%  Similarity=0.767  Sum_probs=9.5

Q ss_pred             CCCCCCcceEEEEeceee
Q 038108           22 SCPYCGGKVLAIDFESQC   39 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~   39 (67)
                      -||-||..+.-.+=|..+
T Consensus         1 ~CP~C~s~l~~~~~ev~~   18 (28)
T PF03119_consen    1 TCPVCGSKLVREEGEVDI   18 (28)
T ss_dssp             B-TTT--BEEE-CCTTCE
T ss_pred             CcCCCCCEeEcCCCCEeE
Confidence            399999999865555443


No 61 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=69.49  E-value=3.6  Score=24.10  Aligned_cols=11  Identities=45%  Similarity=1.310  Sum_probs=9.2

Q ss_pred             CCCCCCcceEE
Q 038108           22 SCPYCGGKVLA   32 (67)
Q Consensus        22 ~Cp~CGG~v~a   32 (67)
                      .|||||-.+..
T Consensus         2 ~CPyCge~~~~   12 (52)
T PF14255_consen    2 QCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCeeEE
Confidence            59999998765


No 62 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=68.30  E-value=1.6  Score=31.13  Aligned_cols=45  Identities=22%  Similarity=0.477  Sum_probs=27.7

Q ss_pred             ecCCCCCCCCCcceEEEEeceeeeEEEee--eEeeecceEEecccccee
Q 038108           17 QQAPGSCPYCGGKVLAIDFESQCRFCFLP--ICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~a~Dves~~rfCflP--~~~k~kr~~~Ct~C~r~L   63 (67)
                      ++--..||.|+|.+..+.=|..--  =||  ++..+-.=+.|+.||+.+
T Consensus        94 ~~e~~RCp~CN~~L~~vs~eev~~--~Vp~~~~~~~~~f~~C~~CgkiY  140 (165)
T COG1656          94 FPEFSRCPECNGELEKVSREEVKE--KVPEKVYRNYEEFYRCPKCGKIY  140 (165)
T ss_pred             ccccccCcccCCEeccCcHHHHhh--ccchhhhhcccceeECCCCcccc
Confidence            445678999999988765443110  034  334444444599999864


No 63 
>PRK09401 reverse gyrase; Reviewed
Probab=66.90  E-value=2.2  Score=37.39  Aligned_cols=14  Identities=43%  Similarity=1.020  Sum_probs=11.3

Q ss_pred             CCCCCCCCcceEEE
Q 038108           20 PGSCPYCGGKVLAI   33 (67)
Q Consensus        20 pG~Cp~CGG~v~a~   33 (67)
                      .++||+|||.++.-
T Consensus         7 ~~~cpnc~g~i~~~   20 (1176)
T PRK09401          7 KNSCPNCGGDISDE   20 (1176)
T ss_pred             cccCCCCCCcCcHh
Confidence            47899999998743


No 64 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=66.41  E-value=3.8  Score=22.80  Aligned_cols=13  Identities=38%  Similarity=0.848  Sum_probs=10.1

Q ss_pred             CCCCCCcceEEEE
Q 038108           22 SCPYCGGKVLAID   34 (67)
Q Consensus        22 ~Cp~CGG~v~a~D   34 (67)
                      -||.||..+.+--
T Consensus         1 ~CP~Cg~~a~ir~   13 (47)
T PF04606_consen    1 RCPHCGSKARIRT   13 (47)
T ss_pred             CcCCCCCeeEEEE
Confidence            3999999886653


No 65 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=66.01  E-value=4.7  Score=26.99  Aligned_cols=14  Identities=36%  Similarity=1.187  Sum_probs=11.9

Q ss_pred             CCCCCcceEEEEec
Q 038108           23 CPYCGGKVLAIDFE   36 (67)
Q Consensus        23 Cp~CGG~v~a~Dve   36 (67)
                      ||-|||.+.++.++
T Consensus         1 CPvCg~~l~vt~l~   14 (113)
T PF09862_consen    1 CPVCGGELVVTRLK   14 (113)
T ss_pred             CCCCCCceEEEEEE
Confidence            89999999988664


No 66 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=65.36  E-value=5  Score=28.14  Aligned_cols=39  Identities=21%  Similarity=0.503  Sum_probs=26.7

Q ss_pred             CCCCCCc-ceEEEEeceeeeEEEeeeEeeecceEEeccccceeeee
Q 038108           22 SCPYCGG-KVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELY   66 (67)
Q Consensus        22 ~Cp~CGG-~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~~   66 (67)
                      -||+||. --.++|=+..-      =-..++|+=.|..||+|..+|
T Consensus         2 ~CP~C~~~dtkViDSR~~~------dg~~IRRRReC~~C~~RFTTy   41 (147)
T TIGR00244         2 HCPFCQHHNTRVLDSRLVE------DGQSIRRRRECLECHERFTTF   41 (147)
T ss_pred             CCCCCCCCCCEeeeccccC------CCCeeeecccCCccCCcccee
Confidence            4999998 45566644211      112467888999999998877


No 67 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=65.05  E-value=5.2  Score=20.79  Aligned_cols=13  Identities=23%  Similarity=0.378  Sum_probs=7.8

Q ss_pred             ceEEeccccceee
Q 038108           52 KKYFCSLCSRRLE   64 (67)
Q Consensus        52 r~~~Ct~C~r~L~   64 (67)
                      .++.|+.|+..+.
T Consensus        24 ~~v~C~~C~~~~~   36 (38)
T TIGR02098        24 GKVRCGKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEE
Confidence            3566676666554


No 68 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=64.94  E-value=2.9  Score=37.46  Aligned_cols=20  Identities=35%  Similarity=0.770  Sum_probs=15.1

Q ss_pred             CCCCCCCCcceEEEEeceee
Q 038108           20 PGSCPYCGGKVLAIDFESQC   39 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~   39 (67)
                      -++||+|||.++.-..++..
T Consensus         8 ~~~CpNCGG~isseRL~~gl   27 (1187)
T COG1110           8 GSSCPNCGGDISSERLEKGL   27 (1187)
T ss_pred             hccCCCCCCcCcHHHHhcCC
Confidence            37899999998876665544


No 69 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=64.38  E-value=4.5  Score=21.90  Aligned_cols=15  Identities=33%  Similarity=1.008  Sum_probs=11.7

Q ss_pred             ecCCCCCCCCCcceE
Q 038108           17 QQAPGSCPYCGGKVL   31 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~   31 (67)
                      -+.+|.|..|||.+.
T Consensus        18 P~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen   18 PKVEGVCDNCGGELV   32 (36)
T ss_dssp             -SSTTBCTTTTEBEB
T ss_pred             CCCCCccCCCCCeeE
Confidence            456799999999764


No 70 
>PF07038 DUF1324:  Protein of unknown function (DUF1324);  InterPro: IPR009757 This family consists of several Circovirus proteins of around 60 residues in length. The function of this family is unknown.
Probab=63.46  E-value=5.9  Score=24.04  Aligned_cols=15  Identities=33%  Similarity=0.895  Sum_probs=12.7

Q ss_pred             eeeeEEEeeeEeeec
Q 038108           37 SQCRFCFLPICYNIK   51 (67)
Q Consensus        37 s~~rfCflP~~~k~k   51 (67)
                      -|.|||..|+-+|+.
T Consensus         7 fqsrfcifpltfkss   21 (59)
T PF07038_consen    7 FQSRFCIFPLTFKSS   21 (59)
T ss_pred             EeeeeEEEEeeeccC
Confidence            478999999999863


No 71 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=63.41  E-value=3.7  Score=24.10  Aligned_cols=29  Identities=34%  Similarity=0.851  Sum_probs=16.5

Q ss_pred             EEcCCceeeee--eecCCCCCCCCCcceEEE
Q 038108            5 YVCSEEERELG--RQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus         5 ~vcde~~kv~~--~~~ApG~Cp~CGG~v~a~   33 (67)
                      ++|-.-++.+.  ...-.-.|||||..+-.-
T Consensus         7 Y~C~~Cg~~~~~~~~~~~irCp~Cg~rIl~K   37 (49)
T COG1996           7 YKCARCGREVELDQETRGIRCPYCGSRILVK   37 (49)
T ss_pred             EEhhhcCCeeehhhccCceeCCCCCcEEEEe
Confidence            44444444443  123345699999987643


No 72 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=62.64  E-value=3.5  Score=23.09  Aligned_cols=10  Identities=60%  Similarity=1.507  Sum_probs=5.8

Q ss_pred             CCCCCCCCcc
Q 038108           20 PGSCPYCGGK   29 (67)
Q Consensus        20 pG~Cp~CGG~   29 (67)
                      ++.||+||-+
T Consensus         2 ~~~CprC~kg   11 (36)
T PF14787_consen    2 PGLCPRCGKG   11 (36)
T ss_dssp             --C-TTTSSS
T ss_pred             CccCcccCCC
Confidence            6899999854


No 73 
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=62.21  E-value=1.4  Score=27.41  Aligned_cols=57  Identities=23%  Similarity=0.357  Sum_probs=36.1

Q ss_pred             EEEcCCceeeeeeecCCCCCCCCCcceEEE---EeceeeeEEEeeeE----eeecceEEecccccee
Q 038108            4 VYVCSEEERELGRQQAPGSCPYCGGKVLAI---DFESQCRFCFLPIC----YNIKKKYFCSLCSRRL   63 (67)
Q Consensus         4 ~~vcde~~kv~~~~~ApG~Cp~CGG~v~a~---Dves~~rfCflP~~----~k~kr~~~Ct~C~r~L   63 (67)
                      +|.|.+++|..   .|-|+|-.||-++=.-   ..|....=---|+-    .+.-+|+.|+-|...+
T Consensus         3 CY~Ca~~gkdt---~AVavCivCG~GlC~~H~~~e~~~~~~g~yp~~~~~~~~~l~RilC~~C~~a~   66 (68)
T PF09947_consen    3 CYDCAEEGKDT---DAVAVCIVCGAGLCMDHSKREEIPVWEGGYPFPSKKLKKPLPRILCPECHAAL   66 (68)
T ss_pred             chhhhhcCCCc---cceehHHhcCchhhHHHHhhhheeeeccCCCCccccccCCCCeeecHHHHHHh
Confidence            56788888743   8999999999887321   11111111234544    3455889999887654


No 74 
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=62.04  E-value=1.5  Score=33.34  Aligned_cols=24  Identities=17%  Similarity=0.012  Sum_probs=18.6

Q ss_pred             cCCceeeeeeecCCCCCCCCCcce
Q 038108            7 CSEEERELGRQQAPGSCPYCGGKV   30 (67)
Q Consensus         7 cde~~kv~~~~~ApG~Cp~CGG~v   30 (67)
                      +|--++|+.+.+-|+.||+|||-.
T Consensus       141 ~dva~~v~~~hfLpd~~gn~r~f~  164 (253)
T COG1933         141 HDVAERVLNSHFIPDLRGNLRSFT  164 (253)
T ss_pred             HHHHHHhhccCCCcchhhhhhhhh
Confidence            455578888888899998888753


No 75 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=62.02  E-value=4  Score=24.45  Aligned_cols=24  Identities=33%  Similarity=0.948  Sum_probs=17.0

Q ss_pred             eeeeeeecCC-CCCCCCCcceEEEE
Q 038108           11 ERELGRQQAP-GSCPYCGGKVLAID   34 (67)
Q Consensus        11 ~kv~~~~~Ap-G~Cp~CGG~v~a~D   34 (67)
                      +|++=.+..| |.||.||..+.-.|
T Consensus        25 GkIiC~~Eg~~~pC~fCg~~l~~~~   49 (57)
T PF06221_consen   25 GKIICEQEGPLGPCPFCGTPLLSSE   49 (57)
T ss_pred             ChhhcccccCcCcCCCCCCcccCHH
Confidence            5666677774 89999997765443


No 76 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=61.43  E-value=4.6  Score=17.87  Aligned_cols=12  Identities=17%  Similarity=0.886  Sum_probs=7.1

Q ss_pred             EEeccccceeee
Q 038108           54 YFCSLCSRRLEL   65 (67)
Q Consensus        54 ~~Ct~C~r~L~~   65 (67)
                      |.|+.|++...+
T Consensus         1 ~~C~~C~~~~~~   12 (24)
T PF13894_consen    1 FQCPICGKSFRS   12 (24)
T ss_dssp             EE-SSTS-EESS
T ss_pred             CCCcCCCCcCCc
Confidence            678888877654


No 77 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=61.22  E-value=4.7  Score=22.22  Aligned_cols=10  Identities=60%  Similarity=1.610  Sum_probs=8.3

Q ss_pred             CCCCCCCCcc
Q 038108           20 PGSCPYCGGK   29 (67)
Q Consensus        20 pG~Cp~CGG~   29 (67)
                      .+.||.|||.
T Consensus         3 ~~pCP~CGG~   12 (37)
T smart00778        3 HGPCPNCGGS   12 (37)
T ss_pred             ccCCCCCCCc
Confidence            4789999994


No 78 
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=61.13  E-value=3.5  Score=36.13  Aligned_cols=14  Identities=36%  Similarity=0.992  Sum_probs=11.5

Q ss_pred             CCCCCCCCcceEEE
Q 038108           20 PGSCPYCGGKVLAI   33 (67)
Q Consensus        20 pG~Cp~CGG~v~a~   33 (67)
                      .+.||+|||.+..-
T Consensus         7 ~~~CPnCgg~i~~~   20 (1171)
T TIGR01054         7 SNLCPNCGGEISSE   20 (1171)
T ss_pred             cCCCCCCCCccchh
Confidence            57899999998653


No 79 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=60.30  E-value=14  Score=22.85  Aligned_cols=30  Identities=27%  Similarity=0.638  Sum_probs=20.7

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      -.||.||..+.-+.....            |=.+.|--|++.
T Consensus         7 KPCPFCG~~~~~v~~~~g------------~~~v~C~~CgA~   36 (64)
T PRK09710          7 KPCPFCGCPSVTVKAISG------------YYRAKCNGCESR   36 (64)
T ss_pred             cCCCCCCCceeEEEecCc------------eEEEEcCCCCcC
Confidence            469999998776654322            225788888875


No 80 
>PF14353 CpXC:  CpXC protein
Probab=60.03  E-value=7.7  Score=24.78  Aligned_cols=35  Identities=26%  Similarity=0.408  Sum_probs=23.6

Q ss_pred             eeeeeecCCCCCCCCCcceEE------EEeceeeeEEEeee
Q 038108           12 RELGRQQAPGSCPYCGGKVLA------IDFESQCRFCFLPI   46 (67)
Q Consensus        12 kv~~~~~ApG~Cp~CGG~v~a------~Dves~~rfCflP~   46 (67)
                      +++.-+=.--.||+||....+      .|.+-++.+-+.|-
T Consensus        30 ~il~g~l~~~~CP~Cg~~~~~~~p~lY~D~~~~~~i~~~P~   70 (128)
T PF14353_consen   30 KILDGSLFSFTCPSCGHKFRLEYPLLYHDPEKKFMIYYFPD   70 (128)
T ss_pred             HHHcCCcCEEECCCCCCceecCCCEEEEcCCCCEEEEEcCC
Confidence            444444445689999987653      57777777777775


No 81 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=60.02  E-value=6.6  Score=21.29  Aligned_cols=13  Identities=38%  Similarity=1.035  Sum_probs=9.6

Q ss_pred             CCCCCCCcceEEE
Q 038108           21 GSCPYCGGKVLAI   33 (67)
Q Consensus        21 G~Cp~CGG~v~a~   33 (67)
                      ..||.|||.++.-
T Consensus         2 ~~CP~Cg~~lv~r   14 (39)
T PF01396_consen    2 EKCPKCGGPLVLR   14 (39)
T ss_pred             cCCCCCCceeEEE
Confidence            4799999876543


No 82 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=59.54  E-value=5.4  Score=22.34  Aligned_cols=17  Identities=24%  Similarity=0.663  Sum_probs=11.2

Q ss_pred             eeeEeeecceEEecccc
Q 038108           44 LPICYNIKKKYFCSLCS   60 (67)
Q Consensus        44 lP~~~k~kr~~~Ct~C~   60 (67)
                      .|+......+.+|..|+
T Consensus        25 ~PL~~~k~g~~~Cv~C~   41 (41)
T PF06677_consen   25 TPLMRDKDGKIYCVSCG   41 (41)
T ss_pred             CeeEEecCCCEECCCCC
Confidence            46666455567888875


No 83 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=59.46  E-value=5.2  Score=24.80  Aligned_cols=9  Identities=44%  Similarity=1.191  Sum_probs=6.8

