BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038326
         (230 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IYN|N Chain N, 3.6-Angstrom Cryoem Structure Of Human Adenovirus Type 5
          Length = 585

 Score = 27.3 bits (59), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 135 KLAKTLNYLERANREEAIPLIEAAFQQRLEEERVLHEIEQQQEVELSRE 183
            L  TLNYL   NR + IP + +      EEER+L  ++Q   + L R+
Sbjct: 292 SLEATLNYL-LTNRRQKIPSLHSL---NSEEERILRYVQQSVSLNLMRD 336


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.126    0.323 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,064,270
Number of Sequences: 62578
Number of extensions: 165472
Number of successful extensions: 601
Number of sequences better than 100.0: 45
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 31
Number of HSP's that attempted gapping in prelim test: 585
Number of HSP's gapped (non-prelim): 49
length of query: 230
length of database: 14,973,337
effective HSP length: 96
effective length of query: 134
effective length of database: 8,965,849
effective search space: 1201423766
effective search space used: 1201423766
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 50 (23.9 bits)