Citrus Sinensis ID: 038249

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
ACSEVSAKEKKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSSQRLPLHKLLEHPWIIQNADPSGVYRG
cccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccECccccEEEEccEEEEEEEEccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccECcccccccccccccccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccCCccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
************WTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSSQRLPLHKLLEHPWIIQNADPS*VYR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ACSEVSAKEKKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSSQRLPLHKLLEHPWIIQNADPSGVYRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase Aurora-1 Phosphorylates specifically 'Ser-10' of histone H3 in vitro and colocalizes with phosphorylated histone H3 during mitosis. Associates with cytoskeletal structures that are necessary for cytokinesis and with the microtubule spindle. Might also colocalize with gamma-tubulin and function in microtubule organizing centers (MTOCs). In contrast with the mammalian B-type Aurora, AUR1 has no kinase activity toward 'Ser-28' of histone H3.confidentQ9M077
Aurora/IPL1-related protein kinase 2 Serine/threonine-protein kinase which mediates both meiotic and mitotic chromosome segregation. Required for histone H3 'Ser-10' phosphorylation. Phosphorylates tlk-1 at 'Ser-634', which enhances its activity. Phosphorylates zen-4 at 'Ser-680'.probableO01427
Serine/threonine-protein kinase Aurora-2 Phosphorylates specifically 'Ser-10' of histone H3 in vitro. Associates with cytoskeletal structures that are necessary for cytokinesis and with the microtubule spindle. Might colocalize with gamma-tubulin and function in microtubule organizing centers (MTOCs).probableQ683C9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FDN, chain A
Confidence level:very confident
Coverage over the Query: 11-274
View the alignment between query and template
View the model in PyMOL