BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038350
(472 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|J Chain J, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|K Chain K, Nuclease Module Of The Yeast Ccr4-Not Complex
pdb|4B8C|L Chain L, Nuclease Module Of The Yeast Ccr4-Not Complex
Length = 727
Score = 31.6 bits (70), Expect = 1.0, Method: Compositional matrix adjust.
Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 6/72 (8%)
Query: 83 RLKYFHFVDRAVCRLASEF--LTKFSFRLYYSSNIYRQNIDKWIEIVLEKSVQELSLDFS 140
+LKYF+F D V L EF L F + + +Q +++I+ EKSV L
Sbjct: 294 QLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQ----FLKILTEKSVTGLIFYLR 349
Query: 141 DGDPVVPQPTLR 152
D P +P P R
Sbjct: 350 DNRPEIPLPHER 361
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.141 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,546,725
Number of Sequences: 62578
Number of extensions: 529469
Number of successful extensions: 1200
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1199
Number of HSP's gapped (non-prelim): 3
length of query: 472
length of database: 14,973,337
effective HSP length: 102
effective length of query: 370
effective length of database: 8,590,381
effective search space: 3178440970
effective search space used: 3178440970
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)