Citrus Sinensis ID: 038133


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MNRLVDEGGSNNKKPLFLTKAQREQLALERRQEQIAQQKRRQEQQQQLLSQPQTHGRNSSDSRDRERERHRREREEEAKARERARLEKLAERERERELELIKEQYLGSKKPKKRVIKPSEKFRFSFDWENTEDTSRDMNALYQNPHEAQLLFGRGFRAGMDRREQKKLAAKNEKEMREEIRKKEGVEEKPEEAAALKLKEEAADLYDTFDMRVDRHWSEKKLEEMTERDWRIFREDFNISYKGSKIPRPMRNWAEGKLTPELLRAVERVGYKNPSPIQMAAIPLGLQQRDVIGIAETGSGKTAAFVLPMLTYISRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFAHYLGIKVVSIVGGQSIEEQGFRIRQGCEVVIATPGRLIDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNLKPENEDEELDEKRIYRTTYMFSATMPPAVERLARKYLRNPVVVTIGTAGKATELISQHVVMMKESEKFSRLQRLLDELGDKTAIVFVNTKKNADMVAKNLDKLGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATTFLTFHDTDVFYDLKQMLIQSNSPVPPELAKHEASKFKPGTIPDRPPRRNDTVFAH
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEccccHHHHHHHcccEEcccccEEEcccccccccccccHHHHHHHccccccccccccHHHHHHccccccEEEEEEccccHHHHHHHHHHHccccEEEEcccccccccEEEEEEEEcccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccHHHHHcHHHccccccccccccccccccccc
***************************************************************************************************************************FSFDWENTEDTSRDM**********QLLFGR************************************************ADLYDTFDMRVDRHWSEKKLEEMTERDWRIFREDFNISYKGSKIPRPMRNWAEGKLTPELLRAVERVGYKNPSPIQMAAIPLGLQQRDVIGIAETGSGKTAAFVLPMLTYISRLPPI*******GPYAVVMAPTRELAQQIEEETVKFAHYLGIKVVSIVGGQSIEEQGFRIRQGCEVVIATPGRLIDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNL*******ELDEKRIYRTTYMFSATMPPAVERLARKYLRNPVVVTIGTAGKATELISQHVVMMKESEKFSRLQRLLDELGDKTAIVFVNTKKNADMVAKNLDKLGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATTFLTFHDTDVFYDLKQMLIQSNSPVPP*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRLVDEGGSNNKKPLFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSQPQTHGRNSSDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQYLGSKKPKKRVIKPSEKFRFSFDWENTEDTSRDMNALYQNPHEAQLLFGRGFRAGMDRxxxxxxxxxxxxxxxxxxxxxxxxxxxPEEAAALKLKEEAADLYDTFDMRVDRHWSEKKLEEMTERDWRIFREDFNISYKGSKIPRPMRNWAEGKLTPELLRAVERVGYKNPSPIQMAAIPLGLQQRDVIGIAETGSGKTAAFVLPMLTYISRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFAHYLGIKVVSIVGGQSIEEQGFRIRQGCEVVIATPGRLIDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNLKPENEDEELDEKRIYRTTYMFSATMPPAVERLARKYLRNPVVVTIGTAGKATELISQHVVMMKESEKFSRLQRLLDELGDKTAIVFVNTKKNADMVAKNLDKLGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATTFLTFHDTDVFYDLKQMLIQSNSPVPPELAKHEASKFKPGTIPDRPPRRNDTVFAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 21 ATP-dependent RNA helicase involved in mRNA splicing. May destabilize the U1/5'-splice site duplex to permit an effective competition for the 5'-splice site by the U6 snRNA, resulting in the switch between U1 and U6 at the 5'-splice site. May also act to unwind the U4/U6 base-pairing interaction in the U4/U6/U5 snRNP, facilitating the first covalent step of splicing.confidentP93008
DEAD-box ATP-dependent RNA helicase 21 ATP-dependent RNA helicase involved in mRNA splicing. May destabilize the U1/5'-splice site duplex to permit an effective competition for the 5'-splice site by the U6 snRNA, resulting in the switch between U1 and U6 at the 5'-splice site. May also act to unwind the U4/U6 base-pairing interaction in the U4/U6/U5 snRNP, facilitating the first covalent step of splicing.confidentQ53RK8
Pre-mRNA-splicing ATP-dependent RNA helicase prp28 ATP-dependent RNA helicase involved in mRNA splicing. May destabilize the U1/5'-splice site duplex to permit an effective competition for the 5'-splice site by the U6 snRNA, resulting in the switch between U1 and U6 at the 5'-splice site. May also act to unwind the U4/U6 base-pairing interaction in the U4/U6/U5 snRNP, facilitating the first covalent step of splicing.probableQ9Y7T7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DB3, chain A
Confidence level:very confident
Coverage over the Query: 236-432,448-645
View the alignment between query and template
View the model in PyMOL
Template: 2FSF, chain A
Confidence level:confident
Coverage over the Query: 443-624
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 19-99
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 29-104
View the alignment between query and template
View the model in PyMOL