Citrus Sinensis ID: 038421

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70---
Protein Sequence
MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLWEST
Secondary Structure (PSIPRED)
ccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccEEEEcccccccccccccc
Secondary Structure Prediction (SSPRO)
ccccccccccHHHHHHHHHHHHHEccccHcccccHHHEEEEccccccccccccccEEEEccccccccEEEccc
Coil and Loop (DISEMBL)
mdpvllesDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSeivdlpvpkqpvftvraecpgfrvlwest
Flexible Loop (DISEMBL)
MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLWEST
Low Complexity Region (SEG)
MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLWEST
Disordered region (IsUnstruct)
****LLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLW***
Disordered Region (DISOPRED)
MDPVLL*SDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVF****************
Disordered Region (DISEMBL)
MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLWEST
Disordered Region (DISPRO)
***VLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGF*******
Transmembrane Helix (TMHMM)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (Phobius)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVRAECPGFRVLWEST
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	73	2.2.26 [Sep-21-2011]
Q9SXB4	820	G-type lectin S-receptor-	no	no	0.876	0.078	0.593	1e-16
Q9LPZ9	830	G-type lectin S-receptor-	no	no	0.821	0.072	0.616	8e-16
Q9SXB5	820	G-type lectin S-receptor-	no	no	0.821	0.073	0.533	5e-14
Q9SXB8	842	G-type lectin S-receptor-	no	no	0.808	0.070	0.525	1e-12
Q9C5S9	674	Cysteine-rich receptor-li	no	no	0.821	0.089	0.516	8e-12
O65468	676	Cysteine-rich receptor-li	no	no	0.835	0.090	0.491	3e-11
Q8GYA4	669	Cysteine-rich receptor-li	no	no	0.753	0.082	0.490	3e-11
O65476	662	Putative cysteine-rich re	no	no	0.849	0.093	0.5	4e-11
Q9LDM5	666	Putative cysteine-rich re	no	no	0.821	0.090	0.466	9e-11
Q3E9X6	690	Cysteine-rich receptor-li	no	no	0.821	0.086	0.483	1e-10

>sp|Q9SXB4|Y1130_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 OS=Arabidopsis thaliana GN=At1g11300 PE=2 SV=1

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 46/64 (71%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP + +  FE EI +CIH+GLLCVQE  +DR S+STV SMLSSEI D+P PKQP F  R
Sbjct: 732 VDPEIFDLLFEKEIHKCIHIGLLCVQEAANDRPSVSTVCSMLSSEIADIPEPKQPAFISR 791

Query: 61  AECP 64
              P
Sbjct: 792 NNVP 795

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp|Q9LPZ9|SD113_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-13 OS=Arabidopsis thaliana GN=SD113 PE=1 SV=2

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/60 (61%), Positives = 46/60 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DPV+ E  FE EI RC+HVGLLCVQ++ +DR S++TVI MLSSE  +LP PKQP F  R
Sbjct: 742 VDPVIFEECFENEIRRCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQPAFIPR 801

Receptor-like serine/threonine-protein kinase that represses the disease resistance signaling pathway triggered in response to bacterial pathogen such as Pseudomonas syringae pv. tomato.

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q9SXB5|Y1135_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11305 OS=Arabidopsis thaliana GN=At1g11305 PE=2 SV=1

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 43/60 (71%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP + +  FE EI +C+H+ LLCVQ+  +DR S+STV  MLSSE+ D+P PKQP F  R
Sbjct: 732 VDPEIFDQLFEKEIRKCVHIALLCVQDAANDRPSVSTVCMMLSSEVADIPEPKQPAFMPR 791

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q9SXB8|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 OS=Arabidopsis thaliana GN=At1g11330 PE=1 SV=3

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 42/59 (71%)

Query: 2   DPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           DP + +  FE EI +C+H+GLLCVQE  +DR ++S VI ML++E + L  PKQP F VR
Sbjct: 755 DPAVFDKCFEKEIEKCVHIGLLCVQEVANDRPNVSNVIWMLTTENMSLADPKQPAFIVR 813

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q9C5S9|CRK6_ARATH Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/60 (51%), Positives = 43/60 (71%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP++ E+    E++RCIH+GLLCVQE    R +ISTV  ML+S  V LPVP+QP F ++
Sbjct: 581 VDPLIAENCQNSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQ 640

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 43/61 (70%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP++  +    E++RCIH+GLLCVQE    R +ISTV  ML+S  V LPVP+QP F ++
Sbjct: 583 VDPLIANNCQNSEVVRCIHIGLLCVQEDPAKRPTISTVFMMLTSNTVTLPVPRQPGFFIQ 642

Query: 61  A 61
           +
Sbjct: 643 S 643

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 42/55 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQP 55
           +DP ++E+    E++RC+H+GLLCVQE   +R ++ST++ ML+S  V LPVP+QP
Sbjct: 578 VDPAIVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 632

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|O65476|CRK16_ARATH Putative cysteine-rich receptor-like protein kinase 16 OS=Arabidopsis thaliana GN=CRK16 PE=3 SV=2

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQP--VFT 58
           +DP + ES  + E++RCIH+ LLCVQE   DR ++STV  ML++  + LPVP+ P  VF 
Sbjct: 566 VDPAMGESYDKDEVIRCIHISLLCVQENPADRPTMSTVFQMLTNTFLTLPVPQLPGFVFR 625

Query: 59  VRAE 62
           VR+E
Sbjct: 626 VRSE 629

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q9LDM5|CRK31_ARATH Putative cysteine-rich receptor-like protein kinase 31 OS=Arabidopsis thaliana GN=CRK31 PE=3 SV=1

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP + ES    E++RCIH+G+LCVQE   DR  +ST+  ML++  + LPVP+ P F  R
Sbjct: 570 IDPAIKESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGFFFR 629

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

>sp|Q3E9X6|CRK21_ARATH Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana GN=CRK21 PE=2 SV=1

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP + E+  + E++RCIH+GLLCVQE   DR S+ST+  ML++  + LPVP+ P F  R
Sbjct: 594 VDPAIGENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFR 653

Arabidopsis thaliana (taxid: 3702)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	73
303305632	808	S-domain receptor-like kinase [Nicotiana	0.863	0.077	0.634	8e-18
449488492	840	PREDICTED: LOW QUALITY PROTEIN: G-type l	0.821	0.071	0.633	1e-16
449457785	1667	PREDICTED: uncharacterized protein LOC10	0.821	0.035	0.633	1e-16
255567481	1093	conserved hypothetical protein [Ricinus	0.753	0.050	0.620	3e-16
449488490	2882	PREDICTED: LOW QUALITY PROTEIN: polygala	0.931	0.023	0.573	3e-16
147840285	1272	hypothetical protein VITISV_016156 [Viti	0.821	0.047	0.683	8e-16
224114121	769	predicted protein [Populus trichocarpa]	0.821	0.078	0.633	2e-15
224104212	1217	predicted protein [Populus trichocarpa]	0.821	0.049	0.633	2e-15
224114129	249	predicted protein [Populus trichocarpa]	0.821	0.240	0.633	3e-15
224114125	832	predicted protein [Populus trichocarpa]	0.821	0.072	0.633	4e-15

>gi|303305632|gb|ADM13586.1| S-domain receptor-like kinase [Nicotiana tabacum]

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 48/63 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP +++  FE EILRC HVGLLCVQEY  DR ++S V+SML+SEI DLP PKQP FT R
Sbjct: 723 VDPKIIDMQFEREILRCAHVGLLCVQEYAEDRPNVSAVLSMLTSEISDLPSPKQPAFTTR 782

Query: 61  AEC 63
             C
Sbjct: 783 PSC 785

Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449488492|ref|XP_004158054.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330-like [Cucumis sativus]

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           ++P + E  ++LEILRCIHVGLLCVQE+++DR ++ST+ISML+SEIVDLP PK+P F  R
Sbjct: 752 IEPTIYEPCYQLEILRCIHVGLLCVQEFINDRPNVSTIISMLNSEIVDLPSPKEPGFVGR 811

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449457785|ref|XP_004146628.1| PREDICTED: uncharacterized protein LOC101215940 [Cucumis sativus]

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%)

Query: 1    MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
            ++P + E  ++LEILRCIHVGLLCVQE+++DR ++ST+ISML+SEIVDLP PK+P F  R
Sbjct: 1579 IEPTIYEPCYQLEILRCIHVGLLCVQEFINDRPNVSTIISMLNSEIVDLPSPKEPGFVGR 1638

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255567481|ref|XP_002524720.1| conserved hypothetical protein [Ricinus communis] gi|223536081|gb|EEF37739.1| conserved hypothetical protein [Ricinus communis]

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 50/58 (86%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFT 58
           +DPVL +  +++EI RCIHVGLLCV+E+  DR ++STV+SML+SEI+DLP+PKQP F+
Sbjct: 196 VDPVLSDPCYQVEIFRCIHVGLLCVREFARDRPAVSTVLSMLNSEILDLPIPKQPAFS 253

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449488490|ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis sativus]

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 53/68 (77%)

Query: 1    MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
            +DP + E  ++LEILRCI VGLLCV+E ++DR +I T++SML+SEIVDLP+PKQP F  R
Sbjct: 2794 IDPTIYELSYQLEILRCIQVGLLCVEESINDRPNILTILSMLNSEIVDLPLPKQPSFIAR 2853

Query: 61   AECPGFRV 68
            A+    R+
Sbjct: 2854 ADQSDSRI 2861

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147840285|emb|CAN63988.1| hypothetical protein VITISV_016156 [Vitis vinifera]

 Score = 87.8 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 47/60 (78%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +D  + E+ F+ EILRCIHVGLLCVQE+V DR SISTV+SML SEI  LP PKQP FT R
Sbjct: 841 IDGSISEACFQEEILRCIHVGLLCVQEFVRDRPSISTVVSMLCSEIAHLPPPKQPAFTER 900

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224114121|ref|XP_002316673.1| predicted protein [Populus trichocarpa] gi|222859738|gb|EEE97285.1| predicted protein [Populus trichocarpa]

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 46/60 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DPV+    FE+E+ RCI++GLLCVQE   DR +ISTVISML+SEIVDLP PKQ  F  R
Sbjct: 681 VDPVISNPSFEVEVFRCINIGLLCVQELARDRPTISTVISMLNSEIVDLPAPKQSAFAER 740

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224104212|ref|XP_002333971.1| predicted protein [Populus trichocarpa] gi|222839418|gb|EEE77755.1| predicted protein [Populus trichocarpa]