Q ss_pred             CCCCCCcce
Q 038108           22 SCPYCGGKV   30 (67)
Q Consensus        22 ~Cp~CGG~v   30 (67)
                      -||.||+.+
T Consensus         2 fC~~Cg~~l   10 (104)
T TIGR01384         2 FCPKCGSLM   10 (104)
T ss_pred             CCcccCccc
Confidence            478888776


No 84 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=58.97  E-value=6.6  Score=25.46  Aligned_cols=18  Identities=17%  Similarity=0.259  Sum_probs=12.1

Q ss_pred             eeeeeeecCCCCCCCCCc
Q 038108           11 ERELGRQQAPGSCPYCGG   28 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG   28 (67)
                      +=++-..|+.+.|+.||.
T Consensus        61 ~L~I~~vp~~~~C~~Cg~   78 (113)
T PRK12380         61 DLHIVYKPAQAWCWDCSQ   78 (113)
T ss_pred             EEEEEeeCcEEEcccCCC
Confidence            345566777777888873


No 85 
>PRK11827 hypothetical protein; Provisional
Probab=58.86  E-value=8.1  Score=23.33  Aligned_cols=27  Identities=33%  Similarity=0.746  Sum_probs=17.7

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      +||.|.|.+.- |-+.+              ...|+.|+..+
T Consensus        10 aCP~ckg~L~~-~~~~~--------------~Lic~~~~laY   36 (60)
T PRK11827         10 ACPVCNGKLWY-NQEKQ--------------ELICKLDNLAF   36 (60)
T ss_pred             ECCCCCCcCeE-cCCCC--------------eEECCccCeec
Confidence            69999999864 33332              46677776554


No 86 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=58.08  E-value=3.9  Score=22.84  Aligned_cols=31  Identities=35%  Similarity=0.877  Sum_probs=13.0

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      .+.||.|||.         -||-..+ =.+..-.++|..|+
T Consensus         3 h~pCP~CGG~---------DrFri~~-d~~~~G~~~C~~C~   33 (40)
T PF08273_consen    3 HGPCPICGGK---------DRFRIFD-DKDGRGTWICRQCG   33 (40)
T ss_dssp             EE--TTTT-T---------TTEEEET-T----S-EEETTTT
T ss_pred             CCCCCCCcCc---------cccccCc-CcccCCCEECCCCC
Confidence            3679999993         2343111 11233567777773


No 87 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=57.47  E-value=28  Score=18.96  Aligned_cols=11  Identities=45%  Similarity=1.271  Sum_probs=8.5

Q ss_pred             cCCCCCCCCCc
Q 038108           18 QAPGSCPYCGG   28 (67)
Q Consensus        18 ~ApG~Cp~CGG   28 (67)
                      ..+-.||.||+
T Consensus        24 ~~~~~CP~Cg~   34 (52)
T TIGR02605        24 DPLATCPECGG   34 (52)
T ss_pred             CCCCCCCCCCC
Confidence            34557999998


No 88 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=57.19  E-value=12  Score=19.97  Aligned_cols=13  Identities=31%  Similarity=1.014  Sum_probs=7.4

Q ss_pred             CCCCCcceEEEEe
Q 038108           23 CPYCGGKVLAIDF   35 (67)
Q Consensus        23 Cp~CGG~v~a~Dv   35 (67)
                      ||.|+..+....+
T Consensus         2 CP~C~~~l~~~~~   14 (41)
T PF13453_consen    2 CPRCGTELEPVRL   14 (41)
T ss_pred             cCCCCcccceEEE
Confidence            7777765544333


No 89 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=57.13  E-value=4.3  Score=21.20  Aligned_cols=21  Identities=38%  Similarity=0.936  Sum_probs=11.7

Q ss_pred             eEEEeeeEeeecceEEecccccee
Q 038108           40 RFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        40 rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      .+|-|  |-. +.+|.|+.|+.++
T Consensus         3 ~~C~v--C~~-~~kY~Cp~C~~~~   23 (30)
T PF04438_consen    3 KLCSV--CGN-PAKYRCPRCGARY   23 (30)
T ss_dssp             EEETS--SSS-EESEE-TTT--EE
T ss_pred             CCCcc--CcC-CCEEECCCcCCce
Confidence            34443  444 7888898888775


No 90 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.05  E-value=9.2  Score=23.62  Aligned_cols=46  Identities=24%  Similarity=0.423  Sum_probs=34.7

Q ss_pred             eeeeeeecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           11 ERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      ...+...-.+-+||-=+++      -..-|. |||+  ..+.-..|+-||+++++
T Consensus        15 ~~~I~~~~~~l~C~g~~~p------~~HPrV-~L~m--g~~gev~CPYC~t~y~l   60 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPP------NDHPRV-FLDM--GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCC------CCCCEE-EEEc--CCCCcEecCccccEEEe
Confidence            4566777777777765555      455555 7898  88888999999999876


No 91 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=56.71  E-value=7.1  Score=22.40  Aligned_cols=19  Identities=26%  Similarity=0.506  Sum_probs=13.0

Q ss_pred             EeeecceEEeccccceeee
Q 038108           47 CYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        47 ~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .-+..++++|..||..|-.
T Consensus        42 s~~~~~r~FC~~CGs~l~~   60 (92)
T PF04828_consen   42 SGKGVERYFCPTCGSPLFS   60 (92)
T ss_dssp             TTSSCEEEEETTT--EEEE
T ss_pred             CCCcCcCcccCCCCCeeec
Confidence            3456688999999998864


No 92 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=55.97  E-value=12  Score=24.16  Aligned_cols=14  Identities=36%  Similarity=0.731  Sum_probs=11.3

Q ss_pred             ceEEeccccceeee
Q 038108           52 KKYFCSLCSRRLEL   65 (67)
Q Consensus        52 r~~~Ct~C~r~L~~   65 (67)
                      .+|.|..|+..|+.
T Consensus       142 ~~~~C~~C~~~l~~  155 (157)
T PF10263_consen  142 KRYRCGRCGGPLVQ  155 (157)
T ss_pred             hhEECCCCCCEEEE
Confidence            46889999988875


No 93 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=55.08  E-value=6.8  Score=19.20  Aligned_cols=14  Identities=29%  Similarity=0.764  Sum_probs=10.7

Q ss_pred             ecceEEecccccee
Q 038108           50 IKKKYFCSLCSRRL   63 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L   63 (67)
                      ..++|.|+.|++..
T Consensus        11 ~~k~~~C~~C~k~F   24 (26)
T PF13465_consen   11 GEKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSSEEESSSSEEE
T ss_pred             CCCCCCCCCCcCee
Confidence            35779999998864


No 94 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=54.21  E-value=9.2  Score=27.83  Aligned_cols=13  Identities=31%  Similarity=0.741  Sum_probs=9.3

Q ss_pred             CCCCCCCCcceEE
Q 038108           20 PGSCPYCGGKVLA   32 (67)
Q Consensus        20 pG~Cp~CGG~v~a   32 (67)
                      .--||+||.....
T Consensus        99 ~~fC~~CG~~~~~  111 (256)
T PRK00241         99 HRFCGYCGHPMHP  111 (256)
T ss_pred             CccccccCCCCee
Confidence            3468888887664


No 95 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=53.57  E-value=9.3  Score=24.78  Aligned_cols=18  Identities=11%  Similarity=0.375  Sum_probs=12.7

Q ss_pred             eeeeeeecCCCCCCCCCc
Q 038108           11 ERELGRQQAPGSCPYCGG   28 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG   28 (67)
                      +=.+...|+.+.|+.||-
T Consensus        61 ~L~I~~~p~~~~C~~Cg~   78 (115)
T TIGR00100        61 KLNIEDEPVECECEDCSE   78 (115)
T ss_pred             EEEEEeeCcEEEcccCCC
Confidence            345566778888888883


No 96 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=53.30  E-value=6.5  Score=25.84  Aligned_cols=15  Identities=33%  Similarity=0.720  Sum_probs=11.3

Q ss_pred             CCCCCCCCCcceEEE
Q 038108           19 APGSCPYCGGKVLAI   33 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~   33 (67)
                      -|-+||+||--....
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            567899999766544


No 97 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=53.23  E-value=6.2  Score=20.13  Aligned_cols=10  Identities=50%  Similarity=1.281  Sum_probs=8.0

Q ss_pred             cCCCCCCCCC
Q 038108           18 QAPGSCPYCG   27 (67)
Q Consensus        18 ~ApG~Cp~CG   27 (67)
                      -++=.||+||
T Consensus        14 ~v~f~CPnCG   23 (24)
T PF07754_consen   14 AVPFPCPNCG   23 (24)
T ss_pred             CceEeCCCCC
Confidence            5667899998


No 98 
>PRK14701 reverse gyrase; Provisional
Probab=52.62  E-value=6.4  Score=35.97  Aligned_cols=17  Identities=29%  Similarity=0.796  Sum_probs=12.8

Q ss_pred             CCCCCCCCcceEEEEec
Q 038108           20 PGSCPYCGGKVLAIDFE   36 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dve   36 (67)
                      .++||+|||.++.-..+
T Consensus         6 ~~~cpnc~g~~~~~rl~   22 (1638)
T PRK14701          6 KEMCPNCGGDITDERLA   22 (1638)
T ss_pred             cccCCCCCCccchhHHh
Confidence            37899999998765444


No 99 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=52.48  E-value=7.3  Score=34.86  Aligned_cols=37  Identities=27%  Similarity=0.632  Sum_probs=19.7

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      -.||.||..      ....+||  |-|.+.-..+.|..||..+..
T Consensus       639 frCP~CG~~------Te~i~fC--P~CG~~~~~y~CPKCG~El~~  675 (1121)
T PRK04023        639 RRCPFCGTH------TEPVYRC--PRCGIEVEEDECEKCGREPTP  675 (1121)
T ss_pred             ccCCCCCCC------CCcceeC--ccccCcCCCCcCCCCCCCCCc
Confidence            455555554      1223344  555555555667777766554


No 100
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=51.85  E-value=4.6  Score=19.64  Aligned_cols=13  Identities=15%  Similarity=0.909  Sum_probs=9.7

Q ss_pred             eEEeccccceeee
Q 038108           53 KYFCSLCSRRLEL   65 (67)
Q Consensus        53 ~~~Ct~C~r~L~~   65 (67)
                      +|+|..|++.+.+
T Consensus         1 q~~C~~C~k~f~~   13 (27)
T PF12171_consen    1 QFYCDACDKYFSS   13 (27)
T ss_dssp             -CBBTTTTBBBSS
T ss_pred             CCCcccCCCCcCC
Confidence            4789999987754


No 101
>PRK05580 primosome assembly protein PriA; Validated
Probab=51.61  E-value=12  Score=30.63  Aligned_cols=11  Identities=27%  Similarity=0.918  Sum_probs=7.9

Q ss_pred             CCCCCCCcceE
Q 038108           21 GSCPYCGGKVL   31 (67)
Q Consensus        21 G~Cp~CGG~v~   31 (67)
                      ..||+|++++.
T Consensus       391 ~~C~~C~~~l~  401 (679)
T PRK05580        391 AECPHCDASLT  401 (679)
T ss_pred             cCCCCCCCcee
Confidence            46888887764


No 102
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=51.00  E-value=17  Score=23.73  Aligned_cols=33  Identities=18%  Similarity=0.402  Sum_probs=21.6

Q ss_pred             cCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           18 QAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      +.--.||+||-....+++.-            .+-...|..||-.
T Consensus        19 pt~f~CP~Cge~~v~v~~~k------------~~~h~~C~~CG~y   51 (99)
T PRK14892         19 PKIFECPRCGKVSISVKIKK------------NIAIITCGNCGLY   51 (99)
T ss_pred             CcEeECCCCCCeEeeeecCC------------CcceEECCCCCCc
Confidence            44457999996544444432            3667788888853


No 103
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=50.87  E-value=6.8  Score=19.12  Aligned_cols=36  Identities=22%  Similarity=0.457  Sum_probs=20.6

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecc--eEEeccccceee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKK--KYFCSLCSRRLE   64 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr--~~~Ct~C~r~L~   64 (67)
                      .|+.|+-.+...+..       +..-.+.|-  =|.|+.|++.|.
T Consensus         1 ~C~~C~~~i~~~~~~-------~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELV-------LRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEE-------EEeCCccccccCCCCcccCCcCc
Confidence            367777766543111       112233333  388999999885


No 104
>PHA00626 hypothetical protein
Probab=50.82  E-value=19  Score=22.10  Aligned_cols=32  Identities=28%  Similarity=0.581  Sum_probs=22.0

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      .||.||-.-.+   .       -.++.+...+|.|..||-..
T Consensus         2 ~CP~CGS~~Iv---r-------cg~cr~~snrYkCkdCGY~f   33 (59)
T PHA00626          2 SCPKCGSGNIA---K-------EKTMRGWSDDYVCCDCGYND   33 (59)
T ss_pred             CCCCCCCceee---e-------eceecccCcceEcCCCCCee
Confidence            69999974221   1       24566777899999998654


No 105
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=50.69  E-value=1.8  Score=27.38  Aligned_cols=39  Identities=23%  Similarity=0.505  Sum_probs=31.5

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .+..||+||-++..-|.        ||+..=..-|=.|..|++++-.
T Consensus        32 ~rS~C~~C~~~L~~~~l--------IPi~S~l~lrGrCr~C~~~I~~   70 (92)
T PF06750_consen   32 PRSHCPHCGHPLSWWDL--------IPILSYLLLRGRCRYCGAPIPP   70 (92)
T ss_pred             CCCcCcCCCCcCccccc--------chHHHHHHhCCCCcccCCCCCh
Confidence            46889999999998886        7888777777888888877643


No 106
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=50.44  E-value=12  Score=19.96  Aligned_cols=13  Identities=38%  Similarity=1.037  Sum_probs=8.3

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      ..+-.||+||.-+
T Consensus        15 ~~~irC~~CG~RI   27 (32)
T PF03604_consen   15 GDPIRCPECGHRI   27 (32)
T ss_dssp             SSTSSBSSSS-SE
T ss_pred             CCcEECCcCCCeE
Confidence            3456788888765


No 107
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=50.17  E-value=6.8  Score=24.28  Aligned_cols=36  Identities=31%  Similarity=0.887  Sum_probs=28.7

Q ss_pred             cCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccc
Q 038108           18 QAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSR   61 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r   61 (67)
                      +.+-.||+|+-        +.++||+.==+.-+--+|+|--|.|
T Consensus         3 ~~~~~CPRC~S--------~nTKFcYyNNy~~~QPR~~Ck~C~r   38 (63)
T PF02701_consen    3 EQPLPCPRCDS--------TNTKFCYYNNYNLSQPRYFCKSCRR   38 (63)
T ss_pred             ccCCCCCCcCC--------CCCEEEeecCCCCCCcchhhHHHHH
Confidence            44567999984        4689999887777888999988865


No 108
>PRK14873 primosome assembly protein PriA; Provisional
Probab=49.98  E-value=14  Score=30.75  Aligned_cols=11  Identities=27%  Similarity=0.631  Sum_probs=7.7

Q ss_pred             CCCCCCcceEE
Q 038108           22 SCPYCGGKVLA   32 (67)
Q Consensus        22 ~Cp~CGG~v~a   32 (67)
                      .||+|++++.-
T Consensus       394 ~C~~C~~~L~~  404 (665)
T PRK14873        394 RCRHCTGPLGL  404 (665)
T ss_pred             ECCCCCCceeE
Confidence            57777777664


No 109
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=49.84  E-value=12  Score=30.18  Aligned_cols=34  Identities=26%  Similarity=0.683  Sum_probs=22.7

Q ss_pred             eecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           16 RQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        16 ~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .....-.||+|||-.     +|.           =+.-|-|..||++..+
T Consensus       346 ~~~~~p~Cp~Cg~~m-----~S~-----------G~~g~rC~kCg~~~~~  379 (421)
T COG1571         346 YERVNPVCPRCGGRM-----KSA-----------GRNGFRCKKCGTRARE  379 (421)
T ss_pred             eEEcCCCCCccCCch-----hhc-----------CCCCcccccccccCCc
Confidence            345566899999963     222           1225889999988754


No 110
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=49.74  E-value=10  Score=23.58  Aligned_cols=16  Identities=44%  Similarity=0.982  Sum_probs=11.8

Q ss_pred             CCCCCCcc---------eEEEEece
Q 038108           22 SCPYCGGK---------VLAIDFES   37 (67)
Q Consensus        22 ~Cp~CGG~---------v~a~Dves   37 (67)
                      .||.||..         +..+|-|+
T Consensus        20 ~CP~Cgs~~~te~W~G~~iIidpe~   44 (64)
T COG2093          20 ICPVCGSTDLTEEWFGLLIIIDPEK   44 (64)
T ss_pred             cCCCCCCcccchhhccEEEEEcCcH
Confidence            59999964         66777664


