BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038326
(230 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IYN|N Chain N, 3.6-Angstrom Cryoem Structure Of Human Adenovirus Type 5
Length = 585
Score = 27.3 bits (59), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
Query: 135 KLAKTLNYLERANREEAIPLIEAAFQQRLEEERVLHEIEQQQEVELSRE 183
L TLNYL NR + IP + + EEER+L ++Q + L R+
Sbjct: 292 SLEATLNYL-LTNRRQKIPSLHSL---NSEEERILRYVQQSVSLNLMRD 336
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.126 0.323
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,064,270
Number of Sequences: 62578
Number of extensions: 165472
Number of successful extensions: 601
Number of sequences better than 100.0: 45
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 31
Number of HSP's that attempted gapping in prelim test: 585
Number of HSP's gapped (non-prelim): 49
length of query: 230
length of database: 14,973,337
effective HSP length: 96
effective length of query: 134
effective length of database: 8,965,849
effective search space: 1201423766
effective search space used: 1201423766
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 50 (23.9 bits)