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 46/60 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DPV+    FE+E+ RCI++GLLCVQE   DR +ISTVISML+SEIVDLP PKQ  F  R
Sbjct: 517 VDPVISNPSFEVEVFRCINIGLLCVQELARDRPTISTVISMLNSEIVDLPAPKQSAFAER 576

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224114129|ref|XP_002316675.1| predicted protein [Populus trichocarpa] gi|222859740|gb|EEE97287.1| predicted protein [Populus trichocarpa]

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 46/60 (76%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DPV+    FE+E+ RCI++GLLCVQE   DR +ISTVISML+SEIVDLP PKQ  F  R
Sbjct: 161 VDPVISNPSFEVEVFRCINIGLLCVQELARDRPTISTVISMLNSEIVDLPAPKQSAFAER 220

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224114125|ref|XP_002316674.1| predicted protein [Populus trichocarpa] gi|222859739|gb|EEE97286.1| predicted protein [Populus trichocarpa]

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 45/60 (75%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
           +DP +    F  EI RC+HVGLLCVQE+  DR +I TVISML+SEIVDLP PKQP F+ R
Sbjct: 744 VDPGISYPSFHEEIFRCVHVGLLCVQEFAKDRPAIFTVISMLNSEIVDLPTPKQPAFSER 803

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	73
TAIR|locus:2200151	830	SD1-13 "S-domain-1 13" [Arabid	0.821	0.072	0.616	9.3e-14
TAIR|locus:2121676	669	CRK10 "cysteine-rich RLK (RECE	0.753	0.082	0.490	3.8e-10
TAIR|locus:2121651	676	CRK8 "cysteine-rich RLK (RECEP	0.835	0.090	0.491	3.9e-10
TAIR|locus:2123126	666	CRK31 "cysteine-rich RLK (RECE	0.821	0.090	0.466	1.3e-09
TAIR|locus:2121706	690	CRK21 "cysteine-rich RLK (RECE	0.821	0.086	0.483	1.8e-09
TAIR|locus:2123056	656	CRK32 "cysteine-rich RLK (RECE	0.821	0.091	0.466	3.4e-09
TAIR|locus:2121636	659	CRK7 "cysteine-rich RLK (RECEP	0.876	0.097	0.461	3.4e-09
TAIR|locus:2197734	814	AT1G61370 [Arabidopsis thalian	0.835	0.074	0.435	7.5e-09
TAIR|locus:2018506	847	RK2 "receptor kinase 2" [Arabi	0.808	0.069	0.507	1.3e-08
TAIR|locus:2121691	667	CRK11 "cysteine-rich RLK (RECE	0.835	0.091	0.459	2e-08

TAIR|locus:2200151 SD1-13 "S-domain-1 13" [Arabidopsis thaliana (taxid:3702)]

 Score = 190 (71.9 bits), Expect = 9.3e-14, P = 9.3e-14
 Identities = 37/60 (61%), Positives = 46/60 (76%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DPV+ E  FE EI RC+HVGLLCVQ++ +DR S++TVI MLSSE  +LP PKQP F  R
Sbjct:   742 VDPVIFEECFENEIRRCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQPAFIPR 801

GO:0004672 "protein kinase activity" evidence=IEA;IDA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM;IDA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0030246 "carbohydrate binding" evidence=IEA

GO:0048544 "recognition of pollen" evidence=IEA

GO:0046777 "protein autophosphorylation" evidence=RCA;IDA

GO:0009637 "response to blue light" evidence=RCA

GO:0010155 "regulation of proton transport" evidence=RCA

GO:0016556 "mRNA modification" evidence=RCA

TAIR|locus:2121676 CRK10 "cysteine-rich RLK (RECEPTOR-like protein kinase) 10" [Arabidopsis thaliana (taxid:3702)]

 Score = 155 (59.6 bits), Expect = 3.8e-10, P = 3.8e-10
 Identities = 27/55 (49%), Positives = 42/55 (76%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQP 55
             +DP ++E+    E++RC+H+GLLCVQE   +R ++ST++ ML+S  V LPVP+QP
Sbjct:   578 VDPAIVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 632

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0005886 "plasma membrane" evidence=IDA

GO:0006995 "cellular response to nitrogen starvation" evidence=RCA

TAIR|locus:2121651 CRK8 "cysteine-rich RLK (RECEPTOR-like protein kinase) 8" [Arabidopsis thaliana (taxid:3702)]

 Score = 155 (59.6 bits), Expect = 3.9e-10, P = 3.9e-10
 Identities = 30/61 (49%), Positives = 43/61 (70%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP++  +    E++RCIH+GLLCVQE    R +ISTV  ML+S  V LPVP+QP F ++
Sbjct:   583 VDPLIANNCQNSEVVRCIHIGLLCVQEDPAKRPTISTVFMMLTSNTVTLPVPRQPGFFIQ 642

Query:    61 A 61
             +
Sbjct:   643 S 643

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2123126 CRK31 "cysteine-rich RLK (RECEPTOR-like protein kinase) 31" [Arabidopsis thaliana (taxid:3702)]

 Score = 150 (57.9 bits), Expect = 1.3e-09, P = 1.3e-09
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP + ES    E++RCIH+G+LCVQE   DR  +ST+  ML++  + LPVP+ P F  R
Sbjct:   570 IDPAIKESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGFFFR 629

GO:0004672 "protein kinase activity" evidence=IEA;ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2121706 CRK21 "cysteine-rich RLK (RECEPTOR-like protein kinase) 21" [Arabidopsis thaliana (taxid:3702)]

 Score = 149 (57.5 bits), Expect = 1.8e-09, P = 1.8e-09
 Identities = 29/60 (48%), Positives = 42/60 (70%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP + E+  + E++RCIH+GLLCVQE   DR S+ST+  ML++  + LPVP+ P F  R
Sbjct:   594 VDPAIGENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFR 653

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0005634 "nucleus" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0005739 "mitochondrion" evidence=IDA

TAIR|locus:2123056 CRK32 "cysteine-rich RLK (RECEPTOR-like protein kinase) 32" [Arabidopsis thaliana (taxid:3702)]

 Score = 146 (56.5 bits), Expect = 3.4e-09, P = 3.4e-09
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP + ES    +++RCIH+GLLCVQE   DR  +ST+  ML++  + LPVP+ P F  R
Sbjct:   560 IDPAIEESCDNDKVIRCIHIGLLCVQETPVDRPEMSTIFQMLTNSSITLPVPRPPGFFFR 619

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR|locus:2121636 CRK7 "cysteine-rich RLK (RECEPTOR-like protein kinase) 7" [Arabidopsis thaliana (taxid:3702)]

 Score = 146 (56.5 bits), Expect = 3.4e-09, P = 3.4e-09
 Identities = 30/65 (46%), Positives = 44/65 (67%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP + +S  + E++RC H+GLLCVQE    R ++ST+  ML+S  + LP P+QP F VR
Sbjct:   566 VDPFIADSCRKSEVVRCTHIGLLCVQEDPVKRPAMSTISVMLTSNTMALPAPQQPGFFVR 625

Query:    61 AECPG 65
             +  PG
Sbjct:   626 SR-PG 629

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA

TAIR|locus:2197734 AT1G61370 [Arabidopsis thaliana (taxid:3702)]

 Score = 144 (55.7 bits), Expect = 7.5e-09, P = 7.5e-09
 Identities = 27/62 (43%), Positives = 43/62 (69%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +D  +  S  E E+ RC+ +GLLC+Q+   DR +I+ V+SML++ + DLP PKQPVF ++
Sbjct:   731 LDQDISSSGSESEVARCVQIGLLCIQQQAGDRPNIAQVMSMLTTTM-DLPKPKQPVFAMQ 789

Query:    61 AE 62
              +
Sbjct:   790 VQ 791

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0030246 "carbohydrate binding" evidence=IEA;ISS

GO:0048544 "recognition of pollen" evidence=IEA

TAIR|locus:2018506 RK2 "receptor kinase 2" [Arabidopsis thaliana (taxid:3702)]

 Score = 142 (55.0 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 32/63 (50%), Positives = 41/63 (65%)

Query:     1 MDPV---LLESDFEL-EILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPV 56
             +DP+    L S+F   EILRCI +GLLCVQE   DR  +S+V+ ML SE   +P PK+P 
Sbjct:   753 VDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPG 812

Query:    57 FTV 59
             F V
Sbjct:   813 FCV 815

GO:0004672 "protein kinase activity" evidence=IEA;IDA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA;IDA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0030246 "carbohydrate binding" evidence=IEA

GO:0048544 "recognition of pollen" evidence=IEA

GO:0005829 "cytosol" evidence=IDA

GO:0031625 "ubiquitin protein ligase binding" evidence=IPI

GO:0034613 "cellular protein localization" evidence=IGI

GO:0046777 "protein autophosphorylation" evidence=IDA

GO:0004675 "transmembrane receptor protein serine/threonine kinase activity" evidence=ISS

TAIR|locus:2121691 CRK11 "cysteine-rich RLK (RECEPTOR-like protein kinase) 11" [Arabidopsis thaliana (taxid:3702)]

 Score = 139 (54.0 bits), Expect = 2.0e-08, P = 2.0e-08
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query:     1 MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLPVPKQPVFTVR 60
             +DP    +    E+ RCIH+ LLCVQE   DR  +ST+I ML+S  + LPVP+ P F  R
Sbjct:   583 VDPTFGRNYQSNEVTRCIHIALLCVQENPEDRPMLSTIILMLTSNTITLPVPRLPGFFPR 642

Query:    61 A 61
             +
Sbjct:   643 S 643

GO:0004672 "protein kinase activity" evidence=IEA;ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0006979 "response to oxidative stress" evidence=IEP;RCA

GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IEP

GO:0016020 "membrane" evidence=ISS

GO:0009611 "response to wounding" evidence=RCA

GO:0010200 "response to chitin" evidence=RCA

GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA

GO:0050832 "defense response to fungus" evidence=RCA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	73
KOG1187	361	consensus Serine/threonine protein kinase [Signal	98.46
PLN00113	968	leucine-rich repeat receptor-like protein kinase;	96.98
cd05038	284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	96.08
cd05051	296	PTKc_DDR Catalytic domain of the Protein Tyrosine	95.89
cd05068	261	PTKc_Frk_like Catalytic domain of Fyn-related kina	95.86
cd05097	295	PTKc_DDR_like Catalytic domain of Discoidin Domain	95.8
cd05148	261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	95.73
cd05095	296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	95.7
cd05112	256	PTKc_Itk Catalytic domain of the Protein Tyrosine	95.68
cd05045	290	PTKc_RET Catalytic domain of the Protein Tyrosine	95.61
cd05048	283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	95.58
cd05063	268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	95.48
cd05081	284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	95.48
cd05050	288	PTKc_Musk Catalytic domain of the Protein Tyrosine	95.41
cd05033	266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	95.38
cd05114	256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	95.38
cd05053	293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	95.35
cd05091	283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	95.33
cd08528	269	STKc_Nek10 Catalytic domain of the Protein Serine/	95.32
cd05096	304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	95.29
cd05094	291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	95.27
cd05080	283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	95.27
PF07714	259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	95.26
cd05102	338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	95.26
cd05072	261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	95.19
cd05052	263	PTKc_Abl Catalytic domain of the Protein Tyrosine	95.1
cd05060	257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	95.1
cd05084	252	PTKc_Fes Catalytic domain of the Protein Tyrosine	95.08
cd05059	256	PTKc_Tec_like Catalytic domain of Tec-like Protein	95.06
cd05104	375	PTKc_Kit Catalytic domain of the Protein Tyrosine	95.05
cd05035	273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	95.01
cd05054	337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	94.88
cd05116	257	PTKc_Syk Catalytic domain of the Protein Tyrosine	94.84
cd05062	277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	94.8
cd05113	256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	94.79
cd05058	262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	94.77
cd05085	250	PTKc_Fer Catalytic domain of the Protein Tyrosine	94.73
cd05036	277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	94.68
cd05093	288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	94.64
cd05074	273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	94.63
cd05078	258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	94.62
cd05075	272	PTKc_Axl Catalytic domain of the Protein Tyrosine	94.58
cd05079	284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	94.51
cd05043	280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	94.48
cd05083	254	PTKc_Chk Catalytic domain of the Protein Tyrosine	94.41
cd05069	260	PTKc_Yes Catalytic domain of the Protein Tyrosine	94.4
cd05070	260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	94.38
cd05039	256	PTKc_Csk_like Catalytic domain of C-terminal Src k	94.37
PHA02988	283	hypothetical protein; Provisional	94.28
cd08229	267	STKc_Nek7 Catalytic domain of the Protein Serine/T	94.22
cd05066	267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	94.2
cd05061	288	PTKc_InsR Catalytic domain of the Protein Tyrosine	94.19
cd05044	269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	94.17
cd05071	262	PTKc_Src Catalytic domain of the Protein Tyrosine	94.12
cd05082	256	PTKc_Csk Catalytic domain of the Protein Tyrosine	94.1
cd05032	277	PTKc_InsR_like Catalytic domain of Insulin Recepto	94.04
cd05065	269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	94.03
cd08224	267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	93.99
cd05103	343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	93.98
cd05040	257	PTKc_Ack_like Catalytic domain of the Protein Tyro	93.93
cd05047	270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	93.93
cd05049	280	PTKc_Trk Catalytic domain of the Protein Tyrosine	93.87
cd05055	302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	93.84
cd00192	262	PTKc Catalytic domain of Protein Tyrosine Kinases.	93.83
cd05073	260	PTKc_Hck Catalytic domain of the Protein Tyrosine	93.82
cd05067	260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	93.81
cd05041	251	PTKc_Fes_like Catalytic domain of Fes-like Protein	93.79
cd08228	267	STKc_Nek6 Catalytic domain of the Protein Serine/T	93.75
cd05090	283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	93.73
cd05101	304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	93.63
cd05100	334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	93.62
cd05034	261	PTKc_Src_like Catalytic domain of Src kinase-like	93.59
cd05098	307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	93.56
cd05076	274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	93.53
cd05064	266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	93.52
cd05089	297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	93.45
cd05106	374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	93.41
cd05099	314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	93.24
cd05092	280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	93.17
cd05111	279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	93.08
cd05037	259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	92.93
smart00219	258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	92.72
cd05105	400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	92.62
cd05046	275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	92.5
cd05077	262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	92.5
cd05088	303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	92.47
cd08217	265	STKc_Nek2 Catalytic domain of the Protein Serine/T	92.38
smart00220	244	S_TKc Serine/Threonine protein kinases, catalytic	92.19
cd05108	316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	92.02
smart00750	176	KIND kinase non-catalytic C-lobe domain. It is an	91.79
cd05107	401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	91.56
cd05110	303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	91.53
cd08529	256	STKc_FA2-like Catalytic domain of the Protein Seri	91.39
cd07835	283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	91.25
cd05056	270	PTKc_FAK Catalytic domain of the Protein Tyrosine	91.22
cd07846	286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	90.99
cd08218	256	STKc_Nek1 Catalytic domain of the Protein Serine/T	90.92
cd06642	277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	90.83
cd05109	279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	90.8
PF11883	48	DUF3403: Domain of unknown function (DUF3403); Int	90.71
cd07830	283	STKc_MAK_like Catalytic domain of Male germ cell-A	90.64
cd05115	257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	90.55
cd06621	287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	90.25
cd06606	260	STKc_MAPKKK Catalytic domain of the Protein Serine	89.92
cd06624	268	STKc_ASK Catalytic domain of the Protein Serine/Th	89.9
cd07840	287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	89.85
cd08223	257	STKc_Nek4 Catalytic domain of the Protein Serine/T	89.82
cd07833	288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	89.7
cd08220	256	STKc_Nek8 Catalytic domain of the Protein Serine/T	89.38
cd05118	283	STKc_CMGC Catalytic domain of CMGC family Serine/T	89.36
cd06612	256	STKc_MST1_2 Catalytic domain of the Protein Serine	89.32
cd06608	275	STKc_myosinIII_like Catalytic domain of Class III	89.13
KOG2345	302	consensus Serine/threonine protein kinase/TGF-beta	88.84
cd05086	268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	88.82
cd06638	286	STKc_myosinIIIA Catalytic domain of the Protein Se	88.82
cd06620	284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	88.79
cd00180	215	PKc Catalytic domain of Protein Kinases. Protein K	88.74
cd07842	316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	88.42
cd07831	282	STKc_MOK Catalytic domain of the Serine/Threonine	88.38
cd07841	298	STKc_CDK7 Catalytic domain of the Serine/Threonine	88.22
cd05122	253	PKc_STE Catalytic domain of STE family Protein Kin	88.11
cd06609	274	STKc_MST3_like Catalytic domain of Mammalian Ste20	87.99
cd07847	286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	87.89
PF00069	260	Pkinase: Protein kinase domain Protein kinase; unc	87.85
cd06637	272	STKc_TNIK Catalytic domain of the Protein Serine/T	87.81
cd06640	277	STKc_MST4 Catalytic domain of the Protein Serine/T	87.8
cd08225	257	STKc_Nek5 Catalytic domain of the Protein Serine/T	87.79
cd06641	277	STKc_MST3 Catalytic domain of the Protein Serine/T	87.58
cd06639	291	STKc_myosinIIIB Catalytic domain of the Protein Se	87.57
cd06619	279	PKc_MKK5 Catalytic domain of the dual-specificity	87.35
cd06615	308	PKc_MEK Catalytic domain of the dual-specificity P	86.96
cd05087	269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	86.61
cd07861	285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	86.57
cd08219	255	STKc_Nek3 Catalytic domain of the Protein Serine/T	86.53
cd07838	287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	86.48
PLN00009	294	cyclin-dependent kinase A; Provisional	86.43
cd06626	264	STKc_MEKK4 Catalytic domain of the Protein Serine/	86.41
cd06629	272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	86.39
cd08226	328	PK_STRAD_beta Pseudokinase domain of STE20-related	86.32
cd06646	267	STKc_MAP4K5 Catalytic domain of the Protein Serine	86.27
cd07858	337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	86.26
cd08216	314	PK_STRAD Pseudokinase domain of STE20-related kina	86.18
cd06627	254	STKc_Cdc7_like Catalytic domain of Cell division c	86.15
cd07829	282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	86.14
cd06610	267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	86.11
cd08221	256	STKc_Nek9 Catalytic domain of the Protein Serine/T	86.02
cd06605	265	PKc_MAPKK Catalytic domain of the dual-specificity	85.84
cd07832	286	STKc_CCRK Catalytic domain of the Serine/Threonine	85.68
cd06649	331	PKc_MEK2 Catalytic domain of the dual-specificity	85.62
cd08227	327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	85.51
cd05057	279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	85.28
cd06618	296	PKc_MKK7 Catalytic domain of the dual-specificity	85.2
cd06917	277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	85.05
cd07865	310	STKc_CDK9 Catalytic domain of the Serine/Threonine	85.04
cd07860	284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	85.03
cd07852	337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	84.98
cd08530	256	STKc_CNK2-like Catalytic domain of the Protein Ser	84.96
cd06616	288	PKc_MKK4 Catalytic domain of the dual-specificity	84.92
cd06632	258	STKc_MEKK1_plant Catalytic domain of the Protein S	84.77
cd06607	307	STKc_TAO Catalytic domain of the Protein Serine/Th	84.6
cd07862	290	STKc_CDK6 Catalytic domain of the Serine/Threonine	84.48
cd07849	336	STKc_ERK1_2_like Catalytic domain of Extracellular	84.46
cd06613	262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	84.46
cd07866	311	STKc_BUR1 Catalytic domain of the Serine/Threonine	84.1
cd08215	258	STKc_Nek Catalytic domain of the Protein Serine/Th	84.04
cd06650	333	PKc_MEK1 Catalytic domain of the dual-specificity	83.4
cd06651	266	STKc_MEKK3 Catalytic domain of the Protein Serine/	83.25
cd06631	265	STKc_YSK4 Catalytic domain of the Protein Serine/T	83.15
cd06635	317	STKc_TAO1 Catalytic domain of the Protein Serine/T	83.04
cd07864	302	STKc_CDK12 Catalytic domain of the Serine/Threonin	83.02
cd07851	343	STKc_p38 Catalytic domain of the Serine/Threonine	82.84
cd05583	288	STKc_MSK_N N-terminal catalytic domain of the Prot	82.68
cd05042	269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	82.64
cd08222	260	STKc_Nek11 Catalytic domain of the Protein Serine/	82.51
cd06623	264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	82.43
cd07844	291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	82.38
cd07874	355	STKc_JNK3 Catalytic domain of the Serine/Threonine	82.34
cd07843	293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	82.03
cd07839	284	STKc_CDK5 Catalytic domain of the Serine/Threonine	82.01
cd07837	295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	81.92
cd07859	338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	81.07
cd06611	280	STKc_SLK_like Catalytic domain of Ste20-like kinas	81.04
cd07836	284	STKc_Pho85 Catalytic domain of the Serine/Threonin	80.85
cd06628	267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	80.57
cd07879	342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	80.34
cd07855	334	STKc_ERK5 Catalytic domain of the Serine/Threonine	80.31
cd06643	282	STKc_SLK Catalytic domain of the Protein Serine/Th	80.22
cd07857	332	STKc_MPK1 Catalytic domain of the Serine/Threonine	80.06
cd06654	296	STKc_PAK1 Catalytic domain of the Protein Serine/T	80.03

