BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038317
(127 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2E0I|A Chain A, Crystal Structure Of Archaeal Photolyase From Sulfolobus
Tokodaii With Two Fad Molecules: Implication Of A Novel
Light-Harvesting Cofactor
pdb|2E0I|B Chain B, Crystal Structure Of Archaeal Photolyase From Sulfolobus
Tokodaii With Two Fad Molecules: Implication Of A Novel
Light-Harvesting Cofactor
pdb|2E0I|C Chain C, Crystal Structure Of Archaeal Photolyase From Sulfolobus
Tokodaii With Two Fad Molecules: Implication Of A Novel
Light-Harvesting Cofactor
pdb|2E0I|D Chain D, Crystal Structure Of Archaeal Photolyase From Sulfolobus
Tokodaii With Two Fad Molecules: Implication Of A Novel
Light-Harvesting Cofactor
Length = 440
Score = 27.3 bits (59), Expect = 2.4, Method: Composition-based stats.
Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 6/50 (12%)
Query: 59 TGLVSALLESDCLEVV------QIVNNRCSSMVEISWMISEILEMNNSFQ 102
TGL AL E D + V Q++NN S +S+MI+ +LE+++ +
Sbjct: 17 TGLNYALSECDRVIPVFIADPRQLINNPYKSEFAVSFMINSLLELDDELR 66
>pdb|4AU2|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex
pdb|4AU2|B Chain B, Crystal Structure Of A Hsp47-Collagen Complex
pdb|4AU2|C Chain C, Crystal Structure Of A Hsp47-Collagen Complex
pdb|4AU2|D Chain D, Crystal Structure Of A Hsp47-Collagen Complex
pdb|4AU4|A Chain A, Crystal Structure Of Hsp47
pdb|4AU4|B Chain B, Crystal Structure Of Hsp47
pdb|4AU4|C Chain C, Crystal Structure Of Hsp47
pdb|4AU4|D Chain D, Crystal Structure Of Hsp47
pdb|4AU4|E Chain E, Crystal Structure Of Hsp47
pdb|4AU4|F Chain F, Crystal Structure Of Hsp47
pdb|4AU4|G Chain G, Crystal Structure Of Hsp47
pdb|3ZHA|A Chain A, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|B Chain B, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|C Chain C, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|D Chain D, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|K Chain K, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|L Chain L, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|P Chain P, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition.
pdb|3ZHA|Q Chain Q, Molecular Basis For The Action Of The Collagen-Specific
Chaperone Hsp47 Serpinh1 And Its Structure-Specific
Client Recognition
Length = 392
Score = 25.8 bits (55), Expect = 6.9, Method: Composition-based stats.
Identities = 13/49 (26%), Positives = 26/49 (53%)
Query: 3 VDATVDVEKQVAGLGVVIRDDKDNCIVAAIISYRIFTNVAMAEAAAIKW 51
V+ T D++K +AGLG+ DK+ ++ + + ++ A A +W
Sbjct: 277 VEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEW 325
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.131 0.373
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,979,137
Number of Sequences: 62578
Number of extensions: 85497
Number of successful extensions: 499
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 493
Number of HSP's gapped (non-prelim): 8
length of query: 127
length of database: 14,973,337
effective HSP length: 87
effective length of query: 40
effective length of database: 9,529,051
effective search space: 381162040
effective search space used: 381162040
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)