No 111
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=48.81  E-value=9.2  Score=19.44  Aligned_cols=13  Identities=31%  Similarity=0.790  Sum_probs=9.1

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      .+.-.||+||-.-
T Consensus        12 ~~~~~Cp~CG~~F   24 (26)
T PF10571_consen   12 ESAKFCPHCGYDF   24 (26)
T ss_pred             hhcCcCCCCCCCC
Confidence            3556899999643


No 112
>PRK04351 hypothetical protein; Provisional
Probab=47.68  E-value=21  Score=24.41  Aligned_cols=16  Identities=38%  Similarity=0.829  Sum_probs=13.6

Q ss_pred             ecceEEeccccceeee
Q 038108           50 IKKKYFCSLCSRRLEL   65 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L~~   65 (67)
                      +.++|.|..|+..|+.
T Consensus       129 n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        129 NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             CCCcEEeCCCCcEeee
Confidence            4689999999999875


No 113
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=47.09  E-value=7  Score=21.40  Aligned_cols=10  Identities=40%  Similarity=0.776  Sum_probs=4.6

Q ss_pred             EEecccccee
Q 038108           54 YFCSLCSRRL   63 (67)
Q Consensus        54 ~~Ct~C~r~L   63 (67)
                      -.||||||..
T Consensus         2 ~~CSFCgr~~   11 (41)
T PF06689_consen    2 KRCSFCGRPE   11 (41)
T ss_dssp             -B-TTT--BT
T ss_pred             CCccCCCCCH
Confidence            3699999864


No 114
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=47.03  E-value=15  Score=24.48  Aligned_cols=50  Identities=22%  Similarity=0.354  Sum_probs=30.4

Q ss_pred             eeeeeeecCCCCCCCCCcceEEEE------eceeeeEEEeeeEeeecceEEeccccce
Q 038108           11 ERELGRQQAPGSCPYCGGKVLAID------FESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG~v~a~D------ves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      +=++-..|+.+.|+.||--....|      =+...-+=|+|--..  .-+.|+.||..
T Consensus        61 ~L~i~~~p~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~CP~Cgs~  116 (135)
T PRK03824         61 EIIFEEEEAVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVH--AFLKCPKCGSR  116 (135)
T ss_pred             EEEEEecceEEECCCCCCEEecccccccccccccccccccccccc--cCcCCcCCCCC
Confidence            445567889999999995554442      223344445664222  22569999864


No 115
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=46.74  E-value=29  Score=20.26  Aligned_cols=16  Identities=19%  Similarity=0.588  Sum_probs=10.8

Q ss_pred             eecceEEeccccceee
Q 038108           49 NIKKKYFCSLCSRRLE   64 (67)
Q Consensus        49 k~kr~~~Ct~C~r~L~   64 (67)
                      -..-...|+.|+|.+.
T Consensus        49 i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   49 IVEGELICPECGREYP   64 (68)
T ss_dssp             TTTTEEEETTTTEEEE
T ss_pred             ccCCEEEcCCCCCEEe
Confidence            3445677888887764


No 116
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=46.38  E-value=7.7  Score=27.65  Aligned_cols=14  Identities=36%  Similarity=0.812  Sum_probs=12.5

Q ss_pred             CCCCCCCcceEEEE
Q 038108           21 GSCPYCGGKVLAID   34 (67)
Q Consensus        21 G~Cp~CGG~v~a~D   34 (67)
                      ..||.||+.++-+|
T Consensus       133 F~Cp~Cg~~L~~~d  146 (176)
T COG1675         133 FTCPKCGEDLEEYD  146 (176)
T ss_pred             CCCCCCCchhhhcc
Confidence            78999999998877


No 117
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=46.25  E-value=16  Score=23.64  Aligned_cols=18  Identities=28%  Similarity=0.420  Sum_probs=13.7

Q ss_pred             eeeeeeecCCCCCCCCCc
Q 038108           11 ERELGRQQAPGSCPYCGG   28 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG   28 (67)
                      +=++-..|+.+.|+.||-
T Consensus        61 ~L~i~~~p~~~~C~~Cg~   78 (114)
T PRK03681         61 KLHLEEQEAECWCETCQQ   78 (114)
T ss_pred             EEEEEeeCcEEEcccCCC
Confidence            445667888888999984


No 118
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=45.87  E-value=12  Score=16.99  Aligned_cols=11  Identities=27%  Similarity=1.084  Sum_probs=8.1

Q ss_pred             EEeccccceee
Q 038108           54 YFCSLCSRRLE   64 (67)
Q Consensus        54 ~~Ct~C~r~L~   64 (67)
                      |.|..|++...
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            67888887754


No 119
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=45.77  E-value=23  Score=18.40  Aligned_cols=22  Identities=27%  Similarity=0.610  Sum_probs=10.1

Q ss_pred             EEcCCceeeeeeecCCCCCCCCCc
Q 038108            5 YVCSEEERELGRQQAPGSCPYCGG   28 (67)
Q Consensus         5 ~vcde~~kv~~~~~ApG~Cp~CGG   28 (67)
                      .-|++-+++  .-|....||+||+
T Consensus        12 ~rC~~Cg~~--~~pPr~~Cp~C~s   33 (37)
T PF12172_consen   12 QRCRDCGRV--QFPPRPVCPHCGS   33 (37)
T ss_dssp             EE-TTT--E--EES--SEETTTT-
T ss_pred             EEcCCCCCE--ecCCCcCCCCcCc
Confidence            344444444  3456688999975


No 120
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=45.47  E-value=10  Score=21.21  Aligned_cols=37  Identities=27%  Similarity=0.603  Sum_probs=20.2

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEee-ecceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYN-IKKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k-~kr~~~Ct~C~r~L   63 (67)
                      .||+||-.....++-..     +--..+ ..+.+.|++|+.++
T Consensus         4 ~CP~C~~~~~~~~L~~H-----~~~~H~~~~~~v~CPiC~~~~   41 (54)
T PF05605_consen    4 TCPYCGKGFSESSLVEH-----CEDEHRSESKNVVCPICSSRV   41 (54)
T ss_pred             CCCCCCCccCHHHHHHH-----HHhHCcCCCCCccCCCchhhh
Confidence            69999985433222211     122222 23468899998754


No 121
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=45.32  E-value=12  Score=29.13  Aligned_cols=30  Identities=30%  Similarity=0.482  Sum_probs=17.2

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      +||.||--++..+.+..             .+-.|++||..|.
T Consensus        15 ~C~~Cd~l~~~~~l~~g-------------~~a~CpRCg~~L~   44 (403)
T TIGR00155        15 LCSQCDMLVALPRIESG-------------QKAACPRCGTTLT   44 (403)
T ss_pred             eCCCCCCcccccCCCCC-------------CeeECCCCCCCCc
Confidence            47777765555444322             2445777777664


No 122
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=44.81  E-value=19  Score=28.75  Aligned_cols=30  Identities=33%  Similarity=0.699  Sum_probs=20.5

Q ss_pred             EEEEcCCceeee-eeecCCCCCCCCCcceEE
Q 038108            3 LVYVCSEEEREL-GRQQAPGSCPYCGGKVLA   32 (67)
Q Consensus         3 ~~~vcde~~kv~-~~~~ApG~Cp~CGG~v~a   32 (67)
                      ..+.|.+.+++. +-.+...-||+|||.+..
T Consensus       239 ~~~~c~~cg~~~~~~~~~~~~c~~Cg~~~~~  269 (380)
T COG1867         239 YIYHCSRCGEIVGSFREVDEKCPHCGGKVHL  269 (380)
T ss_pred             cEEEcccccceecccccccccCCccccccee
Confidence            456777775444 446777789999975544


No 123
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=44.54  E-value=10  Score=24.96  Aligned_cols=9  Identities=56%  Similarity=1.309  Sum_probs=7.5

Q ss_pred             CCCCCCCcc
Q 038108           21 GSCPYCGGK   29 (67)
Q Consensus        21 G~Cp~CGG~   29 (67)
                      ..||.||+.
T Consensus        93 ~~CP~Cgs~  101 (124)
T PRK00762         93 IECPVCGNK  101 (124)
T ss_pred             CcCcCCCCC
Confidence            579999974


No 124
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=44.43  E-value=22  Score=25.63  Aligned_cols=15  Identities=27%  Similarity=0.758  Sum_probs=11.7

Q ss_pred             cCCCCCCCCCcceEE
Q 038108           18 QAPGSCPYCGGKVLA   32 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a   32 (67)
                      +--+.||.|||.+.-
T Consensus       151 ~~~~~Cp~CG~~~~~  165 (177)
T COG1439         151 EPKDFCPICGSPLKR  165 (177)
T ss_pred             CCCCcCCCCCCceEE
Confidence            456899999998654


No 125
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=42.85  E-value=22  Score=26.36  Aligned_cols=31  Identities=32%  Similarity=0.707  Sum_probs=21.5

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      +..||.||+.-.+.|.++-              -.+|+.||-.|.
T Consensus        11 ~~~Cp~Cg~~~iv~d~~~G--------------e~vC~~CG~Vl~   41 (310)
T PRK00423         11 KLVCPECGSDKLIYDYERG--------------EIVCADCGLVIE   41 (310)
T ss_pred             CCcCcCCCCCCeeEECCCC--------------eEeecccCCccc
Confidence            3579999987677775443              456777877654


No 126
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=42.77  E-value=15  Score=24.30  Aligned_cols=11  Identities=27%  Similarity=0.851  Sum_probs=8.1

Q ss_pred             ceEEeccccce
Q 038108           52 KKYFCSLCSRR   62 (67)
Q Consensus        52 r~~~Ct~C~r~   62 (67)
                      ..|.|..|+..
T Consensus        50 ~~~~C~~C~~~   60 (166)
T cd04476          50 GTYRCEKCNKS   60 (166)
T ss_pred             CcEECCCCCCc
Confidence            56778888765


No 127
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=42.28  E-value=30  Score=23.78  Aligned_cols=37  Identities=19%  Similarity=0.444  Sum_probs=20.3

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeee-cceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNI-KKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~-kr~~~Ct~C~r~L   63 (67)
                      .||.||....-.     +-.=-+|.+.+. =-.|.|..||-+-
T Consensus         3 ~Cp~C~~~~~~~-----~~~~~IP~F~evii~sf~C~~CGyk~   40 (161)
T PF03367_consen    3 LCPNCGENGTTR-----ILLTDIPYFKEVIIMSFECEHCGYKN   40 (161)
T ss_dssp             E-TTTSSCCEEE-----EEEEEETTTEEEEEEEEE-TTT--EE
T ss_pred             cCCCCCCCcEEE-----EEEEcCCCCceEEEEEeECCCCCCEe
Confidence            599999875321     112236776664 3578999999664


No 128
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=42.09  E-value=14  Score=25.97  Aligned_cols=26  Identities=23%  Similarity=0.880  Sum_probs=10.9

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccc
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS   60 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~   60 (67)
                      .|++|||.-.+..-+             ....|.|++|.
T Consensus       136 ~C~~C~~~fv~~~~~-------------~~~~~~Cp~C~  161 (175)
T PF05280_consen  136 PCRRCGGHFVTHAHD-------------PRHSFVCPFCQ  161 (175)
T ss_dssp             E-TTT--EEEEESS---------------SS----TT--
T ss_pred             CCCCCCCCeECcCCC-------------CCcCcCCCCCC
Confidence            599999998876433             34566777775


No 129
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=41.98  E-value=24  Score=18.77  Aligned_cols=13  Identities=31%  Similarity=0.795  Sum_probs=9.1

Q ss_pred             CCCCCcceEEEEe
Q 038108           23 CPYCGGKVLAIDF   35 (67)
Q Consensus        23 Cp~CGG~v~a~Dv   35 (67)
                      ||.||..+..-+-
T Consensus         4 Cp~C~nlL~p~~~   16 (35)
T PF02150_consen    4 CPECGNLLYPKED   16 (35)
T ss_dssp             ETTTTSBEEEEEE
T ss_pred             CCCCCccceEcCC
Confidence            8888887765443


No 130
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=41.76  E-value=4.6  Score=22.05  Aligned_cols=25  Identities=16%  Similarity=0.074  Sum_probs=10.6

Q ss_pred             eeecCCCCCCC--CCcceEEEEeceee
Q 038108           15 GRQQAPGSCPY--CGGKVLAIDFESQC   39 (67)
Q Consensus        15 ~~~~ApG~Cp~--CGG~v~a~Dves~~   39 (67)
                      ...+..--||+  |++.+...+-....
T Consensus        13 ~~~~~~~~Cp~~~C~~~~~~~~~~~~~   39 (64)
T PF01485_consen   13 ESDPNIRWCPNPDCEYIIEKDDGCNSP   39 (64)
T ss_dssp             -S---CC--TTSST---ECS-SSTTS-
T ss_pred             HCCCCccCCCCCCCcccEEecCCCCCC
Confidence            34444458988  99999988877664


No 131
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=41.18  E-value=9.5  Score=20.66  Aligned_cols=18  Identities=33%  Similarity=0.506  Sum_probs=9.3

Q ss_pred             ecCCCCCCCCCcceEEEE
Q 038108           17 QQAPGSCPYCGGKVLAID   34 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~a~D   34 (67)
                      .-.+-+|+.||-.++.+|
T Consensus        18 ~~~~isC~~CGPr~~i~~   35 (35)
T PF07503_consen   18 HYQFISCTNCGPRYSIID   35 (35)
T ss_dssp             T-TT--BTTCC-SCCCES
T ss_pred             cCcCccCCCCCCCEEEeC
Confidence            345567888887766543


No 132
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=41.08  E-value=19  Score=32.37  Aligned_cols=20  Identities=25%  Similarity=0.508  Sum_probs=16.8

Q ss_pred             eeeecCCCCCCCCCcceEEE
Q 038108           14 LGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      -+|-|-.|.||.|||.+.-+
T Consensus      1022 YRR~PL~G~C~kCGg~lilT 1041 (1095)
T TIGR00354      1022 YRRIPLVGKCLKCGNNLTLT 1041 (1095)
T ss_pred             cccCCCCCcccccCCeEEEE
Confidence            46778999999999998754


No 133
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=41.06  E-value=29  Score=25.58  Aligned_cols=42  Identities=21%  Similarity=0.517  Sum_probs=29.5

Q ss_pred             cCCCCCCCCCcceEEEEeceeeeEEEeeeEeee-cceEEeccccceee
Q 038108           18 QAPGSCPYCGGKVLAIDFESQCRFCFLPICYNI-KKKYFCSLCSRRLE   64 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~-kr~~~Ct~C~r~L~   64 (67)
                      .-...||-|||     ++...++.==+|.+-+. -.-++|..||-|..
T Consensus        12 ~~~~~CPvCg~-----~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          12 ETRIDCPVCGG-----TLKAHMYLYDIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             eeeecCCcccc-----eeeEEEeeecCCccceEEEEEEEccccCCccc
Confidence            34578999999     55556666667876554 34578999997653


No 134
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=40.48  E-value=12  Score=22.97  Aligned_cols=12  Identities=42%  Similarity=1.124  Sum_probs=9.6

Q ss_pred             CCCCCCCcceEE
Q 038108           21 GSCPYCGGKVLA   32 (67)
Q Consensus        21 G~Cp~CGG~v~a   32 (67)
                      -.||.|||....
T Consensus        18 e~Cp~CG~~t~~   29 (59)
T COG2260          18 EKCPVCGGDTKV   29 (59)
T ss_pred             ccCCCCCCcccc
Confidence            579999997654


No 135
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.45  E-value=14  Score=25.64  Aligned_cols=12  Identities=42%  Similarity=1.021  Sum_probs=9.4

Q ss_pred             cCCCCCCCCCcc
Q 038108           18 QAPGSCPYCGGK   29 (67)
Q Consensus        18 ~ApG~Cp~CGG~   29 (67)
                      ...|.||+||-+
T Consensus        19 Gl~grCP~CGeG   30 (126)
T COG5349          19 GLRGRCPRCGEG   30 (126)
T ss_pred             HhcCCCCCCCCc
Confidence            456899999954


No 136
>PRK04023 DNA polymerase II large subunit; Validated
Probab=40.26  E-value=20  Score=32.32  Aligned_cols=20  Identities=35%  Similarity=0.908  Sum_probs=16.9