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=98.46  E-value=3.7e-07  Score=60.41  Aligned_cols=45  Identities=22%  Similarity=0.352  Sum_probs=39.2

Q ss_pred             CCcccc-CCCcH-HHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421            1 MDPVLL-ESDFE-LEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus         1 ~D~~l~-~~~~~-~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +||+|. +.+.. +++.+++.+|++|++.+|..||.|.+|+.+|+..
T Consensus       306 iD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~  352 (361)
T KOG1187|consen  306 VDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGI  352 (361)
T ss_pred             eCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhh
Confidence            588886 55654 7899999999999999999999999999999654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional

Probab=96.98  E-value=0.0014  Score=47.60  Aligned_cols=36  Identities=22%  Similarity=0.342  Sum_probs=32.1

Q ss_pred             cHHHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           10 FELEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        10 ~~~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+++..+.+++.+|.+.+|.+||+|.+|++.|+..
T Consensus       916 ~~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~  951 (968)
T PLN00113        916 NQNEIVEVMNLALHCTATDPTARPCANDVLKTLESA  951 (968)
T ss_pred             cHHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHh
Confidence            446677889999999999999999999999999864

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=96.08  E-value=0.0089  Score=36.97  Aligned_cols=31  Identities=19%  Similarity=0.250  Sum_probs=27.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+..+..+|++.+|..||++.+++.+|+..
T Consensus       253 ~~~~~li~~cl~~~p~~Rpt~~ei~~~l~~i  283 (284)
T cd05038         253 DEVYDLMKLCWEAEPQDRPSFADLILIVDRL  283 (284)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHhhc
Confidence            3577888999999999999999999999753

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors

Probab=95.89  E-value=0.012  Score=36.79  Aligned_cols=29  Identities=17%  Similarity=0.217  Sum_probs=26.1

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+.++...|++.+|.+||++.+++..|+
T Consensus       267 ~~l~~li~~cl~~~p~~Rpt~~el~~~L~  295 (296)
T cd05051         267 KDIYELMLECWRRDEEDRPTFREIHLFLQ  295 (296)
T ss_pred             HHHHHHHHHHhccChhcCCCHHHHHHHhc
Confidence            45788899999999999999999999885

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases

Probab=95.86  E-value=0.013  Score=36.04  Aligned_cols=30  Identities=23%  Similarity=0.232  Sum_probs=26.4

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+..+|++.+|.+||++.+++..|+.
T Consensus       231 ~~~~~li~~~l~~~P~~Rp~~~~l~~~l~~  260 (261)
T cd05068         231 KELYDIMLDCWKEDPDDRPTFETLQWKLED  260 (261)
T ss_pred             HHHHHHHHHHhhcCcccCCCHHHHHHHHhc
Confidence            456778889999999999999999999873

Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases

Probab=95.80  E-value=0.013  Score=36.82  Aligned_cols=28  Identities=14%  Similarity=0.350  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+.++...|++.+|.+||++.+|...|+
T Consensus       267 ~l~~li~~~l~~~p~~RPs~~~i~~~l~  294 (295)
T cd05097         267 PVFKLMMRCWSRDIKDRPTFNKIHHFLR  294 (295)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHh
Confidence            4678889999999999999999999885

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk

Probab=95.73  E-value=0.018  Score=35.33  Aligned_cols=30  Identities=20%  Similarity=0.220  Sum_probs=26.2

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+..+|++.+|.+||++.++.+.|+.
T Consensus       231 ~~~~~~i~~~l~~~p~~Rpt~~~l~~~L~~  260 (261)
T cd05148         231 QEIYKIMLECWAAEPEDRPSFKALREELDN  260 (261)
T ss_pred             HHHHHHHHHHcCCCchhCcCHHHHHHHHhc
Confidence            346678889999999999999999999874

Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2

Probab=95.70  E-value=0.017  Score=36.29  Aligned_cols=29  Identities=17%  Similarity=0.218  Sum_probs=25.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+.++..+|.+.+|.+||++.+++..|+
T Consensus       267 ~~~~~li~~cl~~~p~~Rp~~~~i~~~l~  295 (296)
T cd05095         267 DSLYKLMLSCWRRNAKERPSFQEIHATLL  295 (296)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            45667889999999999999999999885

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase

Probab=95.68  E-value=0.016  Score=35.39  Aligned_cols=29  Identities=24%  Similarity=0.298  Sum_probs=25.2

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+..+|++.+|.+||++.++++.|+
T Consensus       228 ~~~~~l~~~~l~~~p~~Rp~~~~~l~~l~  256 (256)
T cd05112         228 QSVYELMQHCWKERPEDRPSFSLLLHQLA  256 (256)
T ss_pred             HHHHHHHHHHcccChhhCCCHHHHHHhhC
Confidence            34677899999999999999999998873

Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein

Probab=95.61  E-value=0.018  Score=36.02  Aligned_cols=30  Identities=13%  Similarity=0.222  Sum_probs=26.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       257 ~~~~~i~~cl~~~P~~Rp~~~~i~~~l~~~  286 (290)
T cd05045         257 EMYNLMLTCWKQEPDKRPTFADISKELEKM  286 (290)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHHHHHHHH
Confidence            566788999999999999999999999753

Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors

Probab=95.58  E-value=0.019  Score=35.61  Aligned_cols=30  Identities=20%  Similarity=0.252  Sum_probs=26.2

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|++.+|.+||++.++...|+.
T Consensus       253 ~~~~~l~~~c~~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05048         253 ARVYALMIECWNEIPARRPRFKDIHTRLRS  282 (283)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHhc
Confidence            356678899999999999999999999864

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2

Probab=95.48  E-value=0.022  Score=35.10  Aligned_cols=30  Identities=17%  Similarity=0.282  Sum_probs=26.4

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|.+.+|..||++.++...|+.
T Consensus       237 ~~~~~li~~c~~~~p~~Rp~~~~i~~~l~~  266 (268)
T cd05063         237 SAVYQLMLQCWQQDRARRPRFVDIVNLLDK  266 (268)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            356788899999999999999999999864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=95.48  E-value=0.024  Score=35.29  Aligned_cols=29  Identities=14%  Similarity=0.122  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|+..+|..||++.+++..|+.
T Consensus       254 ~~~~li~~cl~~~p~~Rpt~~ei~~~l~~  282 (284)
T cd05081         254 EIYAIMKECWNNDPSQRPSFSELALQVEA  282 (284)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHh
Confidence            56778889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase

Probab=95.41  E-value=0.026  Score=35.25  Aligned_cols=29  Identities=24%  Similarity=0.393  Sum_probs=25.9

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+..+|++.+|.+||++.++...|+
T Consensus       259 ~~l~~li~~~l~~~p~~Rpt~~el~~~l~  287 (288)
T cd05050         259 LELYNLMRLCWSKLPSDRPSFASINRILQ  287 (288)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhh
Confidence            45777889999999999999999999886

Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases

Probab=95.38  E-value=0.025  Score=34.85  Aligned_cols=30  Identities=23%  Similarity=0.319  Sum_probs=26.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|++.+|.+||++.++...|+.
T Consensus       235 ~~l~~li~~cl~~~p~~Rp~~~ei~~~l~~  264 (266)
T cd05033         235 SALYQLMLDCWQKDRNERPTFSQIVSTLDK  264 (266)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            356678899999999999999999999874

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase

Probab=95.38  E-value=0.025  Score=34.72  Aligned_cols=27  Identities=15%  Similarity=0.281  Sum_probs=24.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+..+...|.+.+|.+||++.+++..|
T Consensus       229 ~~~~li~~c~~~~p~~Rps~~~l~~~l  255 (256)
T cd05114         229 TVYEVMYSCWHEKPEGRPTFAELLRAI  255 (256)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHhh
Confidence            467888899999999999999999876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors

Probab=95.35  E-value=0.023  Score=35.49  Aligned_cols=31  Identities=16%  Similarity=0.198  Sum_probs=27.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+..+...|++.+|.+||++.+++..|+..
T Consensus       261 ~~~~~li~~~l~~~p~~Rps~~eil~~l~~~  291 (293)
T cd05053         261 QELYHLMRDCWHEVPSQRPTFKQLVEDLDRM  291 (293)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHHHHHHh
Confidence            3567788999999999999999999998753

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2

Probab=95.33  E-value=0.024  Score=35.29  Aligned_cols=28  Identities=21%  Similarity=0.324  Sum_probs=24.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+...|++.+|.+||++.++...|+.
T Consensus       255 ~~~li~~cl~~~p~~RP~~~~i~~~l~~  282 (283)
T cd05091         255 VYTLMLECWNEFPSRRPRFKDIHSRLRT  282 (283)
T ss_pred             HHHHHHHHhCCCcccCCCHHHHHHHhhC
Confidence            5677889999999999999999998863

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10

Probab=95.32  E-value=0.031  Score=34.48  Aligned_cols=28  Identities=25%  Similarity=0.298  Sum_probs=23.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+..+|++.+|.+||++.++..++.
T Consensus       241 ~l~~li~~cl~~~p~~Rp~~~e~~~~~~  268 (269)
T cd08528         241 DVTDVITSCLTPDAEARPDIIQVSAMIS  268 (269)
T ss_pred             HHHHHHHHHCCCCCccCCCHHHHHHHhc
Confidence            3555667899999999999999999875

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1

Probab=95.29  E-value=0.027  Score=35.52  Aligned_cols=28  Identities=21%  Similarity=0.328  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+.++...|.+.+|.+||++.+++..|+
T Consensus       276 ~~~~li~~cl~~~p~~RPs~~~i~~~l~  303 (304)
T cd05096         276 GLYELMLQCWSRDCRERPSFSDIHAFLT  303 (304)
T ss_pred             HHHHHHHHHccCCchhCcCHHHHHHHHh
Confidence            4667889999999999999999998885

