BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038317
         (127 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2E0I|A Chain A, Crystal Structure Of Archaeal Photolyase From Sulfolobus
           Tokodaii With Two Fad Molecules: Implication Of A Novel
           Light-Harvesting Cofactor
 pdb|2E0I|B Chain B, Crystal Structure Of Archaeal Photolyase From Sulfolobus
           Tokodaii With Two Fad Molecules: Implication Of A Novel
           Light-Harvesting Cofactor
 pdb|2E0I|C Chain C, Crystal Structure Of Archaeal Photolyase From Sulfolobus
           Tokodaii With Two Fad Molecules: Implication Of A Novel
           Light-Harvesting Cofactor
 pdb|2E0I|D Chain D, Crystal Structure Of Archaeal Photolyase From Sulfolobus
           Tokodaii With Two Fad Molecules: Implication Of A Novel
           Light-Harvesting Cofactor
          Length = 440

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 59  TGLVSALLESDCLEVV------QIVNNRCSSMVEISWMISEILEMNNSFQ 102
           TGL  AL E D +  V      Q++NN   S   +S+MI+ +LE+++  +
Sbjct: 17  TGLNYALSECDRVIPVFIADPRQLINNPYKSEFAVSFMINSLLELDDELR 66


>pdb|4AU2|A Chain A, Crystal Structure Of A Hsp47-Collagen Complex
 pdb|4AU2|B Chain B, Crystal Structure Of A Hsp47-Collagen Complex
 pdb|4AU2|C Chain C, Crystal Structure Of A Hsp47-Collagen Complex
 pdb|4AU2|D Chain D, Crystal Structure Of A Hsp47-Collagen Complex
 pdb|4AU4|A Chain A, Crystal Structure Of Hsp47
 pdb|4AU4|B Chain B, Crystal Structure Of Hsp47
 pdb|4AU4|C Chain C, Crystal Structure Of Hsp47
 pdb|4AU4|D Chain D, Crystal Structure Of Hsp47
 pdb|4AU4|E Chain E, Crystal Structure Of Hsp47
 pdb|4AU4|F Chain F, Crystal Structure Of Hsp47
 pdb|4AU4|G Chain G, Crystal Structure Of Hsp47
 pdb|3ZHA|A Chain A, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|B Chain B, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|C Chain C, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|D Chain D, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|K Chain K, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|L Chain L, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|P Chain P, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition.
 pdb|3ZHA|Q Chain Q, Molecular Basis For The Action Of The Collagen-Specific
           Chaperone Hsp47 Serpinh1 And Its Structure-Specific
           Client Recognition
          Length = 392

 Score = 25.8 bits (55), Expect = 6.9,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 3   VDATVDVEKQVAGLGVVIRDDKDNCIVAAIISYRIFTNVAMAEAAAIKW 51
           V+ T D++K +AGLG+    DK+   ++ +   +     ++  A A +W
Sbjct: 277 VEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEW 325


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.131    0.373 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,979,137
Number of Sequences: 62578
Number of extensions: 85497
Number of successful extensions: 499
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 493
Number of HSP's gapped (non-prelim): 8
length of query: 127
length of database: 14,973,337
effective HSP length: 87
effective length of query: 40
effective length of database: 9,529,051
effective search space: 381162040
effective search space used: 381162040
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)