Q ss_pred             eeeecCCCCCCCCCcceEEE
Q 038108           14 LGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      -+|-|-.|.||.|||.+.-+
T Consensus      1047 YRR~PL~G~C~kCGg~lilT 1066 (1121)
T PRK04023       1047 YRRPPLSGKCPKCGGNLILT 1066 (1121)
T ss_pred             cccCCCCCcCccCCCeEEEE
Confidence            46778999999999998765


No 137
>PRK05320 rhodanese superfamily protein; Provisional
Probab=39.98  E-value=19  Score=26.18  Aligned_cols=28  Identities=14%  Similarity=0.133  Sum_probs=19.5

Q ss_pred             EEEcCCceeeeee--ecCCCCCCCCCcceE
Q 038108            4 VYVCSEEERELGR--QQAPGSCPYCGGKVL   31 (67)
Q Consensus         4 ~~vcde~~kv~~~--~~ApG~Cp~CGG~v~   31 (67)
                      +||+|++--|--.  ..+.+.|..||-+++
T Consensus       226 ~fVFD~R~~~~~~~~~~~~~~c~~c~~~~~  255 (257)
T PRK05320        226 CFVFDYRTALDPQLAPLVDVTCFACRAVVT  255 (257)
T ss_pred             eeeecCeeecCCCCccCccceecCCCCcCC
Confidence            7999997654332  234567999998764


No 138
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=39.96  E-value=69  Score=19.35  Aligned_cols=11  Identities=18%  Similarity=0.492  Sum_probs=8.0

Q ss_pred             ceEEeccccce
Q 038108           52 KKYFCSLCSRR   62 (67)
Q Consensus        52 r~~~Ct~C~r~   62 (67)
                      ..++|+.||=.
T Consensus        35 ~~v~C~~CGYT   45 (64)
T PF09855_consen   35 TTVSCTNCGYT   45 (64)
T ss_pred             EEEECCCCCCE
Confidence            35689999854


No 139
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=39.67  E-value=20  Score=27.44  Aligned_cols=16  Identities=31%  Similarity=0.611  Sum_probs=13.0

Q ss_pred             cCCCCCCCCCcceEEE
Q 038108           18 QAPGSCPYCGGKVLAI   33 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~   33 (67)
                      .-.-.||.||++|..-
T Consensus        28 ~~~~~CP~C~~~v~lk   43 (375)
T PF06054_consen   28 KGKYFCPGCGEPVILK   43 (375)
T ss_pred             CCcEECCCCCCeeEEE
Confidence            5567899999999873


No 140
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.26  E-value=14  Score=24.01  Aligned_cols=17  Identities=12%  Similarity=0.307  Sum_probs=10.6

Q ss_pred             eeeeeeecCCCCCCCCC
Q 038108           11 ERELGRQQAPGSCPYCG   27 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CG   27 (67)
                      +=.+-..|+-+.|..||
T Consensus        62 ~L~Ie~vp~~~~C~~Cg   78 (117)
T PRK00564         62 ILDIVDEKVELECKDCS   78 (117)
T ss_pred             EEEEEecCCEEEhhhCC
Confidence            34455566666777777


No 141
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=38.40  E-value=21  Score=32.65  Aligned_cols=20  Identities=30%  Similarity=0.805  Sum_probs=16.8

Q ss_pred             eeeecCCCCCCCCCcceEEE
Q 038108           14 LGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      -+|-|-.|.||.|||.+.-+
T Consensus      1263 yRR~PL~G~C~kCGg~iilT 1282 (1337)
T PRK14714       1263 YRRMPLAGKCRKCGGRIILT 1282 (1337)
T ss_pred             cccCCCCCcccccCCeEEEE
Confidence            46778999999999998754


No 142
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=38.31  E-value=27  Score=20.08  Aligned_cols=13  Identities=31%  Similarity=0.708  Sum_probs=8.8

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      |+.-.||-||.+-
T Consensus        32 p~~w~CP~C~a~K   44 (50)
T cd00730          32 PDDWVCPVCGAGK   44 (50)
T ss_pred             CCCCCCCCCCCcH
Confidence            3344899998753


No 143
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=38.08  E-value=21  Score=28.02  Aligned_cols=31  Identities=29%  Similarity=0.439  Sum_probs=17.2

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      -+||.||--++..+++..-             +-.|++||..|.
T Consensus        11 ~~C~~Cd~l~~~~~l~~g~-------------~a~CpRCg~~L~   41 (419)
T PRK15103         11 ILCPQCDMLVALPRLEHGQ-------------KAACPRCGTTLT   41 (419)
T ss_pred             ccCCCCCceeecCCCCCCC-------------eeECCCCCCCCc
Confidence            4477777655544443222             345777777664


No 144
>PF07213 DAP10:  DAP10 membrane protein;  InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=38.03  E-value=15  Score=23.56  Aligned_cols=15  Identities=40%  Similarity=0.698  Sum_probs=12.2

Q ss_pred             eeeecCCCCCCCCCc
Q 038108           14 LGRQQAPGSCPYCGG   28 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG   28 (67)
                      -+.|..+|+|+.||.
T Consensus        16 aAaq~~~gscs~C~~   30 (79)
T PF07213_consen   16 AAAQTQPGSCSGCYP   30 (79)
T ss_pred             hhhcCCCCCCCCccc
Confidence            356788999999985


No 145
>PF13395 HNH_4:  HNH endonuclease
Probab=37.93  E-value=11  Score=21.27  Aligned_cols=13  Identities=38%  Similarity=1.152  Sum_probs=11.0

Q ss_pred             CCCCCcceEEEEe
Q 038108           23 CPYCGGKVLAIDF   35 (67)
Q Consensus        23 Cp~CGG~v~a~Dv   35 (67)
                      |+|||-.+...++
T Consensus         1 C~Y~g~~i~~~~l   13 (54)
T PF13395_consen    1 CPYCGKPISIENL   13 (54)
T ss_pred             CCCCCCCCChhhc
Confidence            8999999887764


No 146
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=37.68  E-value=12  Score=20.96  Aligned_cols=13  Identities=46%  Similarity=1.219  Sum_probs=5.7

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      .+.|.||=||.++
T Consensus        18 ~~~~~CPlC~r~l   30 (54)
T PF04423_consen   18 EAKGCCPLCGRPL   30 (54)
T ss_dssp             T-SEE-TTT--EE
T ss_pred             cCCCcCCCCCCCC
Confidence            3445788877654


No 147
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=37.38  E-value=23  Score=19.06  Aligned_cols=36  Identities=33%  Similarity=0.647  Sum_probs=15.5

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      .||.||..-.+ =++.|+|====|    ...-|.|.-||.+
T Consensus         2 ~Cp~Cg~~~a~-~~~~Q~rsaDE~----~T~fy~C~~C~~~   37 (39)
T PF01096_consen    2 KCPKCGHNEAV-FFQIQTRSADEP----MTLFYVCCNCGHR   37 (39)
T ss_dssp             --SSS-SSEEE-EEEESSSSSSSS----SEEEEEESSSTEE
T ss_pred             CCcCCCCCeEE-EEEeeccCCCCC----CeEEEEeCCCCCe
Confidence            49999986533 333333311101    1223567777654


No 148
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=37.32  E-value=15  Score=21.99  Aligned_cols=11  Identities=36%  Similarity=1.026  Sum_probs=8.6

Q ss_pred             CCCCCCCcceE
Q 038108           21 GSCPYCGGKVL   31 (67)
Q Consensus        21 G~Cp~CGG~v~   31 (67)
                      .-||+||.++-
T Consensus         4 kHC~~CG~~Ip   14 (59)
T PF09889_consen    4 KHCPVCGKPIP   14 (59)
T ss_pred             CcCCcCCCcCC
Confidence            56999997764


No 149
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=37.20  E-value=16  Score=28.62  Aligned_cols=11  Identities=45%  Similarity=1.386  Sum_probs=9.0

Q ss_pred             CCCCCCCCcceE
Q 038108           20 PGSCPYCGGKVL   31 (67)
Q Consensus        20 pG~Cp~CGG~v~   31 (67)
                      .|.|| ||+.+.
T Consensus       259 ~~~Cp-CG~~i~  269 (374)
T TIGR00375       259 CANCP-CGGRIK  269 (374)
T ss_pred             CCCCC-CCCcce
Confidence            39999 999953


No 150
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=37.12  E-value=23  Score=33.01  Aligned_cols=20  Identities=35%  Similarity=0.806  Sum_probs=16.9

Q ss_pred             eeeecCCCCCCCCCcceEEE
Q 038108           14 LGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      -+|-|-.|.||.|||.+.-+
T Consensus      1551 yRR~PL~G~C~kCGg~~ilT 1570 (1627)
T PRK14715       1551 YRRVPLKGKCPKCGSKLILT 1570 (1627)
T ss_pred             cccCCCCCcCcccCCeEEEE
Confidence            46778999999999998755


No 151
>PRK05978 hypothetical protein; Provisional
Probab=36.63  E-value=18  Score=25.16  Aligned_cols=35  Identities=26%  Similarity=0.473  Sum_probs=21.8

Q ss_pred             cCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeeee
Q 038108           18 QAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELY   66 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~~   66 (67)
                      ...|.||+||-+=.=-              .=.|=+-.|+.||-.+..+
T Consensus        31 Gl~grCP~CG~G~LF~--------------g~Lkv~~~C~~CG~~~~~~   65 (148)
T PRK05978         31 GFRGRCPACGEGKLFR--------------AFLKPVDHCAACGEDFTHH   65 (148)
T ss_pred             HHcCcCCCCCCCcccc--------------cccccCCCccccCCccccC
Confidence            4568999999663210              1123455688888877643


No 152
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=36.29  E-value=30  Score=26.01  Aligned_cols=30  Identities=37%  Similarity=0.772  Sum_probs=21.6

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      ..||.||+.....|++.              -.+.|.-||-.+.
T Consensus         2 ~~CpeCg~~~~~~d~~~--------------ge~VC~~CG~Vi~   31 (285)
T COG1405           2 MSCPECGSTNIITDYER--------------GEIVCADCGLVLE   31 (285)
T ss_pred             CCCCCCCCccceeeccC--------------CeEEeccCCEEec
Confidence            57999999977777663              4566777776553


No 153
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=36.24  E-value=15  Score=21.87  Aligned_cols=16  Identities=31%  Similarity=0.752  Sum_probs=9.2

Q ss_pred             ecCCCCCCCCCcceEE
Q 038108           17 QQAPGSCPYCGGKVLA   32 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~a   32 (67)
                      .+.-|.||+|.-.++.
T Consensus        52 ~~~~G~CP~C~~~i~~   67 (70)
T PF11793_consen   52 IPIFGECPYCSSPISW   67 (70)
T ss_dssp             T--EEE-TTT-SEEEG
T ss_pred             cccccCCcCCCCeeeE
Confidence            3567899999988763


No 154
>smart00019 SF_P Pulmonary surfactant proteins. Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
Probab=35.93  E-value=15  Score=26.77  Aligned_cols=21  Identities=29%  Similarity=0.537  Sum_probs=18.5

Q ss_pred             EEcCCceeeeeeecCCCCCCC
Q 038108            5 YVCSEEERELGRQQAPGSCPY   25 (67)
Q Consensus         5 ~vcde~~kv~~~~~ApG~Cp~   25 (67)
                      .|+|-++-.++-+||||.|=|
T Consensus       102 VvyDYqrLLiaykPaPGtcCY  122 (191)
T smart00019      102 VVYDYQRLLIAYKPAPGTCCY  122 (191)
T ss_pred             EEEEhhhhheeccCCCCceEE
Confidence            578988999999999999855


No 155
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=35.92  E-value=21  Score=21.94  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=7.3

Q ss_pred             CCCCCCCcc
Q 038108           21 GSCPYCGGK   29 (67)
Q Consensus        21 G~Cp~CGG~   29 (67)
                      ..||.||+.
T Consensus        18 ~~Cp~Cgs~   26 (64)
T PRK06393         18 KTCPVHGDE   26 (64)
T ss_pred             CcCCCCCCC
Confidence            389999974


No 156
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=35.57  E-value=29  Score=27.74  Aligned_cols=30  Identities=17%  Similarity=0.429  Sum_probs=17.5

Q ss_pred             eceeeeEE---EeeeEeeecceEEeccccceeee
Q 038108           35 FESQCRFC---FLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        35 ves~~rfC---flP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      -....-+|   |.||| |-+....|++||+++..
T Consensus       360 ~~npF~ICa~s~tPIY-~G~~~v~CP~cgA~y~~  392 (422)
T PF06957_consen  360 ERNPFDICAASYTPIY-RGSPSVKCPYCGAKYHP  392 (422)
T ss_dssp             TTS-EEEBTTT--EEE-TTS-EEE-TTT--EEEG
T ss_pred             CCCCceeeeccccccc-CCCCCeeCCCCCCccCh
Confidence            34566777   67998 66677999999998764


No 157
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=35.43  E-value=22  Score=16.40  Aligned_cols=12  Identities=17%  Similarity=1.110  Sum_probs=9.3

Q ss_pred             EEeccccceeee
Q 038108           54 YFCSLCSRRLEL   65 (67)
Q Consensus        54 ~~Ct~C~r~L~~   65 (67)
                      |.|..|.+...+
T Consensus         1 ~~C~~C~~~f~s   12 (25)
T PF12874_consen    1 FYCDICNKSFSS   12 (25)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCCcCC
Confidence            689999887654


No 158
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=35.00  E-value=9.8  Score=22.76  Aligned_cols=13  Identities=38%  Similarity=0.754  Sum_probs=6.7

Q ss_pred             CCCCCCcceEEEE
Q 038108           22 SCPYCGGKVLAID   34 (67)
Q Consensus        22 ~Cp~CGG~v~a~D   34 (67)
                      .||.||..+...+
T Consensus         4 ~CP~C~k~~~~~~   16 (57)
T PF03884_consen    4 KCPICGKPVEWSP   16 (57)
T ss_dssp             E-TTT--EEE-SS
T ss_pred             cCCCCCCeecccC
Confidence            5999999887643


No 159
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=34.82  E-value=20  Score=22.77  Aligned_cols=14  Identities=43%  Similarity=0.980  Sum_probs=7.7

Q ss_pred             ecCCCCCCCCCcce
Q 038108           17 QQAPGSCPYCGGKV   30 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v   30 (67)
                      ..+...|.||||+.
T Consensus        85 l~~~d~CiyCGgkf   98 (99)
T PF12660_consen   85 LESFDVCIYCGGKF   98 (99)
T ss_dssp             HHTSSB-TTT--B-
T ss_pred             HhCCCEEeCCCCCc
Confidence            45677999999975


No 160
>PHA02942 putative transposase; Provisional
Probab=34.71  E-value=23  Score=27.23  Aligned_cols=28  Identities=32%  Similarity=0.821  Sum_probs=19.4

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      .-.||.||....  +           +   +.|.|.|..||-..
T Consensus       325 Sq~Cs~CG~~~~--~-----------l---~~r~f~C~~CG~~~  352 (383)
T PHA02942        325 SVSCPKCGHKMV--E-----------I---AHRYFHCPSCGYEN  352 (383)
T ss_pred             CccCCCCCCccC--c-----------C---CCCEEECCCCCCEe
Confidence            356999998542  1           1   34689999999653


No 161
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=34.70  E-value=18  Score=19.99  Aligned_cols=30  Identities=43%  Similarity=1.113  Sum_probs=17.5

Q ss_pred             CCCCCcceEEEEeceeeeEEEeeeEeeecce--EEe-cccccee
Q 038108           23 CPYCGGKVLAIDFESQCRFCFLPICYNIKKK--YFC-SLCSRRL   63 (67)
Q Consensus        23 Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~--~~C-t~C~r~L   63 (67)
                      |.+|||.|.-           =|+-.|+.++  |+| ..|-+++
T Consensus         1 Cd~CG~~I~~-----------eP~~~k~~~~~y~fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITG-----------EPIVVKIGNKVYYFCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccC-----------CEEEEEECCeEEEEECHHHHHHH
Confidence            7889998753           2555554443  444 6665544


No 162
>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]
Probab=34.62  E-value=17  Score=25.02  Aligned_cols=12  Identities=42%  Similarity=1.043  Sum_probs=10.2

Q ss_pred             ecCCCCCCCCCc
Q 038108           17 QQAPGSCPYCGG   28 (67)
Q Consensus        17 ~~ApG~Cp~CGG   28 (67)
                      +|.+++|.|||=
T Consensus       101 k~~~~~CgYCGl  112 (120)
T KOG3456|consen  101 KPGPHICGYCGL  112 (120)
T ss_pred             CCCCcccccchh
Confidence            677899999994


No 163
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=34.61  E-value=16  Score=19.71  Aligned_cols=13  Identities=46%  Similarity=0.945  Sum_probs=9.5