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C

Probab=95.27  E-value=0.024  Score=35.61  Aligned_cols=30  Identities=20%  Similarity=0.273  Sum_probs=27.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.++.++|+..
T Consensus       253 ~~~~li~~~l~~~P~~Rpt~~~v~~~l~~~  282 (291)
T cd05094         253 EVYDIMLGCWQREPQQRLNIKEIYKILHAL  282 (291)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHHH
Confidence            466788999999999999999999999865

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=95.27  E-value=0.025  Score=35.26  Aligned_cols=30  Identities=13%  Similarity=0.168  Sum_probs=26.8

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+...|.+.+|..||++.+++..|+.
T Consensus       251 ~~~~~li~~cl~~~p~~Rps~~~i~~~l~~  280 (283)
T cd05080         251 QEVYILMKNCWETEAKFRPTFRSLIPILKE  280 (283)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHHH
Confidence            467778899999999999999999999875

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity

Probab=95.26  E-value=0.025  Score=35.04  Aligned_cols=27  Identities=15%  Similarity=0.175  Sum_probs=20.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+..+...|...+|.+||++.++++.|
T Consensus       233 ~~~~li~~C~~~~p~~RPs~~~i~~~L  259 (259)
T PF07714_consen  233 DIYSLIQQCWSHDPEKRPSFQEILQEL  259 (259)
T ss_dssp             HHHHHHHHHT-SSGGGS--HHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHhcC
Confidence            456778899999999999999999876

Tyrosine kinase, catalytic domain; InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []: Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction []. Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases []. ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3

Probab=95.26  E-value=0.024  Score=36.38  Aligned_cols=29  Identities=21%  Similarity=0.391  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++++.|+.
T Consensus       305 ~l~~li~~cl~~dp~~RPs~~el~~~l~~  333 (338)
T cd05102         305 EIYRIMLACWQGDPKERPTFSALVEILGD  333 (338)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            46678889999999999999999999975

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn

Probab=95.19  E-value=0.034  Score=34.13  Aligned_cols=29  Identities=17%  Similarity=0.285  Sum_probs=25.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|+..+|.+||++.++...|+.
T Consensus       232 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  260 (261)
T cd05072         232 ELYDIMKTCWKEKAEERPTFDYLQSVLDD  260 (261)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            46678889999999999999999999864

Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase

Probab=95.10  E-value=0.039  Score=34.03  Aligned_cols=29  Identities=17%  Similarity=0.223  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++.+.|+.
T Consensus       233 ~~~~li~~cl~~~p~~Rp~~~~l~~~l~~  261 (263)
T cd05052         233 KVYELMRACWQWNPSDRPSFAEIHQAFET  261 (263)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHHHHHHh
Confidence            45567789999999999999999999874

Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases

Probab=95.10  E-value=0.033  Score=34.18  Aligned_cols=31  Identities=19%  Similarity=0.239  Sum_probs=27.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+..+...|+..+|.+||++.++...|+..
T Consensus       225 ~~l~~li~~cl~~~p~~Rp~~~~l~~~l~~~  255 (257)
T cd05060         225 QEIYSIMLSCWKYRPEDRPTFSELESTFRRD  255 (257)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHHHHHHhc
Confidence            3456788899999999999999999999764

Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes

Probab=95.08  E-value=0.033  Score=34.01  Aligned_cols=29  Identities=24%  Similarity=0.093  Sum_probs=25.2

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+...|++.+|.+||++.++.++|+
T Consensus       223 ~~~~~li~~~l~~~p~~Rps~~~~~~~l~  251 (252)
T cd05084         223 DAVYRLMERCWEYDPGQRPSFSTVHQELQ  251 (252)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHh
Confidence            35667788999999999999999999885

Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases

Probab=95.06  E-value=0.032  Score=34.25  Aligned_cols=28  Identities=21%  Similarity=0.330  Sum_probs=24.9

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      ..+..+...|+..+|.+||++.+++..|
T Consensus       228 ~~~~~li~~cl~~~p~~Rpt~~~~l~~l  255 (256)
T cd05059         228 TEVYTIMYSCWHEKPEDRPAFKKLLSQL  255 (256)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHHHHh
Confidence            3577888999999999999999999876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit

Probab=95.05  E-value=0.027  Score=37.07  Aligned_cols=29  Identities=7%  Similarity=0.213  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       345 ~l~~li~~cl~~dP~~RPs~~eil~~l~~  373 (375)
T cd05104         345 EMYDIMKSCWDADPLKRPTFKQIVQLIEQ  373 (375)
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHh
Confidence            45677789999999999999999999874

Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases

Probab=95.01  E-value=0.036  Score=34.03  Aligned_cols=30  Identities=13%  Similarity=0.194  Sum_probs=26.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|++.+|.+||++.+++..|+.
T Consensus       242 ~~~~~li~~~l~~~p~~Rp~~~e~~~~l~~  271 (273)
T cd05035         242 DELYDLMYSCWRADPKDRPTFTKLREVLEN  271 (273)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            356677788999999999999999999874

Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors

Probab=94.88  E-value=0.035  Score=36.00  Aligned_cols=30  Identities=20%  Similarity=0.342  Sum_probs=26.6

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+...|++.+|.+||++.+++..|+.
T Consensus       303 ~~~~~l~~~cl~~~p~~RPs~~ell~~l~~  332 (337)
T cd05054         303 PEIYSIMLDCWHNNPEDRPTFSELVEILGD  332 (337)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            356788899999999999999999999875

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase

Probab=94.84  E-value=0.043  Score=33.70  Aligned_cols=29  Identities=21%  Similarity=0.199  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++-..|.+.+|.+||++.+|+..|+.
T Consensus       226 ~l~~li~~~~~~~p~~Rp~~~~i~~~l~~  254 (257)
T cd05116         226 EMYDLMKLCWTYGVDERPGFAVVELRLRN  254 (257)
T ss_pred             HHHHHHHHHhccCchhCcCHHHHHHHHhc
Confidence            34567788999999999999999999975

Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor

Probab=94.80  E-value=0.041  Score=34.19  Aligned_cols=28  Identities=21%  Similarity=0.207  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.+++..|+
T Consensus       249 ~~~~li~~~l~~~p~~Rps~~e~l~~l~  276 (277)
T cd05062         249 MLFELMRMCWQYNPKMRPSFLEIISSIK  276 (277)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHhh
Confidence            4667888999999999999999998875

Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome

Probab=94.79  E-value=0.048  Score=33.59  Aligned_cols=28  Identities=14%  Similarity=0.354  Sum_probs=24.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+.++...|.+.+|.+||++.+++..|+
T Consensus       229 ~~~~li~~cl~~~p~~Rp~~~~ll~~~~  256 (256)
T cd05113         229 KVYAIMYSCWHEKAEERPTFQQLLSSIE  256 (256)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHhhC
Confidence            5667788999999999999999988764

Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron

Probab=94.77  E-value=0.045  Score=33.53  Aligned_cols=29  Identities=21%  Similarity=0.236  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       230 ~~~~li~~cl~~~p~~Rp~~~~il~~l~~  258 (262)
T cd05058         230 PLYEVMLSCWHPKPEMRPTFSELVSRIEQ  258 (262)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            46678889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer

Probab=94.73  E-value=0.055  Score=32.92  Aligned_cols=29  Identities=17%  Similarity=0.103  Sum_probs=25.5

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+...|++.+|.+||++.++...|.
T Consensus       221 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~  249 (250)
T cd05085         221 DDVYKVMQRCWDYKPENRPKFSELQKELA  249 (250)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhc
Confidence            45677889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase

Probab=94.68  E-value=0.056  Score=33.62  Aligned_cols=28  Identities=18%  Similarity=0.294  Sum_probs=24.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+.++...|++.+|.+||++.+|++.|+
T Consensus       249 ~~~~~i~~cl~~~p~~Rps~~~vl~~l~  276 (277)
T cd05036         249 PVYRIMTDCWQHTPEDRPNFATILERIQ  276 (277)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHhh
Confidence            4567888999999999999999998875

Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B

Probab=94.64  E-value=0.042  Score=34.41  Aligned_cols=30  Identities=27%  Similarity=0.280  Sum_probs=26.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.++...|+..
T Consensus       250 ~l~~li~~~l~~~p~~Rpt~~~v~~~l~~~  279 (288)
T cd05093         250 EVYDLMLGCWQREPHMRLNIKEIHSLLQNL  279 (288)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHHH
Confidence            467788999999999999999999988754

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3

Probab=94.63  E-value=0.051  Score=33.48  Aligned_cols=30  Identities=13%  Similarity=0.029  Sum_probs=26.9

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|++.+|..||++.++...|+.
T Consensus       242 ~~~~~l~~~~l~~~p~~Rps~~~~~~~l~~  271 (273)
T cd05074         242 EDVYELMCQCWSPEPKCRPSFQHLRDQLEL  271 (273)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            467788899999999999999999999874

Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=94.62  E-value=0.044  Score=33.76  Aligned_cols=28  Identities=18%  Similarity=0.146  Sum_probs=23.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|..||++.++++.|+
T Consensus       231 ~~~~li~~~l~~~p~~Rps~~~il~~l~  258 (258)
T cd05078         231 ELANLINQCMDYEPDFRPSFRAIIRDLN  258 (258)
T ss_pred             HHHHHHHHHhccChhhCCCHHHHHHhcC
Confidence            3566778899999999999999998863

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl

Probab=94.58  E-value=0.06  Score=33.17  Aligned_cols=29  Identities=21%  Similarity=0.117  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++...|+.
T Consensus       242 ~~~~li~~~l~~~p~~Rps~~~l~~~l~~  270 (272)
T cd05075         242 GLYSLMSSCWLLNPKDRPSFETLRCELEK  270 (272)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            46678889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=94.51  E-value=0.058  Score=33.65  Aligned_cols=30  Identities=10%  Similarity=0.112  Sum_probs=26.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+...|++.+|.+||++.+++..|+.
T Consensus       253 ~~~~~li~~~l~~~p~~Rpt~~~il~~l~~  282 (284)
T cd05079         253 EEVYQLMRKCWEFQPSKRTTFQNLIEGFEA  282 (284)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHHHHh
Confidence            457788899999999999999999999875

