Citrus Sinensis ID: 038356

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
VINSAYYNRGALGALLVYDVTKSTTFENVSRWLKDLGDHADSNIVIMMIGNKTDLKHLPTSMSIFQSLSGLLFKLIFI
ccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHccccccccc
VINSAYYNRGALGALLVYDVTKSTTFENVSRWLKDLGDHADSNIVIMMIGNKTDLKHLPTSMSIFQSLSGLLFKLIFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VINSAYYNRGALGALLVYDVTKSTTFENVSRWLKDLGDHADSNIVIMMIGNKTDLKHLPTSMSIFQSLSGLLFKLIFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTP-binding protein ypt3 Has a role in retrograde traffricking of proteins from the endosome to the Golgi. Involved in the secretory pathway where it has a role in acid phosphatase secretion.probableP17610
Ras-related protein RABA2a Intracellular vesicle trafficking and protein transport.probableO04486

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F9L, chain A
Confidence level:very confident
Coverage over the Query: 2-62
View the alignment between query and template
View the model in PyMOL