Citrus Sinensis ID: 038345

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------

FLITCNDTFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPTITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCIGTGCCQIEIPRGSFKNHTNVSSFNPCTYAFVVDQSQFHFTSNYLAFDGIPDDFPIVLDWEITTIETCEEAKICGPNASCDKSKDNTTTSSGYHCKCNKGYEGNPYLSDGCRDVNEFEDPSLNNCTHICDNTAGNYTCRCPKGFRGDGRRDGGGCIPNQKNLIKVALGAGCSGGLGLLFLIVGIWGLYKFTKKRREIKSKQKFFKRNGGLLLQQELSSNKSSVEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLADGRIVAVKKSKLVDENNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFVPNGTLYQNIHNHIEEFPITWELLLRIAVEVSGALFYLHSAASISIYRRDIKSANILLDDKYRAKVSDFGTSRSITVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIRAINIDEDRSLVGYFLQAMNENRLFEVLDALVLKEAEREEIMTVATLAKRCLNLNGKNRPTMKEVAFELGGIRASIGASILQQNCGVIDCVNGDISEHYLESDLVSMGTSILNNSAAFSIDAGPAFSIDARPLL

cEEEccccccccccccccccEEEEEEEEccEEEEEEEccccccccccccccccccccccccEEECccccEEEEEccccEEEEEEccccccEEEEEEccccccccccccccccccccCECcccccccccCEECcccccEEEEEEcccccEEcccccccccccccccEEEEEEEcccccHHHHHccccccCECccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEECccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHcccccccccEEEccHHHHHHHHccccccccccccccCEEEEEECccccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEECcccccCEEEEEECccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccEEEEECccccccccHHHHcccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

FLITCNDTFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPTITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCIGTGCCQIEIPRGSFKNHTNVSSFNPCTYAFVVDQSQFHFTSNYLAFDGIPDDFPIVLDWEITTIETCEEAKICGPNASCDKSKDNTTTSSGYHCKCNKGYEGNPYLSDGCRDVNEFEDPSLNNCTHICDNTAGNYTCRCPKGFRGDGRRDGGGCIPNQKNLIKVALGAGCSGGLGLLFLIVGIWGLYKFTKKRREIK***KFFKRNGGL*****************LFTSKDLEKATDNYNANRILGQGGQGTVYKGMLADGRIVAVKKSKLVDENNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFVPNGTLYQNIHNHIEEFPITWELLLRIAVEVSGALFYLHSAASISIYRRDIKSANILLDDKYRAKVSDFGTSRSITVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIRAINIDEDRSLVGYFLQAMNENRLFEVLDALVLKEAEREEIMTVATLAKRCLNLNGKNRPTMKEVAFELGGIRASI*****************************************************ARPLL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Wall-associated receptor kinase 2	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. Binding to pectin may have significance in the control of cell expansion, morphogenesis and development.	probable	Q9LMP1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 442-628
View the alignment between query and template
View the model in PyMOL

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 334-624
View the alignment between query and template
View the model in PyMOL

Template: 1LMJ, chain A
Confidence level:very confident
Coverage over the Query: 180-265
View the alignment between query and template
View the model in PyMOL

Template: 2WEL, chain A
Confidence level:probable
Coverage over the Query: 348-436,453-560,573-668
View the alignment between query and template
View the model in PyMOL

Template: 3VN9, chain A
Confidence level:probable
Coverage over the Query: 343-545
View the alignment between query and template
View the model in PyMOL

Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 277-299
View the alignment between query and template
View the model in PyMOL

Template: 4AQT, chain A
Confidence level:probable
Coverage over the Query: 107-267
View the alignment between query and template
View the model in PyMOL