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)

Probab=94.48  E-value=0.056  Score=33.57  Aligned_cols=30  Identities=20%  Similarity=0.195  Sum_probs=26.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++..+|++.+|.+||++.+++..|+..
T Consensus       247 ~~~~li~~~l~~~p~~Rps~~~~~~~l~~~  276 (280)
T cd05043         247 ELFAVMACCWALDPEERPSFSQLVQCLTDF  276 (280)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHHH
Confidence            466788999999999999999999998753

Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase

Probab=94.41  E-value=0.067  Score=32.75  Aligned_cols=29  Identities=14%  Similarity=0.112  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|..||++.+++..|+.
T Consensus       225 ~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  253 (254)
T cd05083         225 DVYVLMTSCWETEPKKRPSFHKLREKLEK  253 (254)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHcc
Confidence            45677889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes

Probab=94.40  E-value=0.076  Score=32.67  Aligned_cols=29  Identities=17%  Similarity=0.258  Sum_probs=24.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++.+.|+.
T Consensus       231 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  259 (260)
T cd05069         231 SLHELMKLCWKKDPDERPTFEYIQSFLED  259 (260)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            45566778999999999999999999863

Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk

Probab=94.38  E-value=0.072  Score=32.71  Aligned_cols=29  Identities=17%  Similarity=0.249  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|+..+|.+||++.++...|+.
T Consensus       231 ~~~~li~~~l~~~p~~Rpt~~~l~~~l~~  259 (260)
T cd05070         231 SLHELMLQCWKKDPEERPTFEYLQSFLED  259 (260)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHHhc
Confidence            46678899999999999999999988863

Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases

Probab=94.37  E-value=0.072  Score=32.59  Aligned_cols=30  Identities=13%  Similarity=0.046  Sum_probs=25.6

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+..+...|+..+|.+||++.++..+|+.
T Consensus       226 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  255 (256)
T cd05039         226 PEVYKVMKDCWELDPAKRPTFKQLREQLAL  255 (256)
T ss_pred             HHHHHHHHHHhccChhhCcCHHHHHHHHhc
Confidence            345667788999999999999999999864

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk

>PHA02988 hypothetical protein; Provisional

Probab=94.28  E-value=0.077  Score=33.44  Aligned_cols=29  Identities=17%  Similarity=0.129  Sum_probs=24.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|.+.+|.+||++.+++..|+..
T Consensus       251 l~~li~~cl~~dp~~Rps~~ell~~l~~~  279 (283)
T PHA02988        251 IKCIVEACTSHDSIKRPNIKEILYNLSLY  279 (283)
T ss_pred             HHHHHHHHhcCCcccCcCHHHHHHHHHHH
Confidence            45566789999999999999999998753

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7

Probab=94.22  E-value=0.089  Score=32.32  Aligned_cols=29  Identities=14%  Similarity=0.228  Sum_probs=24.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+|.+.+..
T Consensus       236 ~~~~li~~~l~~~p~~Rpt~~~i~~~~~~  264 (267)
T cd08229         236 ELRQLVNMCINPDPEKRPDITYVYDVAKR  264 (267)
T ss_pred             HHHHHHHHhcCCCcccCCCHHHHHHHHhh
Confidence            45566678999999999999999988764

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors

Probab=94.20  E-value=0.079  Score=32.70  Aligned_cols=29  Identities=21%  Similarity=0.334  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       237 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  265 (267)
T cd05066         237 ALHQLMLDCWQKDRNERPKFEQIVSILDK  265 (267)
T ss_pred             HHHHHHHHHcccCchhCCCHHHHHHHHHh
Confidence            45678889999999999999999999864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor

Probab=94.19  E-value=0.06  Score=33.71  Aligned_cols=31  Identities=16%  Similarity=0.273  Sum_probs=27.1

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+..+...|++.+|.+||++.++++.|...
T Consensus       248 ~~~~~li~~~l~~~p~~Rps~~~ll~~l~~~  278 (288)
T cd05061         248 ERVTDLMRMCWQFNPKMRPTFLEIVNLLKDD  278 (288)
T ss_pred             HHHHHHHHHHcCCChhHCcCHHHHHHHHHhh
Confidence            3567788899999999999999999999864

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros

Probab=94.17  E-value=0.095  Score=32.21  Aligned_cols=28  Identities=11%  Similarity=0.243  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.++...|+
T Consensus       241 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~  268 (269)
T cd05044         241 KIYQLMTNCWAQDPSERPTFDRIQEILQ  268 (269)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            4566778999999999999999999885

Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src

Probab=94.12  E-value=0.095  Score=32.38  Aligned_cols=30  Identities=10%  Similarity=0.138  Sum_probs=26.6

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++...|++.+|.+||++.++...|+.
T Consensus       230 ~~l~~li~~~l~~~p~~Rp~~~~~~~~l~~  259 (262)
T cd05071         230 ESLHDLMCQCWRKEPEERPTFEYLQAFLED  259 (262)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHHHHHHH
Confidence            456788899999999999999999999874

Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase

Probab=94.10  E-value=0.078  Score=32.47  Aligned_cols=29  Identities=17%  Similarity=0.076  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++...|+.
T Consensus       227 ~~~~li~~~l~~~p~~Rpt~~~l~~~l~~  255 (256)
T cd05082         227 VVYDVMKQCWHLDAATRPSFLQLREQLEH  255 (256)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHhc
Confidence            35667789999999999999999998864

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases

Probab=94.04  E-value=0.082  Score=32.65  Aligned_cols=29  Identities=17%  Similarity=0.220  Sum_probs=25.5

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+...|++.+|.+||++.++...|+
T Consensus       248 ~~~~~li~~~l~~~p~~Rpt~~~l~~~l~  276 (277)
T cd05032         248 DKLLELMRMCWQYNPKMRPTFLEIVSSLK  276 (277)
T ss_pred             HHHHHHHHHHcCCChhhCCCHHHHHHHhc
Confidence            45667888999999999999999999875

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors

Probab=94.03  E-value=0.08  Score=32.66  Aligned_cols=29  Identities=21%  Similarity=0.266  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.++...|+.
T Consensus       239 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  267 (269)
T cd05065         239 ALHQLMLDCWQKDRNARPKFGQIVSTLDK  267 (269)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            45667889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7

Probab=93.99  E-value=0.1  Score=31.94  Aligned_cols=30  Identities=17%  Similarity=0.192  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|+..+|..||++.+++.+|+..
T Consensus       236 ~~~~~i~~cl~~~p~~Rp~~~~il~~~~~~  265 (267)
T cd08224         236 ELRDLVSRCINPDPEKRPDISYVLQVAKEM  265 (267)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHHHHh
Confidence            456677889999999999999999999753

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2

Probab=93.98  E-value=0.071  Score=34.52  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       310 ~~~~~~~~cl~~~p~~Rps~~eil~~l~~  338 (343)
T cd05103         310 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  338 (343)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            46677889999999999999999999875

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase

Probab=93.93  E-value=0.099  Score=31.92  Aligned_cols=28  Identities=21%  Similarity=0.311  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.+++..|.
T Consensus       229 ~~~~li~~~l~~~p~~Rps~~~~~~~l~  256 (257)
T cd05040         229 DIYNVMLQCWAHNPADRPTFAALREFLP  256 (257)
T ss_pred             HHHHHHHHHCCCCcccCCCHHHHHHHhc
Confidence            4566788999999999999999998874

Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases

Probab=93.93  E-value=0.087  Score=32.62  Aligned_cols=29  Identities=17%  Similarity=0.263  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|..||++.+++..|..
T Consensus       239 ~~~~li~~~l~~~p~~Rps~~~il~~l~~  267 (270)
T cd05047         239 EVYDLMRQCWREKPYERPSFAQILVSLNR  267 (270)
T ss_pred             HHHHHHHHHcccChhhCCCHHHHHHHHHH
Confidence            46678899999999999999999999874

Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases

Probab=93.87  E-value=0.1  Score=32.29  Aligned_cols=28  Identities=18%  Similarity=0.241  Sum_probs=24.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|..||++.++...|+
T Consensus       252 ~~~~li~~~l~~~p~~Rp~~~eil~~l~  279 (280)
T cd05049         252 EVYDIMLGCWKRDPQQRINIKDIHERLQ  279 (280)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHhh
Confidence            4567778899999999999999999885

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors

Probab=93.84  E-value=0.098  Score=33.17  Aligned_cols=29  Identities=7%  Similarity=0.221  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.+++..|+.
T Consensus       272 ~~~~li~~cl~~~p~~Rpt~~ell~~l~~  300 (302)
T cd05055         272 EIYDIMKTCWDADPLKRPTFKQIVQLIGK  300 (302)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHh
Confidence            46678889999999999999999999864

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases

Probab=93.83  E-value=0.092  Score=31.80  Aligned_cols=28  Identities=25%  Similarity=0.303  Sum_probs=24.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.++...|+
T Consensus       235 ~~~~li~~~l~~~p~~Rps~~~l~~~l~  262 (262)
T cd00192         235 ELYELMLSCWQLDPEDRPTFSELVERLE  262 (262)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHhhC
Confidence            4667778899999999999999998763

Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase

Probab=93.82  E-value=0.11  Score=31.94  Aligned_cols=29  Identities=14%  Similarity=0.303  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++...|+.
T Consensus       231 ~~~~~i~~~l~~~p~~Rp~~~~l~~~L~~  259 (260)
T cd05073         231 ELYNIMMRCWKNRPEERPTFEYIQSVLDD  259 (260)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHHhc
Confidence            45667789999999999999999998863

Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk

Probab=93.81  E-value=0.1  Score=32.01  Aligned_cols=29  Identities=21%  Similarity=0.296  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.++...|+.
T Consensus       231 ~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  259 (260)
T cd05067         231 ELYELMRLCWKEKPEERPTFEYLRSVLED  259 (260)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHhhc
Confidence            46777789999999999999999998863

Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases

Probab=93.79  E-value=0.091  Score=31.97  Aligned_cols=28  Identities=21%  Similarity=0.236  Sum_probs=24.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|.+.+|.+||++.++...|+
T Consensus       223 ~~~~li~~~l~~~p~~Rp~~~ell~~l~  250 (251)
T cd05041         223 EIYRLMLQCWAYDPENRPSFSEIYNELQ  250 (251)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHHHHhh
Confidence            5667788999999999999999998875

Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6

Probab=93.75  E-value=0.11  Score=31.90  Aligned_cols=30  Identities=13%  Similarity=0.185  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+|...++..
T Consensus       236 ~~~~li~~cl~~~p~~Rp~~~~vl~~~~~~  265 (267)
T cd08228         236 KLRELVSMCIYPDPDQRPDIGYVHQIAKQM  265 (267)
T ss_pred             HHHHHHHHHCCCCcccCcCHHHHHHHHHHh
Confidence            456677789999999999999999998753

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1

Probab=93.73  E-value=0.11  Score=32.27  Aligned_cols=28  Identities=21%  Similarity=0.197  Sum_probs=24.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.++.+.|.
T Consensus       254 ~~~~li~~cl~~~p~~Rp~~~~i~~~l~  281 (283)
T cd05090         254 RMYSLMTECWQEGPSRRPRFKDIHTRLR  281 (283)
T ss_pred             HHHHHHHHHcccCcccCcCHHHHHHHhh
Confidence            4556778999999999999999998875

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2

Probab=93.63  E-value=0.11  Score=32.72  Aligned_cols=30  Identities=10%  Similarity=0.090  Sum_probs=25.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|..||++.+++..|...
T Consensus       267 ~~~~li~~cl~~~p~~Rps~~e~l~~l~~~  296 (304)
T cd05101         267 ELYMMMRDCWHAIPSHRPTFKQLVEDLDRI  296 (304)
T ss_pred             HHHHHHHHHcccChhhCCCHHHHHHHHHHH
Confidence            455677889999999999999999998753

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3

Probab=93.62  E-value=0.15  Score=32.68  Aligned_cols=30  Identities=10%  Similarity=0.130  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+++..|...
T Consensus       264 ~l~~li~~cl~~~p~~Rps~~ell~~l~~~  293 (334)
T cd05100         264 ELYMIMRECWHAVPSQRPTFKQLVEDLDRV  293 (334)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHHH
Confidence            456778899999999999999999999754

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases

Probab=93.59  E-value=0.13  Score=31.49  Aligned_cols=29  Identities=17%  Similarity=0.266  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.++...|+.
T Consensus       232 ~~~~~i~~~l~~~p~~Rp~~~~l~~~l~~  260 (261)
T cd05034         232 ELYDLMLQCWDKDPEERPTFEYLQSFLED  260 (261)
T ss_pred             HHHHHHHHHcccCcccCCCHHHHHHHHhc
Confidence            56678889999999999999999998863

Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1

Probab=93.56  E-value=0.12  Score=32.77  Aligned_cols=29  Identities=10%  Similarity=0.125  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       270 ~~~~li~~~l~~~p~~Rps~~evl~~l~~  298 (307)
T cd05098         270 ELYMMMRDCWHAVPSQRPTFKQLVEDLDR  298 (307)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHHHHH
Confidence            45567789999999999999999999975

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=93.53  E-value=0.097  Score=32.69  Aligned_cols=27  Identities=19%  Similarity=0.191  Sum_probs=23.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+..+...|.+.+|.+||++.+++..|
T Consensus       247 ~~~~li~~cl~~~p~~Rps~~~il~~L  273 (274)
T cd05076         247 ELATLISQCLTYEPTQRPSFRTILRDL  273 (274)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHhh
Confidence            356777899999999999999998876

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10

Probab=93.52  E-value=0.13  Score=31.88  Aligned_cols=29  Identities=28%  Similarity=0.265  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|..||++.++.+.|..
T Consensus       236 ~~~~li~~c~~~~p~~RP~~~~i~~~l~~  264 (266)
T cd05064         236 LLHQLMLDCWQKERGERPRFSQIHSILSK  264 (266)
T ss_pred             HHHHHHHHHcCCCchhCCCHHHHHHHHHh
Confidence            45667788999999999999999998864

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1

Probab=93.45  E-value=0.12  Score=32.58  Aligned_cols=29  Identities=14%  Similarity=0.202  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.+++..|..
T Consensus       246 ~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  274 (297)
T cd05089         246 EVYELMRQCWRDRPYERPPFAQISVQLSR  274 (297)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45678889999999999999999988864

Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor

Probab=93.41  E-value=0.11  Score=34.27  Aligned_cols=29  Identities=10%  Similarity=0.234  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++++|+.
T Consensus       343 ~l~~li~~cl~~dp~~RPs~~~l~~~l~~  371 (374)
T cd05106         343 EIYSIMKMCWNLEPTERPTFSQISQLIQR  371 (374)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35566678999999999999999999874

Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4

Probab=93.24  E-value=0.14  Score=32.56  Aligned_cols=30  Identities=10%  Similarity=0.143  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|..||++.++...|...
T Consensus       264 ~l~~li~~cl~~~p~~Rps~~~ll~~l~~~  293 (314)
T cd05099         264 ELYMLMRECWHAVPTQRPTFKQLVEALDKV  293 (314)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            455677899999999999999999998754

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A

Probab=93.17  E-value=0.13  Score=32.02  Aligned_cols=28  Identities=21%  Similarity=0.178  Sum_probs=24.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.++...|+
T Consensus       252 ~~~~li~~cl~~~P~~Rp~~~~l~~~l~  279 (280)
T cd05092         252 EVYAIMQGCWQREPQQRMVIKDIHSRLQ  279 (280)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHh
Confidence            3556778899999999999999998885

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3

Probab=93.08  E-value=0.18  Score=31.52  Aligned_cols=30  Identities=10%  Similarity=0.056  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|...+|..||++.++...|...
T Consensus       239 ~~~~li~~c~~~~p~~Rps~~el~~~l~~~  268 (279)
T cd05111         239 DVYMVMVKCWMIDENVRPTFKELANEFTRM  268 (279)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            345567789999999999999999988753

Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=92.93  E-value=0.13  Score=31.27  Aligned_cols=29  Identities=14%  Similarity=0.103  Sum_probs=24.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      ..+..+...|...+|.+||++.+++..|+
T Consensus       231 ~~~~~li~~~l~~~p~~Rpt~~~il~~l~  259 (259)
T cd05037         231 AELANLINQCWTYDPTKRPSFRAILRDLN  259 (259)
T ss_pred             hHHHHHHHHHhccChhhCCCHHHHHHhcC
Confidence            45667788999999999999999998763

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki

>smart00219 TyrKc Tyrosine kinase, catalytic domain

Probab=92.72  E-value=0.14  Score=31.02  Aligned_cols=27  Identities=26%  Similarity=0.420  Sum_probs=22.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+.++...|+..+|.+||++.++...|
T Consensus       232 ~~~~~i~~~l~~~p~~Rpt~~~ll~~l  258 (258)
T smart00219      232 EIYKLMLQCWAEDPEDRPTFSELVEIL  258 (258)
T ss_pred             HHHHHHHHHCcCChhhCcCHHHHHhhC
Confidence            456678899999999999999988764

Phosphotransferases. Tyrosine-specific kinase subfamily.

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha

Probab=92.62  E-value=0.14  Score=34.24  Aligned_cols=29  Identities=14%  Similarity=0.216  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|..||++.++++.|+.
T Consensus       368 ~l~~li~~cl~~dP~~RPt~~~l~~~l~~  396 (400)
T cd05105         368 EVYDIMVKCWNSEPEKRPSFLHLSDIVES  396 (400)
T ss_pred             HHHHHHHHHCccCHhHCcCHHHHHHHHHH
Confidence            46678899999999999999999999975

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4

Probab=92.50  E-value=0.23  Score=30.69  Aligned_cols=28  Identities=29%  Similarity=0.334  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|++.+|.+||++.+++..|.
T Consensus       247 ~l~~~i~~~l~~~p~~Rp~~~~~l~~l~  274 (275)
T cd05046         247 RLYKLMTRCWAVNPKDRPSFSELVSALG  274 (275)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHhc
Confidence            5677889999999999999999998875

Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=92.50  E-value=0.17  Score=31.37  Aligned_cols=28  Identities=7%  Similarity=0.144  Sum_probs=23.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|.+.+|.+||++.+++..++
T Consensus       235 ~~~~li~~cl~~dp~~Rp~~~~il~~~~  262 (262)
T cd05077         235 ELADLMTHCMNYDPNQRPFFRAIMRDIN  262 (262)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHhcC
Confidence            3456777899999999999999988763

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2

Probab=92.47  E-value=0.18  Score=31.97  Aligned_cols=29  Identities=17%  Similarity=0.263  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|..||++.+++..|..
T Consensus       251 ~~~~li~~~l~~~p~~Rp~~~~il~~l~~  279 (303)
T cd05088         251 EVYDLMRQCWREKPYERPSFAQILVSLNR  279 (303)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45677889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2

Probab=92.38  E-value=0.18  Score=30.62  Aligned_cols=26  Identities=12%  Similarity=-0.041  Sum_probs=22.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.++++
T Consensus       236 ~~~~~l~~~~l~~~p~~Rp~~~~il~  261 (265)
T cd08217         236 SELNEVIKSMLNVDPDKRPSTEELLQ  261 (265)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHhh
Confidence            34567778999999999999999875

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain

Probab=92.19  E-value=0.21  Score=29.66  Aligned_cols=26  Identities=4%  Similarity=-0.079  Sum_probs=22.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+..+|+..+|..||++.+++.
T Consensus       215 ~~~~~~i~~~l~~~p~~Rp~~~~~~~  240 (244)
T smart00220      215 PEAKDLIRKLLVKDPEKRLTAEEALQ  240 (244)
T ss_pred             HHHHHHHHHHccCCchhccCHHHHhh
Confidence            45677889999999999999999875

Phosphotransferases. Serine or threonine-specific kinase subfamily.