Q ss_pred             CCCCCCcceEEEE
Q 038108           22 SCPYCGGKVLAID   34 (67)
Q Consensus        22 ~Cp~CGG~v~a~D   34 (67)
                      .||+||-.|.|.-
T Consensus         6 ~C~nC~R~v~a~R   18 (33)
T PF08209_consen    6 ECPNCGRPVAASR   18 (33)
T ss_dssp             E-TTTSSEEEGGG
T ss_pred             ECCCCcCCcchhh
Confidence            5999999887654


No 164
>PRK08173 DNA topoisomerase III; Validated
Probab=34.59  E-value=37  Score=29.09  Aligned_cols=14  Identities=57%  Similarity=1.388  Sum_probs=11.8

Q ss_pred             ecCCCCCCCCCcce
Q 038108           17 QQAPGSCPYCGGKV   30 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v   30 (67)
                      +.+.|.||.||+.+
T Consensus       723 ~~~~g~CPkCg~~v  736 (862)
T PRK08173        723 QEPVGACPKCGGRV  736 (862)
T ss_pred             cccccCCCCCCCee
Confidence            66789999999964


No 165
>PF04879 Molybdop_Fe4S4:  Molybdopterin oxidoreductase Fe4S4 domain;  InterPro: IPR006963 The molybdopterin oxidoreductase Fe4S4 domain is found in a number of reductase/dehydrogenase families, which include the periplasmic nitrate reductase precursor and the formate dehydrogenase alpha chain [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 2VPZ_A 2VPY_A 2VPW_A 2VPX_A 2NYA_A 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 ....
Probab=34.12  E-value=11  Score=20.80  Aligned_cols=13  Identities=38%  Similarity=1.158  Sum_probs=8.3

Q ss_pred             ecCCCCCCCCCcc
Q 038108           17 QQAPGSCPYCGGK   29 (67)
Q Consensus        17 ~~ApG~Cp~CGG~   29 (67)
                      |.++.+||+|+.+
T Consensus         2 k~~~t~C~~C~~g   14 (55)
T PF04879_consen    2 KTVPTVCPYCSSG   14 (55)
T ss_dssp             EEEEEE-SSCTT-
T ss_pred             eEEeeECcCCcCC
Confidence            4567789999864


No 166
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=34.04  E-value=8.7  Score=24.73  Aligned_cols=21  Identities=29%  Similarity=0.485  Sum_probs=9.3

Q ss_pred             eeeeeeecCCCCCCCCCcceE
Q 038108           11 ERELGRQQAPGSCPYCGGKVL   31 (67)
Q Consensus        11 ~kv~~~~~ApG~Cp~CGG~v~   31 (67)
                      +=.+-..|+-+.|..||.-..
T Consensus        61 ~L~Ie~~p~~~~C~~Cg~~~~   81 (113)
T PF01155_consen   61 ELEIEEVPARARCRDCGHEFE   81 (113)
T ss_dssp             EEEEEEE--EEEETTTS-EEE
T ss_pred             EEEEEecCCcEECCCCCCEEe
Confidence            334455556666666665433


No 167
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=33.92  E-value=20  Score=20.22  Aligned_cols=35  Identities=23%  Similarity=0.487  Sum_probs=20.4

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      .|+|.-|+=.+...++..-         .+...-++|+.|||.|
T Consensus        22 ~~~C~gC~~~l~~~~~~~i---------~~~~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   22 GGTCSGCHMELPPQELNEI---------RKGDEIVFCPNCGRIL   56 (56)
T ss_pred             CCccCCCCEEcCHHHHHHH---------HcCCCeEECcCCCccC
Confidence            4667777655544433321         1224568899999876


No 168
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=33.41  E-value=37  Score=24.76  Aligned_cols=25  Identities=16%  Similarity=0.505  Sum_probs=17.9

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      ..|++||+.+.-                 .++...|+.||+.
T Consensus       150 A~CsrC~~~L~~-----------------~~~~l~Cp~Cg~t  174 (188)
T COG1096         150 ARCSRCRAPLVK-----------------KGNMLKCPNCGNT  174 (188)
T ss_pred             EEccCCCcceEE-----------------cCcEEECCCCCCE
Confidence            369999987542                 5667788888864


No 169
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=33.37  E-value=21  Score=20.05  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=7.7

Q ss_pred             CCCCCcceEEE
Q 038108           23 CPYCGGKVLAI   33 (67)
Q Consensus        23 Cp~CGG~v~a~   33 (67)
                      ||+||+...=.
T Consensus         1 CP~Cg~~f~C~   11 (50)
T PF14375_consen    1 CPRCGAPFECG   11 (50)
T ss_pred             CCCCCCcCCCC
Confidence            78888876543


No 170
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=33.10  E-value=45  Score=21.79  Aligned_cols=11  Identities=36%  Similarity=0.990  Sum_probs=8.2

Q ss_pred             CCCCCCcceEE
Q 038108           22 SCPYCGGKVLA   32 (67)
Q Consensus        22 ~Cp~CGG~v~a   32 (67)
                      -||.||+.+.+
T Consensus         4 FCp~Cgsll~p   14 (113)
T COG1594           4 FCPKCGSLLYP   14 (113)
T ss_pred             ccCCccCeeEE
Confidence            48888887765


No 171
>cd04467 S1_aIF5A S1_aIF5A: Archaeal translation Initiation Factor 5A (aIF5A), S1-like RNA-binding domain. aIF5A is a homolog of eukaryotic eIF5A. IF5A is the only protein known to have the unusual amino acid hypusine. Hypusine is a post-translationally modified lysine and is essential for IF5A function. In yeast, eIF5A interacts with components of the 80S ribosome and translation elongation factors 2 (eEF2) in a hypusine-dependent manner. This C-terminal S1 domain resembles the cold-shock domain which binds RNA. Moreover, IF5A prefers binding to the actively translating ribosome. This evidence suggests that IF5A plays a role in translation elongation instead of translation initiation as previously proposed.
Probab=32.86  E-value=25  Score=20.89  Aligned_cols=15  Identities=33%  Similarity=0.490  Sum_probs=11.5

Q ss_pred             CcceEEEEeceeeeE
Q 038108           27 GGKVLAIDFESQCRF   41 (67)
Q Consensus        27 GG~v~a~Dves~~rf   41 (67)
                      |+.|+.||+||---|
T Consensus        13 g~~vQlMD~eTYeT~   27 (57)
T cd04467          13 GDVVQLMDLETYETF   27 (57)
T ss_pred             CCEEEEeccccceeE
Confidence            668999999965544


No 172
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=32.70  E-value=18  Score=30.19  Aligned_cols=10  Identities=20%  Similarity=0.614  Sum_probs=6.0

Q ss_pred             Eeccccceee
Q 038108           55 FCSLCSRRLE   64 (67)
Q Consensus        55 ~Ct~C~r~L~   64 (67)
                      +|..||..+.
T Consensus        43 fC~~CG~~~~   52 (645)
T PRK14559         43 HCPNCGAETG   52 (645)
T ss_pred             cccccCCccc
Confidence            5666666553


No 173
>PRK06260 threonine synthase; Validated
Probab=32.55  E-value=41  Score=25.44  Aligned_cols=28  Identities=32%  Similarity=0.621  Sum_probs=17.4

Q ss_pred             EcCCceeeeeeecCCCCCCCCCcceEEE
Q 038108            6 VCSEEERELGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus         6 vcde~~kv~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      .|-.-++...-....-.||.|||.+.+.
T Consensus         5 ~C~~cg~~~~~~~~~~~Cp~cg~~l~~~   32 (397)
T PRK06260          5 KCIECGKEYDPDEIIYTCPECGGLLEVI   32 (397)
T ss_pred             EECCCCCCCCCCCccccCCCCCCeEEEE
Confidence            3444444444444556799999987655


No 174
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=32.51  E-value=16  Score=21.81  Aligned_cols=11  Identities=36%  Similarity=1.198  Sum_probs=3.6

Q ss_pred             ceEEeccccce
Q 038108           52 KKYFCSLCSRR   62 (67)
Q Consensus        52 r~~~Ct~C~r~   62 (67)
                      |+|.|.+||+.
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            56777777763


No 175
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.20  E-value=25  Score=27.82  Aligned_cols=14  Identities=36%  Similarity=1.125  Sum_probs=11.6

Q ss_pred             eecCCCCCCCCCcc
Q 038108           16 RQQAPGSCPYCGGK   29 (67)
Q Consensus        16 ~~~ApG~Cp~CGG~   29 (67)
                      +++.|-.||.||+.
T Consensus       249 ~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       249 QEPIPKTCPQCGSE  262 (505)
T ss_pred             cCCCCCCCCCCCCC
Confidence            46779999999985


No 176
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=32.15  E-value=20  Score=21.79  Aligned_cols=8  Identities=50%  Similarity=1.622  Sum_probs=6.7

Q ss_pred             CCCCCCcc
Q 038108           22 SCPYCGGK   29 (67)
Q Consensus        22 ~Cp~CGG~   29 (67)
                      .||.||+.
T Consensus        17 ~CP~Cgs~   24 (61)
T PRK08351         17 RCPVCGSR   24 (61)
T ss_pred             cCCCCcCC
Confidence            59999973


No 177
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=32.04  E-value=12  Score=24.65  Aligned_cols=11  Identities=45%  Similarity=1.253  Sum_probs=8.3

Q ss_pred             ceEEeccccce
Q 038108           52 KKYFCSLCSRR   62 (67)
Q Consensus        52 r~~~Ct~C~r~   62 (67)
                      .+|.|++||+.
T Consensus        35 aky~CsfCGK~   45 (92)
T KOG0402|consen   35 AKYTCSFCGKK   45 (92)
T ss_pred             hhhhhhhcchh
Confidence            46888888864


No 178
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription]
Probab=32.04  E-value=26  Score=29.07  Aligned_cols=29  Identities=31%  Similarity=0.744  Sum_probs=22.0

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      .|++|||..-.-|-              .--.-+||.||..|+
T Consensus         2 ~C~~C~~s~fe~d~--------------a~g~~~C~~CG~v~E   30 (521)
T KOG1598|consen    2 VCKNCGGSNFERDE--------------ATGNLYCTACGTVLE   30 (521)
T ss_pred             cCCCCCCCCccccc--------------ccCCceeccccceee
Confidence            69999998766664              334668999998876


No 179
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes.
Probab=31.72  E-value=34  Score=26.35  Aligned_cols=16  Identities=44%  Similarity=0.943  Sum_probs=10.9

Q ss_pred             eeecCCCCCCCCCcce
Q 038108           15 GRQQAPGSCPYCGGKV   30 (67)
Q Consensus        15 ~~~~ApG~Cp~CGG~v   30 (67)
                      +.++.++.||+||+..
T Consensus       247 ~~~~~~~~C~~c~~~~  262 (374)
T TIGR00308       247 GISQRKGRCKECGGEY  262 (374)
T ss_pred             cccCCCCCCCCCCCcc
Confidence            3355667899998754


No 180
>PLN03086 PRLI-interacting factor K; Provisional
Probab=31.71  E-value=8.1  Score=31.99  Aligned_cols=45  Identities=18%  Similarity=0.431  Sum_probs=27.4

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeee---E---------------eeecceEEecccccee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPI---C---------------YNIKKKYFCSLCSRRL   63 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~---~---------------~k~kr~~~Ct~C~r~L   63 (67)
                      ..-.|++||......+++.+.+.|--|+   |               .--+|.+.|.+|+...
T Consensus       452 ~H~~C~~Cgk~f~~s~LekH~~~~Hkpv~CpCg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        452 NHVHCEKCGQAFQQGEMEKHMKVFHEPLQCPCGVVLEKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             cCccCCCCCCccchHHHHHHHHhcCCCccCCCCCCcchhHHHhhhhccCCCCceeCCCCCCcc
Confidence            3447888888777667766666543332   2               0125677788887654


No 181
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=31.10  E-value=24  Score=20.12  Aligned_cols=8  Identities=50%  Similarity=1.456  Sum_probs=5.4

Q ss_pred             CCCCCCcc
Q 038108           22 SCPYCGGK   29 (67)
Q Consensus        22 ~Cp~CGG~   29 (67)
                      .||-||.+
T Consensus        36 ~CP~C~a~   43 (47)
T PF00301_consen   36 VCPVCGAP   43 (47)
T ss_dssp             B-TTTSSB
T ss_pred             cCcCCCCc
Confidence            78888865


No 182
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=31.05  E-value=41  Score=18.20  Aligned_cols=36  Identities=33%  Similarity=0.710  Sum_probs=17.4

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      .||.||+.-.+ =++.|+|====|+    -.-|.|+.|+.+
T Consensus         2 ~Cp~C~~~~a~-~~q~Q~RsaDE~m----T~fy~C~~C~~~   37 (40)
T smart00440        2 PCPKCGNREAT-FFQLQTRSADEPM----TVFYVCTKCGHR   37 (40)
T ss_pred             cCCCCCCCeEE-EEEEcccCCCCCC----eEEEEeCCCCCE
Confidence            59999865443 3444433110011    123567777654


No 183
>smart00507 HNHc HNH nucleases.
Probab=30.87  E-value=27  Score=17.55  Aligned_cols=11  Identities=45%  Similarity=1.198  Sum_probs=9.6

Q ss_pred             CCCCCCCcceE
Q 038108           21 GSCPYCGGKVL   31 (67)
Q Consensus        21 G~Cp~CGG~v~   31 (67)
                      +.|++||....
T Consensus        11 ~~C~~C~~~~~   21 (52)
T smart00507       11 GVCAYCGKPAS   21 (52)
T ss_pred             CCCcCCcCCCC
Confidence            89999999875


No 184
>KOG4317 consensus Predicted Zn-finger protein [Function unknown]
Probab=30.62  E-value=22  Score=28.50  Aligned_cols=22  Identities=27%  Similarity=0.446  Sum_probs=13.9

Q ss_pred             EeeeEeeecceEEeccccceee
Q 038108           43 FLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        43 flP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      +-|+|-+-||.|.|++|..++=
T Consensus         9 ~C~ic~vq~~~YtCPRCn~~YC   30 (383)
T KOG4317|consen    9 ACGICGVQKREYTCPRCNLLYC   30 (383)
T ss_pred             eccccccccccccCCCCCccce
Confidence            3466666677777777766543


No 185
>PRK01343 zinc-binding protein; Provisional
Probab=29.94  E-value=18  Score=21.79  Aligned_cols=12  Identities=33%  Similarity=0.833  Sum_probs=9.6

Q ss_pred             CCCCCCCCcceE
Q 038108           20 PGSCPYCGGKVL   31 (67)
Q Consensus        20 pG~Cp~CGG~v~   31 (67)
                      .-.||-||-.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            467999999864


No 186
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.47  E-value=28  Score=25.14  Aligned_cols=14  Identities=36%  Similarity=0.904  Sum_probs=10.5

Q ss_pred             CCCCCCCcceEEEE
Q 038108           21 GSCPYCGGKVLAID   34 (67)
Q Consensus        21 G~Cp~CGG~v~a~D   34 (67)
                      -.|.+|||.-.+.-
T Consensus       135 ~~C~~Cgg~fv~~~  148 (187)
T PRK12722        135 SSCNCCGGHFVTHA  148 (187)
T ss_pred             ccCCCCCCCeeccc
Confidence            36999999976443


No 187
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=29.42  E-value=50  Score=17.85  Aligned_cols=16  Identities=19%  Similarity=0.613  Sum_probs=11.3

Q ss_pred             CCCCCC--CCCcceEEEE
Q 038108           19 APGSCP--YCGGKVLAID   34 (67)
Q Consensus        19 ApG~Cp--~CGG~v~a~D   34 (67)
                      .---||  .|+..+...|
T Consensus        17 ~~~~CP~~~C~~~~~~~~   34 (64)
T smart00647       17 DLKWCPAPDCSAAIIVTE   34 (64)
T ss_pred             CccCCCCCCCcceEEecC
Confidence            334588  9988887763


No 188
>PF13966 zf-RVT:  zinc-binding in reverse transcriptase
Probab=29.40  E-value=29  Score=20.61  Aligned_cols=15  Identities=33%  Similarity=0.687  Sum_probs=11.6

Q ss_pred             ecCCCCCCCCCcceE
Q 038108           17 QQAPGSCPYCGGKVL   31 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~   31 (67)
                      -..++.|+.||+..+
T Consensus        56 ~~~~~~C~~C~~~~E   70 (86)
T PF13966_consen   56 IQVDPICPLCGNEEE   70 (86)
T ss_pred             CccCCccccCCCccc
Confidence            467799999998543


