Citrus Sinensis ID: 038325

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-

STTHPRRDSAAIAAAIHANVDNNSSSSYNNVPNEQQQQLPLQSLLPPAGAPCVVREQDQYMPIANVIRIMRRILPPHAKISDDAKETVQECVSEYISFITGEANERCHREQRKTITAEDVVWAMGKLGFDNYVEPLSIFLNRFRDSEHERTAAQHKEPIPMPRRGPSVDYGLFGLPPGPFGPVFNMGPQQGVFDPSIGGFLREGSGSGSGSSSQATGHNHLPGFDPFAQFK

cccccccccHHHHHHHccccccccccccccccccHHccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***************************************************CVVREQDQYMPIANVIRIMRRILPPHAKISDDAKETVQECVSEYISFITGEANERCHREQRKTITAEDVVWAMGKLGFDNYVEPLSIFLNRF*********************************P*PFGPVFNMG********************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear transcription factor Y subunit B-9	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Acts as a central regulator of the embryogenesis. Required for the speciation of cotyledon identity and the completion of embryo maturation. Controls seed storage protein genes through the regulation of FUS3 and ABI3. Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways.	probable	Q9SFD8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JFI, chain B
Confidence level:very confident
Coverage over the Query: 57-153
View the alignment between query and template
View the model in PyMOL