No 189
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=28.93  E-value=23  Score=24.45  Aligned_cols=8  Identities=63%  Similarity=1.759  Sum_probs=6.9

Q ss_pred             CCCCCCcc
Q 038108           22 SCPYCGGK   29 (67)
Q Consensus        22 ~Cp~CGG~   29 (67)
                      -||.|||.
T Consensus        21 GCP~CGg~   28 (131)
T PF09845_consen   21 GCPECGGN   28 (131)
T ss_pred             cCcccCCc
Confidence            49999996


No 191
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=28.53  E-value=28  Score=26.67  Aligned_cols=21  Identities=48%  Similarity=1.056  Sum_probs=12.8

Q ss_pred             cCCceeeeeeecCCCCCCCCC
Q 038108            7 CSEEERELGRQQAPGSCPYCG   27 (67)
Q Consensus         7 cde~~kv~~~~~ApG~Cp~CG   27 (67)
                      |..+|+-+.-..+.|.||+||
T Consensus       123 c~~~e~fl~e~~v~g~CP~C~  143 (391)
T PF09334_consen  123 CPSCERFLPESFVEGTCPYCG  143 (391)
T ss_dssp             ETTTTEEE-GGGETCEETTT-
T ss_pred             ecCcCcccccceeeccccCcC
Confidence            445566666666778888766


No 192
>PRK06450 threonine synthase; Validated
Probab=28.51  E-value=52  Score=24.67  Aligned_cols=16  Identities=25%  Similarity=0.478  Sum_probs=11.8

Q ss_pred             cCCCCCCCCCcceEEE
Q 038108           18 QAPGSCPYCGGKVLAI   33 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~   33 (67)
                      ...-.||.|||.+...
T Consensus        16 ~~~~~C~~cg~~l~~~   31 (338)
T PRK06450         16 IYEIRCKKCGGPFEIL   31 (338)
T ss_pred             cccccCCcCCCEeEEe
Confidence            3346899999987654


No 193
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=28.51  E-value=30  Score=24.57  Aligned_cols=20  Identities=30%  Similarity=0.519  Sum_probs=15.2

Q ss_pred             eeeecCCCCCCCCCcceEEE
Q 038108           14 LGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      .++-++++.|++|||---+.
T Consensus       104 g~~s~l~~~c~~c~g~fc~~  123 (162)
T COG3582         104 GKGSTLAGKCNYCTGYFCAE  123 (162)
T ss_pred             cCCccccccccCCCCcceec
Confidence            34568999999999965543


No 194
>PF03117 Herpes_UL49_1:  UL49 family;  InterPro: IPR004339 UL49 proteins are present in the viral tegument at the surface of the nucleocapsid []. Many of the nonconserved tegument proteins of alpha-herpes viruses play important roles during different steps of the viral replication cycle, such as the shutoff of host cell functions by the vhs protein encoded by UL41 and the transcriptional activation of viral immediate-early genes by the UL48 gene product, VP16. UL49 of Human herpesvirus 1 (HHV-1) has been shown to directly interact with VP16. The UL49 gene products of HHV-1 and Bovine herpesvirus 1 exhibit virus-independent intercellular trafficking of unknown biological function but are dispensable for productive viral replication.  Envelope glycoprotein M (gM) and the complex formed by glycoproteins E (gE) and I (gI) are involved in the secondary envelopment of Suid herpesvirus 1 (Pseudorabies virus, PrV) particles in the cytoplasm of infected cells. In the absence of the gE-gI complex and gM, envelopment is blocked and capsids surrounded by tegument proteins accumulate in the cytoplasm. The cytoplasmic domains of gE and gM specifically interact with the C-terminal part of the UL49 gene product of PrV suggesting a role for the protein in secondary envelopment during herpesvirus virion maturation [].; GO: 0016032 viral reproduction, 0019033 viral tegument
Probab=28.43  E-value=42  Score=25.35  Aligned_cols=26  Identities=23%  Similarity=0.593  Sum_probs=19.3

Q ss_pred             EEEcCCceeeeeeecCCC--CCCCCCcc
Q 038108            4 VYVCSEEERELGRQQAPG--SCPYCGGK   29 (67)
Q Consensus         4 ~~vcde~~kv~~~~~ApG--~Cp~CGG~   29 (67)
                      +|-=||+||-+----..|  -|++||..
T Consensus       134 FY~RDqkEK~v~~c~~tgriyCS~CGS~  161 (245)
T PF03117_consen  134 FYYRDQKEKQVIYCATTGRIYCSLCGSQ  161 (245)
T ss_pred             eEeccccceeEEEeccCCCEEEccCCCC
Confidence            455688888777666655  49999985


No 195
>TIGR03031 cas_csx12 CRISPR-associated protein, Csx12 family. Members of this family of CRISPR-associated (cas) protein are found, so far, in CRISPR/cas loci in Wolinella succinogenes DSM 1740, Legionella pneumophila str. Paris, and Francisella tularensis, where the last probably is an example of a degenerate CRISPR locus, having neither repeats nor a functional Cas1. The characteristic repeat length is 37 base pairs and period is about 72. One region of this large protein shows sequence similarity to PFAM model pfam01844, HNH endonuclease.
Probab=28.24  E-value=27  Score=30.31  Aligned_cols=13  Identities=38%  Similarity=0.905  Sum_probs=10.9

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      -+-|+|||||..+
T Consensus       758 fs~gIcpY~Ga~i  770 (802)
T TIGR03031       758 FSMGICPYKGASI  770 (802)
T ss_pred             HhccCCCCCCCCC
Confidence            3679999999877


No 196
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=27.79  E-value=24  Score=21.75  Aligned_cols=12  Identities=42%  Similarity=1.063  Sum_probs=8.0

Q ss_pred             eecCCCCCCCCC
Q 038108           16 RQQAPGSCPYCG   27 (67)
Q Consensus        16 ~~~ApG~Cp~CG   27 (67)
                      ++.++-.||.||
T Consensus        46 k~g~~Y~Cp~CG   57 (61)
T COG2888          46 KLGNPYRCPKCG   57 (61)
T ss_pred             HcCCceECCCcC
Confidence            456666777776


No 197
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=27.62  E-value=36  Score=20.70  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=12.7

Q ss_pred             eeeecCCCCCCCCCcceE
Q 038108           14 LGRQQAPGSCPYCGGKVL   31 (67)
Q Consensus        14 ~~~~~ApG~Cp~CGG~v~   31 (67)
                      .+|=-|...||.|+-+=.
T Consensus         3 kKRFIAGA~CP~C~~~Dt   20 (59)
T TIGR02443         3 KKRFIAGAVCPACSAQDT   20 (59)
T ss_pred             cceEeccccCCCCcCccE
Confidence            345568889999986533


No 198
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=27.24  E-value=47  Score=28.35  Aligned_cols=13  Identities=46%  Similarity=1.168  Sum_probs=11.8

Q ss_pred             ecCCCCCCCCCcc
Q 038108           17 QQAPGSCPYCGGK   29 (67)
Q Consensus        17 ~~ApG~Cp~CGG~   29 (67)
                      ++-|..||.||+.
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            5889999999997


No 199
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.14  E-value=32  Score=22.54  Aligned_cols=7  Identities=57%  Similarity=1.545  Sum_probs=3.5

Q ss_pred             CCCCCCc
Q 038108           22 SCPYCGG   28 (67)
Q Consensus        22 ~Cp~CGG   28 (67)
                      -||+|+|
T Consensus        23 ~CPrCrG   29 (88)
T COG3809          23 YCPRCRG   29 (88)
T ss_pred             eCCcccc
Confidence            4555554


No 200
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=27.11  E-value=28  Score=23.18  Aligned_cols=7  Identities=71%  Similarity=2.119  Sum_probs=5.6

Q ss_pred             CCCCCCc
Q 038108           22 SCPYCGG   28 (67)
Q Consensus        22 ~Cp~CGG   28 (67)
                      .||+||-
T Consensus         5 ~CP~Cg~   11 (97)
T COG4311           5 PCPYCGE   11 (97)
T ss_pred             cCCCCCC
Confidence            5999984


No 201
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.08  E-value=1.1e+02  Score=20.92  Aligned_cols=30  Identities=20%  Similarity=0.322  Sum_probs=22.0

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEee
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYN   49 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k   49 (67)
                      .-+||.||-.+.++=|-..+-+=-|=|.-|
T Consensus        49 ~t~CP~Cg~~~e~~fvva~~aLVgl~l~mk   78 (115)
T COG1885          49 STSCPKCGEPFESAFVVANTALVGLILSMK   78 (115)
T ss_pred             cccCCCCCCccceeEEEecceeEEEEEEEE
Confidence            458999999998887777666655544444


No 202
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle depende
Probab=26.95  E-value=37  Score=20.93  Aligned_cols=10  Identities=40%  Similarity=1.102  Sum_probs=8.2

Q ss_pred             cCCCCCCCCC
Q 038108           18 QAPGSCPYCG   27 (67)
Q Consensus        18 ~ApG~Cp~CG   27 (67)
                      .++..||+||
T Consensus        82 ~~np~C~~C~   91 (91)
T cd04482          82 RENPVCPKCG   91 (91)
T ss_pred             EcCCcCCCCC
Confidence            3678899997


No 203
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=26.87  E-value=34  Score=23.71  Aligned_cols=15  Identities=27%  Similarity=0.631  Sum_probs=11.3

Q ss_pred             cCCCCCCCCCcceEE
Q 038108           18 QAPGSCPYCGGKVLA   32 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a   32 (67)
                      +-|-+||+||--...
T Consensus        24 k~p~vcP~cg~~~~~   38 (129)
T TIGR02300        24 RRPAVSPYTGEQFPP   38 (129)
T ss_pred             CCCccCCCcCCccCc
Confidence            468899999976543


No 204
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=26.72  E-value=30  Score=23.97  Aligned_cols=11  Identities=45%  Similarity=1.144  Sum_probs=8.6

Q ss_pred             CCCCCCCCcce
Q 038108           20 PGSCPYCGGKV   30 (67)
Q Consensus        20 pG~Cp~CGG~v   30 (67)
                      .-.||.|||.+
T Consensus       133 ~p~C~~Cg~~l  143 (218)
T cd01407         133 VPRCPKCGGLL  143 (218)
T ss_pred             CCcCCCCCCcc
Confidence            34799999974


No 205
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=26.33  E-value=30  Score=23.57  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=8.1

Q ss_pred             CCCCCCCCcc
Q 038108           20 PGSCPYCGGK   29 (67)
Q Consensus        20 pG~Cp~CGG~   29 (67)
                      +-.|||||..
T Consensus       105 ~~~cp~c~s~  114 (146)
T TIGR02159       105 SVQCPRCGSA  114 (146)
T ss_pred             CCcCCCCCCC
Confidence            3589999975


No 206
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=26.29  E-value=30  Score=24.40  Aligned_cols=9  Identities=56%  Similarity=1.523  Sum_probs=7.5

Q ss_pred             CCCCCCcce
Q 038108           22 SCPYCGGKV   30 (67)
Q Consensus        22 ~Cp~CGG~v   30 (67)
                      .||.|||.+
T Consensus       144 ~C~~Cgg~l  152 (242)
T PRK00481        144 RCPKCGGIL  152 (242)
T ss_pred             CCCCCCCcc
Confidence            399999875


No 207
>PRK12860 transcriptional activator FlhC; Provisional
Probab=26.20  E-value=34  Score=24.78  Aligned_cols=13  Identities=38%  Similarity=0.899  Sum_probs=10.3

Q ss_pred             CCCCCCCcceEEE
Q 038108           21 GSCPYCGGKVLAI   33 (67)
Q Consensus        21 G~Cp~CGG~v~a~   33 (67)
                      -.|.+|||.-.+.
T Consensus       135 ~~C~~Cgg~fv~~  147 (189)
T PRK12860        135 ARCCRCGGKFVTH  147 (189)
T ss_pred             ccCCCCCCCeecc
Confidence            4699999997644


No 208
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=26.18  E-value=63  Score=24.69  Aligned_cols=34  Identities=29%  Similarity=0.741  Sum_probs=12.2

Q ss_pred             CCCCCCCCcc-eEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           20 PGSCPYCGGK-VLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        20 pG~Cp~CGG~-v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .+.||+||-. ++..  +.....          .-|+|+-|+-.+++
T Consensus        31 n~yCP~Cg~~~L~~f--~NN~PV----------aDF~C~~C~eeyEL   65 (254)
T PF06044_consen   31 NMYCPNCGSKPLSKF--ENNRPV----------ADFYCPNCNEEYEL   65 (254)
T ss_dssp             H---TTT--SS-EE--------------------EEE-TTT--EEEE
T ss_pred             CCcCCCCCChhHhhc--cCCCcc----------ceeECCCCchHHhh
Confidence            4679999987 5543  333322          25788888876654


No 209
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=26.03  E-value=40  Score=15.78  Aligned_cols=12  Identities=17%  Similarity=0.692  Sum_probs=9.3

Q ss_pred             EEeccccceeee
Q 038108           54 YFCSLCSRRLEL   65 (67)
Q Consensus        54 ~~Ct~C~r~L~~   65 (67)
                      |.|..|++...+
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            789999987654


No 210
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=25.94  E-value=50  Score=22.62  Aligned_cols=38  Identities=24%  Similarity=0.584  Sum_probs=22.1

Q ss_pred             CCCCCCCcc-eEEEEeceeeeEEEeeeEeeecceEEeccccceee
Q 038108           21 GSCPYCGGK-VLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE   64 (67)
Q Consensus        21 G~Cp~CGG~-v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~   64 (67)
                      ..||+||-. ..|+= ..---||     +.---...|+-|++...
T Consensus        78 PgCP~CGn~~~fa~C-~CGkl~C-----i~g~~~~~CPwCg~~g~  116 (131)
T PF15616_consen   78 PGCPHCGNQYAFAVC-GCGKLFC-----IDGEGEVTCPWCGNEGS  116 (131)
T ss_pred             CCCCCCcChhcEEEe-cCCCEEE-----eCCCCCEECCCCCCeee
Confidence            569999987 33332 3333333     33344677888877643


No 211
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=25.90  E-value=43  Score=22.53  Aligned_cols=16  Identities=19%  Similarity=0.519  Sum_probs=11.0

Q ss_pred             ecceEEeccccceeee
Q 038108           50 IKKKYFCSLCSRRLEL   65 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L~~   65 (67)
                      ..+.|.|.+|+...++
T Consensus        19 L~k~FtCp~Cghe~vs   34 (104)
T COG4888          19 LPKTFTCPRCGHEKVS   34 (104)
T ss_pred             CCceEecCccCCeeee
Confidence            4567777777776655


No 212
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=25.78  E-value=41  Score=18.06  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=9.2

Q ss_pred             CCCCCCcceEE
Q 038108           22 SCPYCGGKVLA   32 (67)
Q Consensus        22 ~Cp~CGG~v~a   32 (67)
                      .|+.||.....
T Consensus         7 ~C~~CG~~m~~   17 (58)
T PF13408_consen    7 RCGHCGSKMTR   17 (58)
T ss_pred             EcccCCcEeEE
Confidence            59999998776


No 213
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=25.54  E-value=33  Score=23.75  Aligned_cols=11  Identities=45%  Similarity=1.129  Sum_probs=8.4

Q ss_pred             CCCCCCCCcce
Q 038108           20 PGSCPYCGGKV   30 (67)
Q Consensus        20 pG~Cp~CGG~v   30 (67)
                      .-.||.|||.+
T Consensus       130 ~p~C~~Cgg~l  140 (224)
T cd01412         130 LPRCPKCGGLL  140 (224)
T ss_pred             CCCCCCCCCcc
Confidence            34699999964


No 214
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=25.48  E-value=24  Score=20.98  Aligned_cols=12  Identities=50%  Similarity=1.126  Sum_probs=9.4

Q ss_pred             CCCCCCCCcceE
Q 038108           20 PGSCPYCGGKVL   31 (67)
Q Consensus        20 pG~Cp~CGG~v~   31 (67)
                      ...||.||+...
T Consensus        17 k~~CP~CG~~t~   28 (56)
T PRK13130         17 KEICPVCGGKTK   28 (56)
T ss_pred             cccCcCCCCCCC
Confidence            567999998754


No 215
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.42  E-value=23  Score=25.49  Aligned_cols=26  Identities=35%  Similarity=0.861  Sum_probs=17.7

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      .|-+|||.|+-               ..+|-...|+.|..+
T Consensus        91 ~CARCGGrv~l---------------rsNKv~wvcnlc~k~  116 (169)
T KOG3799|consen   91 FCARCGGRVSL---------------RSNKVMWVCNLCRKQ  116 (169)
T ss_pred             HHHhcCCeeee---------------ccCceEEeccCCcHH
Confidence            47889999863               235666677777554


No 216
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=25.31  E-value=39  Score=27.11  Aligned_cols=28  Identities=43%  Similarity=0.834  Sum_probs=20.0

Q ss_pred             CCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccceeee
Q 038108           19 APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      +.-.||+|+.+           .|=||+        .|+.|+-.|++
T Consensus       275 ~Gy~CP~Ckak-----------vCsLP~--------eCpiC~ltLVs  302 (378)
T KOG2807|consen  275 GGYFCPQCKAK-----------VCSLPI--------ECPICSLTLVS  302 (378)
T ss_pred             CceeCCcccCe-----------eecCCc--------cCCccceeEec
Confidence            34468888764           477775        68888888876


No 217
>PRK14724 DNA topoisomerase III; Provisional
Probab=25.13  E-value=43  Score=29.17  Aligned_cols=14  Identities=50%  Similarity=1.156  Sum_probs=11.8

Q ss_pred             ecCCCCCCCCCcce
Q 038108           17 QQAPGSCPYCGGKV   30 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v   30 (67)
                      +.+-|.||.||+.+
T Consensus       752 ~~~~g~CPkCg~~v  765 (987)
T PRK14724        752 QESLGPCPKCGAPV  765 (987)
T ss_pred             cccccCCCCCCCce
Confidence            56779999999985


No 218
>PF09856 DUF2083:  Predicted transcriptional regulator (DUF2083);  InterPro: IPR018653  This domain is found in various prokaryotic transcriptional regulatory proteins belonging to the XRE family. Its exact function is, as yet, unknown. 
Probab=25.10  E-value=66  Score=22.44  Aligned_cols=25  Identities=24%  Similarity=0.465  Sum_probs=21.0

Q ss_pred             EEEEEcCCceeeeeeecCCC--------CCCCC
Q 038108            2 CLVYVCSEEERELGRQQAPG--------SCPYC   26 (67)
Q Consensus         2 ~~~~vcde~~kv~~~~~ApG--------~Cp~C   26 (67)
                      +|+..||..+.++.+++|+|        +||.=
T Consensus        12 ff~~r~D~AGniskR~~a~gf~~~R~GgaCPlW   44 (156)
T PF09856_consen   12 FFFVRCDRAGNISKRFSATGFPFPRFGGACPLW   44 (156)
T ss_pred             EEEEEEcCCCCEEeeccCCCCccCCCCCcCcCc
Confidence            57889999999999999875        67764


No 219
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=24.99  E-value=42  Score=25.65  Aligned_cols=24  Identities=33%  Similarity=0.811  Sum_probs=18.7

Q ss_pred             ceeeeeeecCCCCCCCCCcceEEE
Q 038108           10 EERELGRQQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        10 ~~kv~~~~~ApG~Cp~CGG~v~a~   33 (67)
                      -++-.++-|--|.||.|||.++-+
T Consensus       173 c~~k~rr~pl~g~c~kcg~~~~lt  196 (253)
T COG1933         173 CNTKFRRPPLDGKCPICGGKIVLT  196 (253)
T ss_pred             hhhhhcCCCccccccccCCeEEEE
Confidence            345567889999999999977643


No 220
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=24.84  E-value=38  Score=24.31  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=8.5

Q ss_pred             CCCCCCCCcce
Q 038108           20 PGSCPYCGGKV   30 (67)
Q Consensus        20 pG~Cp~CGG~v   30 (67)
                      .-.||.|||.+
T Consensus       143 ~p~Cp~Cgg~l  153 (244)
T PRK14138        143 VPRCDDCSGLI  153 (244)
T ss_pred             CCCCCCCCCeE
Confidence            34699999864


No 221
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=24.83  E-value=35  Score=16.77  Aligned_cols=10  Identities=50%  Similarity=1.205  Sum_probs=6.6

Q ss_pred             CCCCCCcceE
Q 038108           22 SCPYCGGKVL   31 (67)
Q Consensus        22 ~Cp~CGG~v~   31 (67)
                      .||.||-.-.
T Consensus         4 ~C~~CgR~F~   13 (25)
T PF13913_consen    4 PCPICGRKFN   13 (25)
T ss_pred             cCCCCCCEEC
Confidence            4788876543


No 222
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=24.73  E-value=57  Score=26.30  Aligned_cols=38  Identities=21%  Similarity=0.648  Sum_probs=22.4

Q ss_pred             CCCCCCCcceEEEEeceeeeEEEeeeE-eeecceEEecccccee
Q 038108           21 GSCPYCGGKVLAIDFESQCRFCFLPIC-YNIKKKYFCSLCSRRL   63 (67)
Q Consensus        21 G~Cp~CGG~v~a~Dves~~rfCflP~~-~k~kr~~~Ct~C~r~L   63 (67)
                      -.||+||..-. .+.+. .++   |-= ....-.|.|..||...
T Consensus       201 vpCPhCg~~~~-l~~~~-l~w---~~~~~~~~a~y~C~~Cg~~i  239 (557)
T PF05876_consen  201 VPCPHCGEEQV-LEWEN-LKW---DKGEAPETARYVCPHCGCEI  239 (557)
T ss_pred             ccCCCCCCCcc-ccccc-eee---cCCCCccceEEECCCCcCCC
Confidence            35999998765 33332 111   110 2334678999999764


No 223
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=24.69  E-value=41  Score=22.67  Aligned_cols=22  Identities=27%  Similarity=0.567  Sum_probs=14.6

Q ss_pred             CCceeeeeeecCCCCCCCCCcc
Q 038108            8 SEEERELGRQQAPGSCPYCGGK   29 (67)
Q Consensus         8 de~~kv~~~~~ApG~Cp~CGG~   29 (67)
                      |.++-.-.-++..-.||.||+.
T Consensus        53 gg~~a~~nv~~t~~~Cp~Cgh~   74 (105)
T KOG2906|consen   53 GGDEAWENVDQTEATCPTCGHE   74 (105)
T ss_pred             CCcccccchhhccCcCCCCCCC
Confidence            3333344446677899999986


No 224
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=24.68  E-value=11  Score=20.70  Aligned_cols=39  Identities=23%  Similarity=0.623  Sum_probs=24.0

Q ss_pred             CCCCCCC--CCcceEEEEeceeee-EEEeeeEeeecceEEecc----ccceee
Q 038108           19 APGSCPY--CGGKVLAIDFESQCR-FCFLPICYNIKKKYFCSL----CSRRLE   64 (67)
Q Consensus        19 ApG~Cp~--CGG~v~a~Dves~~r-fCflP~~~k~kr~~~Ct~----C~r~L~   64 (67)
                      ++-.||+  |...+..-+++.... -|       -++.+.|++    |+.+..
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C-------~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENEC-------PKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTS-------TTSEEE-SS----S--EEE
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccC-------CCCcEECCCCCCCCCCccc
Confidence            4557888  555688888888776 66       457788888    877653


No 225
>PF05015 Plasmid_killer:  Plasmid maintenance system killer protein;  InterPro: IPR007711 Several plasmids with proteic killer gene systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of those systems result in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.
Probab=24.32  E-value=75  Score=19.57  Aligned_cols=19  Identities=16%  Similarity=0.113  Sum_probs=15.7

Q ss_pred             cceEEEEeceeeeEEEeee
Q 038108           28 GKVLAIDFESQCRFCFLPI   46 (67)
Q Consensus        28 G~v~a~Dves~~rfCflP~   46 (67)
                      .+--++||.-+||++|-+.
T Consensus        62 ~g~~Si~i~~~~RliF~~~   80 (93)
T PF05015_consen   62 KGQWSIRINGNWRLIFRFE   80 (93)
T ss_pred             CCcEEEEeCCCEEEEEEEe
Confidence            3567899999999999653


No 226
>PF04400 DUF539:  Protein of unknown function (DUF539);  InterPro: IPR007495 This is a family of putative periplasmic proteins.
Probab=24.03  E-value=22  Score=20.55  Aligned_cols=24  Identities=33%  Similarity=0.774  Sum_probs=16.8

Q ss_pred             eeeeecCCCCCCCCCcceEEEEeceeee
Q 038108           13 ELGRQQAPGSCPYCGGKVLAIDFESQCR   40 (67)
Q Consensus        13 v~~~~~ApG~Cp~CGG~v~a~Dves~~r   40 (67)
                      ++++++..|||    |++.++.++..--
T Consensus         2 i~~rk~I~GSC----GGl~~lGi~~~C~   25 (45)
T PF04400_consen    2 IFGRKPIKGSC----GGLGALGIDKECD   25 (45)
T ss_pred             cccCCcccccc----hhhhhcCCCccCC
Confidence            46788999997    5566777765543


No 227
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=24.02  E-value=39  Score=19.67  Aligned_cols=17  Identities=41%  Similarity=0.737  Sum_probs=9.0

Q ss_pred             cCCCCCCCCCcceEEEE
Q 038108           18 QAPGSCPYCGGKVLAID   34 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a~D   34 (67)
                      .|.+.||-|+|+-..-|
T Consensus        12 Gal~~Cp~C~~~~l~~~   28 (55)
T PF08063_consen   12 GALEPCPKCKGGQLYFD   28 (55)
T ss_dssp             TEE---SSSSE-EEEEE
T ss_pred             cCCCCCCCCCCCeEEec
Confidence            36788999999755444


No 228
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=23.85  E-value=27  Score=23.80  Aligned_cols=21  Identities=29%  Similarity=0.776  Sum_probs=10.8

Q ss_pred             cCCceeeeeeecCCCCCCCCCcce
Q 038108            7 CSEEERELGRQQAPGSCPYCGGKV   30 (67)
Q Consensus         7 cde~~kv~~~~~ApG~Cp~CGG~v   30 (67)
                      |+..=|++|+..   .|+||+-++
T Consensus        75 C~K~TKmLGr~D---~CM~C~~pL   95 (114)
T PF11023_consen   75 CGKQTKMLGRVD---ACMHCKEPL   95 (114)
T ss_pred             CCChHhhhchhh---ccCcCCCcC
Confidence            334445555553   566666554


No 229
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.69  E-value=30  Score=21.56  Aligned_cols=15  Identities=33%  Similarity=0.680  Sum_probs=10.8

Q ss_pred             CCCCCCCCcceEEEE
Q 038108           20 PGSCPYCGGKVLAID   34 (67)
Q Consensus        20 pG~Cp~CGG~v~a~D   34 (67)
                      ---||.||-+|.=.+
T Consensus         7 ~v~CP~Cgkpv~w~~   21 (65)
T COG3024           7 TVPCPTCGKPVVWGE   21 (65)
T ss_pred             cccCCCCCCcccccc
Confidence            345999998876544


No 230
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=23.67  E-value=31  Score=21.42  Aligned_cols=11  Identities=36%  Similarity=0.948  Sum_probs=4.7

Q ss_pred             CCCCCCCCCcc
Q 038108           19 APGSCPYCGGK   29 (67)
Q Consensus        19 ApG~Cp~CGG~   29 (67)
                      .---||.||.+
T Consensus        23 ~k~FCp~CGn~   33 (73)
T PF08772_consen   23 TKQFCPKCGNA   33 (73)
T ss_dssp             S--S-SSS--S
T ss_pred             CceeCcccCCC
Confidence            33469999986


No 231
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=23.67  E-value=67  Score=24.70  Aligned_cols=13  Identities=54%  Similarity=1.324  Sum_probs=8.8

Q ss_pred             cCCCCCCCCCcce
Q 038108           18 QAPGSCPYCGGKV   30 (67)
Q Consensus        18 ~ApG~Cp~CGG~v   30 (67)
                      +.+..||+||+..
T Consensus       259 ~~~~~C~~c~~~~  271 (382)
T PRK04338        259 LPPEECPVCGGKF  271 (382)
T ss_pred             CCCCCCCCCCCcc
Confidence            4566788887653


No 232
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=23.52  E-value=32  Score=22.35  Aligned_cols=13  Identities=31%  Similarity=0.902  Sum_probs=8.9

Q ss_pred             cceEEecccccee
Q 038108           51 KKKYFCSLCSRRL   63 (67)
Q Consensus        51 kr~~~Ct~C~r~L   63 (67)
                      ..+|.|++||+.-
T Consensus        33 ~~ky~Cp~Cgk~~   45 (90)
T PF01780_consen   33 HAKYTCPFCGKTS   45 (90)
T ss_dssp             HS-BEESSSSSSE
T ss_pred             hCCCcCCCCCCce
Confidence            4678888888754


No 233
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=23.34  E-value=31  Score=20.72  Aligned_cols=16  Identities=31%  Similarity=0.634  Sum_probs=11.9

Q ss_pred             CCCCCCCCcceEEEEe
Q 038108           20 PGSCPYCGGKVLAIDF   35 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dv   35 (67)
                      ...||-||.+++-.|.
T Consensus        39 YngCPfC~~~~~~~~~   54 (55)
T PF14447_consen   39 YNGCPFCGTPFEFDDP   54 (55)
T ss_pred             ccCCCCCCCcccCCCC
Confidence            3579999998876654


No 234
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=23.13  E-value=96  Score=21.27  Aligned_cols=8  Identities=50%  Similarity=1.352  Sum_probs=4.4

Q ss_pred             CCCCCCCc
Q 038108           21 GSCPYCGG   28 (67)
Q Consensus        21 G~Cp~CGG   28 (67)
                      ..||.|||
T Consensus       131 ~~Cp~C~~  138 (146)
T PF07295_consen  131 PPCPKCGH  138 (146)
T ss_pred             CCCCCCCC
Confidence            34666655


No 235
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=23.12  E-value=38  Score=24.08  Aligned_cols=41  Identities=27%  Similarity=0.681  Sum_probs=21.5

Q ss_pred             CCCCCcceEEEEeceeeeEEEe---eeEe--eecceEEeccccceee
Q 038108           23 CPYCGGKVLAIDFESQCRFCFL---PICY--NIKKKYFCSLCSRRLE   64 (67)
Q Consensus        23 Cp~CGG~v~a~Dves~~rfCfl---P~~~--k~kr~~~Ct~C~r~L~   64 (67)
                      ||.||.+.... .+..--=||+   |+..  +.-.-..|+.|||.+.
T Consensus         1 C~~CG~~~~~~-~~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~   46 (236)
T PF04981_consen    1 CPRCGREIEPL-IDGLCPDCYLKRFDIIEIPDRIEVTICPKCGRYRI   46 (236)
T ss_pred             CCCCCCCCCCc-ccccChHHhcccCCeeecCCccCceECCCCCCEEC
Confidence            78888754321 2222222232   5544  1124568999998764


No 236
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=23.07  E-value=37  Score=21.75  Aligned_cols=6  Identities=83%  Similarity=2.516  Sum_probs=5.0

Q ss_pred             CCCCCC
Q 038108           22 SCPYCG   27 (67)
Q Consensus        22 ~Cp~CG   27 (67)
                      .||+||
T Consensus         3 ~CP~CG    8 (84)
T TIGR01374         3 PCPYCG    8 (84)
T ss_pred             cCCCCC
Confidence            599998


No 237
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=22.52  E-value=39  Score=21.95  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=7.0

Q ss_pred             CCCCCCCCC
Q 038108           19 APGSCPYCG   27 (67)
Q Consensus        19 ApG~Cp~CG   27 (67)
                      ..--||+||
T Consensus        19 ~~~gCpnC~   27 (98)
T cd07973          19 ERDGCPNCE   27 (98)
T ss_pred             cCCCCCCCc
Confidence            456799997


No 238
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=22.46  E-value=27  Score=25.01  Aligned_cols=16  Identities=25%  Similarity=0.519  Sum_probs=13.7

Q ss_pred             ecceEEeccccceeee
Q 038108           50 IKKKYFCSLCSRRLEL   65 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L~~   65 (67)
                      ++.+|+|+.||.++=+
T Consensus       126 ~~S~ysC~~CG~kyCs  141 (156)
T KOG3362|consen  126 YDSKYSCVNCGTKYCS  141 (156)
T ss_pred             CCchhHHHhcCCceee
Confidence            7889999999998755


No 239
>PRK05333 NAD-dependent deacetylase; Provisional
Probab=22.45  E-value=40  Score=24.59  Aligned_cols=10  Identities=50%  Similarity=1.358  Sum_probs=8.1

Q ss_pred             CCCCCCCcce
Q 038108           21 GSCPYCGGKV   30 (67)
Q Consensus        21 G~Cp~CGG~v   30 (67)
                      -.||.|||.+
T Consensus       180 P~C~~Cgg~l  189 (285)
T PRK05333        180 PACPACGGIL  189 (285)
T ss_pred             CCCCCCCCcc
Confidence            4699999975


No 240
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=22.42  E-value=39  Score=16.56  Aligned_cols=12  Identities=25%  Similarity=1.021  Sum_probs=9.7

Q ss_pred             eEEeccccceee
Q 038108           53 KYFCSLCSRRLE   64 (67)
Q Consensus        53 ~~~Ct~C~r~L~   64 (67)
                      +|+|..|...+.
T Consensus         3 ~~~C~~C~~~~~   14 (35)
T smart00451        3 GFYCKLCNVTFT   14 (35)
T ss_pred             CeEccccCCccC
Confidence            688999988765


No 241
>TIGR02646 conserved hypothetical protein TIGR02646. Members of this uncharacterized protein family are found exclusively in bacteria. Neighboring genes in various genomes are also uncharacterized or may annotated as similar to restriction system proteins.
Probab=22.35  E-value=26  Score=23.10  Aligned_cols=17  Identities=29%  Similarity=0.710  Sum_probs=12.7

Q ss_pred             ecCCCCCCCCCcceEEE
Q 038108           17 QQAPGSCPYCGGKVLAI   33 (67)
Q Consensus        17 ~~ApG~Cp~CGG~v~a~   33 (67)
                      +-+.|.|+||+-.+...
T Consensus        21 ~~~~~~C~YC~~~~~~~   37 (144)
T TIGR02646        21 QLQGGLCAYCEREIELL   37 (144)
T ss_pred             HHhCCCcCccCCCcCCC
Confidence            34589999999966643


No 242
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=22.31  E-value=43  Score=23.64  Aligned_cols=11  Identities=27%  Similarity=0.604  Sum_probs=8.6

Q ss_pred             CCCCCCCCcce
Q 038108           20 PGSCPYCGGKV   30 (67)
Q Consensus        20 pG~Cp~CGG~v   30 (67)
                      .-.||.|||.+
T Consensus       136 ~p~C~~Cgg~l  146 (225)
T cd01411         136 SPYHAKCGGVI  146 (225)
T ss_pred             CCCCCCCCCEe
Confidence            35799999864


No 243
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=22.23  E-value=62  Score=19.59  Aligned_cols=21  Identities=14%  Similarity=0.319  Sum_probs=17.0

Q ss_pred             eeEeeecceEEeccccceeee
Q 038108           45 PICYNIKKKYFCSLCSRRLEL   65 (67)
Q Consensus        45 P~~~k~kr~~~Ct~C~r~L~~   65 (67)
                      .++.+.-....|..||+.|..
T Consensus        22 ~vFsha~t~V~C~~Cg~~L~~   42 (59)
T PRK00415         22 VVFSHASTVVRCLVCGKTLAE   42 (59)
T ss_pred             EEEecCCcEEECcccCCCccc
Confidence            467778888999999998853


No 244
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=22.20  E-value=64  Score=16.68  Aligned_cols=14  Identities=29%  Similarity=0.589  Sum_probs=9.5

Q ss_pred             CCCCCCCCcceEEE
Q 038108           20 PGSCPYCGGKVLAI   33 (67)
Q Consensus        20 pG~Cp~CGG~v~a~   33 (67)
                      .|.|..||..+...
T Consensus         3 yg~C~~CGe~I~~~   16 (36)
T PF01258_consen    3 YGICEDCGEPIPEE   16 (36)
T ss_dssp             -SB-TTTSSBEEHH
T ss_pred             CCCccccCChHHHH
Confidence            57899999988644


No 245
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated
Probab=22.13  E-value=74  Score=26.53  Aligned_cols=15  Identities=33%  Similarity=1.096  Sum_probs=12.9

Q ss_pred             CCCCCCCCCcceEEE
Q 038108           19 APGSCPYCGGKVLAI   33 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~   33 (67)
                      .|-.||.||+.++..
T Consensus       403 ~P~~CP~Cgs~l~~~  417 (665)
T PRK07956        403 MPTHCPVCGSELVRV  417 (665)
T ss_pred             CCCCCCCCCCEeEec
Confidence            688999999999753


No 246
>PF04194 PDCD2_C:  Programmed cell death protein 2, C-terminal putative domain ;  InterPro: IPR007320  PDCD2 is localized predominantly in the cytosol of cells situated at the opposite pole of the germinal centre from the centroblasts as well as in cells in the mantle zone. It has been shown to interact with BCL6, an evolutionarily conserved Kruppel-type zinc finger protein that functions as a strong transcriptional repressor and is required for germinal centre development. The rat homologue, Rp8, is associated with programmed cell death in thymocytes.; GO: 0005737 cytoplasm
Probab=22.11  E-value=42  Score=22.76  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=8.7

Q ss_pred             CCCCCCCCcce
Q 038108           20 PGSCPYCGGKV   30 (67)
Q Consensus        20 pG~Cp~CGG~v   30 (67)
                      .-.|++|||.-
T Consensus        97 ip~C~~Cg~~R  107 (164)
T PF04194_consen   97 IPKCENCGSPR  107 (164)
T ss_pred             CCCCccCCCcc
Confidence            45799999864


No 247
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=22.09  E-value=42  Score=19.79  Aligned_cols=12  Identities=42%  Similarity=1.071  Sum_probs=9.7

Q ss_pred             CCCCCCCcceEE
Q 038108           21 GSCPYCGGKVLA   32 (67)
Q Consensus        21 G~Cp~CGG~v~a   32 (67)
                      -.||.|||....
T Consensus        18 ~~cp~cG~~T~~   29 (53)
T PF04135_consen   18 DKCPPCGGPTES   29 (53)
T ss_dssp             SBBTTTSSBSEE
T ss_pred             CccCCCCCCCcC
Confidence            589999998654


No 248
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=21.93  E-value=51  Score=20.21  Aligned_cols=15  Identities=33%  Similarity=0.538  Sum_probs=11.0

Q ss_pred             eecCCCCCCCCCcce
Q 038108           16 RQQAPGSCPYCGGKV   30 (67)
Q Consensus        16 ~~~ApG~Cp~CGG~v   30 (67)
                      |=-|...||.|+.+=
T Consensus         4 rFIAGa~CP~C~~~D   18 (71)
T PF09526_consen    4 RFIAGAVCPKCQAMD   18 (71)
T ss_pred             eEecCccCCCCcCcc
Confidence            345778999998653


No 249
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=21.80  E-value=37  Score=17.95  Aligned_cols=31  Identities=29%  Similarity=0.599  Sum_probs=21.0

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      .||+|+..-...|=+       ||   ...++.-|+.|+-.
T Consensus         4 ~CP~C~~~f~v~~~~-------l~---~~~~~vrC~~C~~~   34 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK-------LP---AGGRKVRCPKCGHV   34 (37)
T ss_pred             ECCCCCceEEcCHHH-------cc---cCCcEEECCCCCcE
Confidence            599999877665532       22   45668888888764


No 250
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=21.74  E-value=42  Score=21.09  Aligned_cols=11  Identities=45%  Similarity=1.059  Sum_probs=6.6

Q ss_pred             CCCCCCcceEE
Q 038108           22 SCPYCGGKVLA   32 (67)
Q Consensus        22 ~Cp~CGG~v~a   32 (67)
                      .||.||=-.-.
T Consensus         3 ~CPCCg~~Tl~   13 (78)
T PF14206_consen    3 PCPCCGYYTLE   13 (78)
T ss_pred             cCCCCCcEEec
Confidence            47777765443


No 251
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=21.73  E-value=38  Score=19.24  Aligned_cols=8  Identities=50%  Similarity=1.256  Sum_probs=6.4

Q ss_pred             CCCCCCcc
Q 038108           22 SCPYCGGK   29 (67)
Q Consensus        22 ~Cp~CGG~   29 (67)
                      -||-||+-
T Consensus        11 ~CPgCG~t   18 (52)
T PF10825_consen   11 PCPGCGMT   18 (52)
T ss_pred             CCCCCcHH
Confidence            59999974


No 252
>smart00532 LIGANc Ligase N family.
Probab=21.71  E-value=80  Score=25.09  Aligned_cols=16  Identities=31%  Similarity=0.947  Sum_probs=13.5

Q ss_pred             CCCCCCCCCcceEEEE
Q 038108           19 APGSCPYCGGKVLAID   34 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~D   34 (67)
                      .|-.||.||..++-.+
T Consensus       398 ~P~~CP~C~s~l~~~~  413 (441)
T smart00532      398 MPTHCPSCGSELVREE  413 (441)
T ss_pred             CCCCCCCCCCEeEecC
Confidence            7899999999997543


No 253
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=21.42  E-value=79  Score=26.25  Aligned_cols=15  Identities=40%  Similarity=1.028  Sum_probs=12.9

Q ss_pred             CCCCCCCCCcceEEE
Q 038108           19 APGSCPYCGGKVLAI   33 (67)
Q Consensus        19 ApG~Cp~CGG~v~a~   33 (67)
                      .|-.||.||..++--
T Consensus       391 ~P~~CP~C~s~l~~~  405 (652)
T TIGR00575       391 FPTHCPSCGSPLVKI  405 (652)
T ss_pred             CCCCCCCCCCEeEec
Confidence            689999999999763


No 254
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=21.31  E-value=1.2e+02  Score=16.21  Aligned_cols=31  Identities=29%  Similarity=0.479  Sum_probs=19.7

Q ss_pred             eecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccccce
Q 038108           16 RQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRR   62 (67)
Q Consensus        16 ~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~   62 (67)
                      +-..|..|..|+..+                ....+..|.|+.|+..
T Consensus         7 ~~~~~~~C~~C~~~i----------------~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    7 TFSKPTYCDVCGKFI----------------WGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             ESSSTEB-TTSSSBE----------------CSSSSCEEEETTTT-E
T ss_pred             cCCCCCCCcccCccc----------------CCCCCCeEEECCCCCh
Confidence            346778888888876                1145667888888753


No 255
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=21.28  E-value=75  Score=24.12  Aligned_cols=17  Identities=24%  Similarity=0.565  Sum_probs=13.1

Q ss_pred             CCCCCCCCcceEEEEec
Q 038108           20 PGSCPYCGGKVLAIDFE   36 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dve   36 (67)
                      .--|++||+.++-.-+.
T Consensus       245 GepC~~CGt~I~k~~~~  261 (273)
T COG0266         245 GEPCRRCGTPIEKIKLG  261 (273)
T ss_pred             CCCCCccCCEeEEEEEc
Confidence            34699999999876654


No 256
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=21.26  E-value=37  Score=21.11  Aligned_cols=9  Identities=44%  Similarity=0.870  Sum_probs=6.7

Q ss_pred             CCCCCCCCc
Q 038108           20 PGSCPYCGG   28 (67)
Q Consensus        20 pG~Cp~CGG   28 (67)
                      --.||+||.
T Consensus        17 ~lrCPRC~~   25 (65)
T COG4049          17 FLRCPRCGM   25 (65)
T ss_pred             eeeCCchhH
Confidence            346999984


No 257
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=21.11  E-value=36  Score=22.17  Aligned_cols=11  Identities=45%  Similarity=1.283  Sum_probs=7.2

Q ss_pred             cceEEeccccc
Q 038108           51 KKKYFCSLCSR   61 (67)
Q Consensus        51 kr~~~Ct~C~r   61 (67)
                      +.+|.|++|++
T Consensus        33 ~a~y~CpfCgk   43 (91)
T TIGR00280        33 KAKYVCPFCGK   43 (91)
T ss_pred             hcCccCCCCCC
Confidence            45677777764


No 258
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=21.10  E-value=49  Score=18.72  Aligned_cols=14  Identities=21%  Similarity=0.750  Sum_probs=7.9

Q ss_pred             ecceEEecccccee
Q 038108           50 IKKKYFCSLCSRRL   63 (67)
Q Consensus        50 ~kr~~~Ct~C~r~L   63 (67)
                      ..||+.|..||+..
T Consensus        22 ~~rrhhCr~CG~~v   35 (69)
T PF01363_consen   22 FRRRHHCRNCGRVV   35 (69)
T ss_dssp             SS-EEE-TTT--EE
T ss_pred             ceeeEccCCCCCEE
Confidence            58899999998754


No 259
>PF09012 FeoC:  FeoC like transcriptional regulator;  InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif. FeoC acts as a [Fe-S] dependent transcriptional repressor []. ; PDB: 1XN7_A 2K02_A.
Probab=20.95  E-value=96  Score=17.78  Aligned_cols=12  Identities=42%  Similarity=0.839  Sum_probs=6.6

Q ss_pred             CCCCCCCCcceE
Q 038108           20 PGSCPYCGGKVL   31 (67)
Q Consensus        20 pG~Cp~CGG~v~   31 (67)
                      .|.|..|++.-.
T Consensus        54 ~~~C~~C~~~~~   65 (69)
T PF09012_consen   54 GGSCSSCGPASK   65 (69)
T ss_dssp             SSSSSS-SS---
T ss_pred             CCCCCCCCCccc
Confidence            578998987643


No 260
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=20.80  E-value=46  Score=23.37  Aligned_cols=10  Identities=50%  Similarity=1.361  Sum_probs=8.0

Q ss_pred             CCCCCCCcce
Q 038108           21 GSCPYCGGKV   30 (67)
Q Consensus        21 G~Cp~CGG~v   30 (67)
                      -.||.|||.+
T Consensus       137 p~C~~Cgg~l  146 (222)
T cd01413         137 PRCPKCGGII  146 (222)
T ss_pred             CcCCCCCCcc
Confidence            4699999864


No 261
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]
Probab=20.47  E-value=83  Score=24.48  Aligned_cols=26  Identities=23%  Similarity=0.468  Sum_probs=22.5

Q ss_pred             eeeeecCCCCCCCCCcceEEEEecee
Q 038108           13 ELGRQQAPGSCPYCGGKVLAIDFESQ   38 (67)
Q Consensus        13 v~~~~~ApG~Cp~CGG~v~a~Dves~   38 (67)
                      ++---.||.-|-|||-.++++.++..
T Consensus       253 lvTVWSAPNYCYRCGNvAsi~~~d~~  278 (306)
T KOG0373|consen  253 LVTVWSAPNYCYRCGNVASIMSFDDN  278 (306)
T ss_pred             EEEEecCCchhhhccCeeeEEEeccc
Confidence            66677899999999999999988754


No 262
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=20.31  E-value=80  Score=26.57  Aligned_cols=15  Identities=33%  Similarity=0.848  Sum_probs=12.8

Q ss_pred             cCCCCCCCCCcceEE
Q 038108           18 QAPGSCPYCGGKVLA   32 (67)
Q Consensus        18 ~ApG~Cp~CGG~v~a   32 (67)
                      ..|-.||.||..++-
T Consensus       421 ~~P~~CP~C~~~l~~  435 (689)
T PRK14351        421 EFPDTCPVCDSAVER  435 (689)
T ss_pred             cCCCCCCCCCCEeee
Confidence            468999999999863


No 263
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=20.19  E-value=1.2e+02  Score=18.48  Aligned_cols=27  Identities=26%  Similarity=0.700  Sum_probs=18.0

Q ss_pred             CCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108           22 SCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus        22 ~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      +||-|-|+++..               +.+...+|..|++-+
T Consensus        10 aCP~~kg~L~~~---------------~~~~~L~c~~~~~aY   36 (60)
T COG2835          10 ACPVCKGPLVYD---------------EEKQELICPRCKLAY   36 (60)
T ss_pred             eccCcCCcceEe---------------ccCCEEEecccCcee
Confidence            699999995543               333367777777654


No 264
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=20.03  E-value=39  Score=21.92  Aligned_cols=11  Identities=36%  Similarity=1.020  Sum_probs=6.9

Q ss_pred             cceEEeccccc
Q 038108           51 KKKYFCSLCSR   61 (67)
Q Consensus        51 kr~~~Ct~C~r   61 (67)
                      +.+|.|++|++
T Consensus        34 ~a~y~CpfCgk   44 (90)
T PRK03976         34 RAKHVCPVCGR   44 (90)
T ss_pred             hcCccCCCCCC
Confidence            45667777754


No 265
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=20.01  E-value=45  Score=23.82  Aligned_cols=13  Identities=31%  Similarity=0.818  Sum_probs=10.3

Q ss_pred             eeecceEEecccc
Q 038108           48 YNIKKKYFCSLCS   60 (67)
Q Consensus        48 ~k~kr~~~Ct~C~   60 (67)
                      --+-|||+|+.|.
T Consensus       121 ~vSPRRYFClQCH  133 (155)
T COG3043         121 DVSPRRYFCLQCH  133 (155)
T ss_pred             ccCccceeeeecc
Confidence            3467999999995


Done!