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor

Probab=92.02  E-value=0.22  Score=31.69  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|..||++.++...+..
T Consensus       239 ~~~~li~~cl~~~p~~Rps~~~l~~~l~~  267 (316)
T cd05108         239 DVYMIMVKCWMIDADSRPKFRELIIEFSK  267 (316)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            45677889999999999999999998864

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor

>smart00750 KIND kinase non-catalytic C-lobe domain

Probab=91.79  E-value=0.26  Score=28.49  Aligned_cols=28  Identities=7%  Similarity=0.139  Sum_probs=24.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+.++...|.+.+|.+||++.+++..+.
T Consensus       140 ~~~~~i~~cl~~~p~~Rp~~~~ll~~~~  167 (176)
T smart00750      140 SFADFMRVCASRLPQRREAANHYLAHCR  167 (176)
T ss_pred             hHHHHHHHHHhcccccccCHHHHHHHHH
Confidence            4777888999999999999999988764

It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta

Probab=91.56  E-value=0.25  Score=33.18  Aligned_cols=29  Identities=14%  Similarity=0.261  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|..||++.+++..|+.
T Consensus       370 ~l~~li~~cl~~~P~~RPs~~ell~~L~~  398 (401)
T cd05107         370 EIYEIMQKCWEEKFEIRPDFSQLVHLVGD  398 (401)
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            45566778999999999999999999875

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4

Probab=91.53  E-value=0.31  Score=30.83  Aligned_cols=29  Identities=14%  Similarity=0.127  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|...+|..||++.+++..|..
T Consensus       239 ~~~~li~~c~~~~p~~Rp~~~~l~~~l~~  267 (303)
T cd05110         239 DVYMVMVKCWMIDADSRPKFKELAAEFSR  267 (303)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45667788999999999999999999864

Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains

Probab=91.39  E-value=0.28  Score=29.76  Aligned_cols=25  Identities=8%  Similarity=0.145  Sum_probs=21.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       228 ~~~~~i~~~l~~~p~~Rp~~~~ll~  252 (256)
T cd08529         228 QLAQLIDQCLTKDYRQRPDTFQLLR  252 (256)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHhh
Confidence            4667788999999999999998865

Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases

Probab=91.25  E-value=0.22  Score=30.90  Aligned_cols=25  Identities=8%  Similarity=-0.064  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       255 ~~~~li~~~l~~~P~~Rpt~~~il~  279 (283)
T cd07835         255 DGLDLLSKMLVYDPAKRISAKAALQ  279 (283)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhc
Confidence            4567888999999999999998864

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase

Probab=91.22  E-value=0.3  Score=30.11  Aligned_cols=30  Identities=13%  Similarity=0.058  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|+..+|.+||++.++...|+..
T Consensus       236 ~~~~li~~~l~~~P~~Rpt~~~~~~~l~~~  265 (270)
T cd05056         236 TLYSLMTKCWAYDPSKRPRFTELKAQLSDI  265 (270)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            455667789999999999999999998753

Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3

Probab=90.99  E-value=0.26  Score=30.52  Aligned_cols=25  Identities=20%  Similarity=0.324  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       258 ~~~~li~~~l~~~P~~Rp~~~~il~  282 (286)
T cd07846         258 LVLDLAKQCLRIDPDDRPSSSQLLH  282 (286)
T ss_pred             HHHHHHHHHhcCCcccchhHHHHhc
Confidence            4667888999999999999998764

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1

Probab=90.92  E-value=0.29  Score=29.84  Aligned_cols=25  Identities=12%  Similarity=0.178  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+|+.
T Consensus       228 ~~~~li~~~l~~~p~~Rp~~~~vl~  252 (256)
T cd08218         228 DLRNLVSQLFKRNPRDRPSVNSILE  252 (256)
T ss_pred             HHHHHHHHHhhCChhhCcCHHHHhh
Confidence            3556667899999999999999875

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1

Probab=90.83  E-value=0.36  Score=29.92  Aligned_cols=26  Identities=8%  Similarity=0.069  Sum_probs=22.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|.+||++.+++..
T Consensus       228 ~~~~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06642         228 PFKEFVEACLNKDPRFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHh
Confidence            45667788999999999999999863

Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2

Probab=90.80  E-value=0.4  Score=29.75  Aligned_cols=30  Identities=10%  Similarity=0.074  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|..||++.++...|...
T Consensus       239 ~~~~li~~~l~~dp~~Rp~~~~l~~~l~~~  268 (279)
T cd05109         239 DVYMIMVKCWMIDSECRPRFRELVDEFSRM  268 (279)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            455677889999999999999999888653

Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve

>PF11883 DUF3403: Domain of unknown function (DUF3403); InterPro: IPR021820 This functionally uncharacterised domain of around 50 amino acids is found in the C terminus of eukaryotic S-locus receptor kinase proteins

Probab=90.71  E-value=0.39  Score=23.26  Aligned_cols=24  Identities=29%  Similarity=0.265  Sum_probs=18.8

Q ss_pred             CCCCCCCCCcceecccCCCCcccc
Q 038421           47 VDLPVPKQPVFTVRAECPGFRVLW   70 (73)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~   70 (73)
                      ..+|.|++|+|+..+......+++
T Consensus         4 ~~LP~PKqPgF~~~r~~~e~~sSs   27 (48)
T PF11883_consen    4 ATLPQPKQPGFFTGRSPSETDSSS   27 (48)
T ss_pred             ccCCCCCCCCEEeEcCCCCcCCCc
Confidence            468999999999888876665553

; GO: 0004674 protein serine/threonine kinase activity

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases

Probab=90.64  E-value=0.36  Score=29.83  Aligned_cols=26  Identities=12%  Similarity=0.000  Sum_probs=22.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       254 ~~~~~li~~cl~~~p~~Rpt~~ei~~  279 (283)
T cd07830         254 PEAIDLIKDMLRWDPKKRPTASQALQ  279 (283)
T ss_pred             HHHHHHHHHhcccCcccCCCHHHHhh
Confidence            45678889999999999999998864

Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa

Probab=90.55  E-value=0.43  Score=29.40  Aligned_cols=29  Identities=14%  Similarity=0.075  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++-..|.+.+|.+||++.+|.+.|+.
T Consensus       226 ~l~~li~~c~~~~~~~Rp~~~~i~~~l~~  254 (257)
T cd05115         226 EMYALMKDCWIYKWEDRPNFAKVEERMRT  254 (257)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHhh
Confidence            44567788999999999999999999875

Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases

Probab=90.25  E-value=0.44  Score=29.79  Aligned_cols=26  Identities=8%  Similarity=0.062  Sum_probs=22.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|++.+|.+||++.+++..
T Consensus       241 ~~~~li~~~l~~~p~~Rpt~~eil~~  266 (287)
T cd06621         241 EFKDFIKQCLEKDPTRRPTPWDMLEH  266 (287)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHhC
Confidence            45678889999999999999988763

Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase

Probab=89.92  E-value=0.45  Score=28.60  Aligned_cols=25  Identities=8%  Similarity=0.178  Sum_probs=20.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++..+|+..+|.+||++.+++.
T Consensus       232 ~l~~~i~~~l~~~p~~Rp~~~~ll~  256 (260)
T cd06606         232 EAKDFLRKCLRRDPKKRPTADELLQ  256 (260)
T ss_pred             HHHHHHHHhCcCChhhCCCHHHHhh
Confidence            4556667899999999999998864

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase

Probab=89.90  E-value=0.47  Score=29.21  Aligned_cols=25  Identities=20%  Similarity=0.263  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       240 ~~~~li~~~l~~~p~~Rpt~~~ll~  264 (268)
T cd06624         240 EAKNFILRCFEPDPDKRASAHDLLQ  264 (268)
T ss_pred             HHHHHHHHHcCCCchhCCCHHHHHh
Confidence            4556778999999999999998764

Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases

Probab=89.85  E-value=0.43  Score=29.40  Aligned_cols=26  Identities=8%  Similarity=-0.056  Sum_probs=22.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..++.+...|++.+|.+||++.+++.
T Consensus       258 ~~~~~~i~~~l~~~P~~Rp~~~~~l~  283 (287)
T cd07840         258 PSALDLLDKLLTLDPKKRISADQALQ  283 (287)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHhh
Confidence            35677888999999999999998864

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4

Probab=89.82  E-value=0.4  Score=29.16  Aligned_cols=25  Identities=8%  Similarity=0.093  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|..||++.+++.
T Consensus       229 ~~~~li~~~l~~~p~~Rp~~~~~l~  253 (257)
T cd08223         229 ELGELIATMLSKRPEKRPSVKSILR  253 (257)
T ss_pred             HHHHHHHHHhccCcccCCCHHHHhc
Confidence            4567788999999999999988764

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases

Probab=89.70  E-value=0.32  Score=30.13  Aligned_cols=26  Identities=8%  Similarity=0.178  Sum_probs=21.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|+..+|.+||++.+++.
T Consensus       259 ~~~~~li~~~l~~~p~~Rps~~~il~  284 (288)
T cd07833         259 SPALDFLKACLRMDPKERLTCDELLQ  284 (288)
T ss_pred             hHHHHHHHHHhccCchhcccHHHHhc
Confidence            34667788999999999999988764

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8

Probab=89.38  E-value=0.42  Score=29.01  Aligned_cols=25  Identities=12%  Similarity=0.103  Sum_probs=20.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       228 ~l~~li~~~l~~~p~~Rpt~~~ll~  252 (256)
T cd08220         228 DLRQLILSMLNLDPSKRPQLSQIMA  252 (256)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhh
Confidence            3556778899999999999998864

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases

Probab=89.36  E-value=0.54  Score=28.96  Aligned_cols=26  Identities=8%  Similarity=0.088  Sum_probs=22.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       254 ~~~~~~i~~~l~~~P~~Rp~~~~ll~  279 (283)
T cd05118         254 PQALDLLSQMLHYDPHKRITAEQALA  279 (283)
T ss_pred             HHHHHHHHHHhccCcccCcCHHHHhh
Confidence            35667888999999999999998864

Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2

Probab=89.32  E-value=0.4  Score=29.08  Aligned_cols=25  Identities=12%  Similarity=0.145  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++-..|++.+|..||++.+++.
T Consensus       228 ~~~~~i~~~l~~~P~~Rps~~~il~  252 (256)
T cd06612         228 EFNDFVKKCLVKDPEERPSAIQLLQ  252 (256)
T ss_pred             HHHHHHHHHHhcChhhCcCHHHHhc
Confidence            3455667899999999999998864

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases

Probab=89.13  E-value=0.45  Score=29.07  Aligned_cols=25  Identities=8%  Similarity=0.151  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-.+|+..+|.+||++.+++.
T Consensus       247 ~~~~li~~~l~~dp~~Rpt~~~ll~  271 (275)
T cd06608         247 KFNDFISECLIKNYEQRPFMEELLE  271 (275)
T ss_pred             HHHHHHHHHhhcChhhCcCHHHHhc
Confidence            4556778899999999999998865

Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I

>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]

Probab=88.84  E-value=0.78  Score=30.03  Aligned_cols=29  Identities=17%  Similarity=0.122  Sum_probs=24.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++--+|++.+|.+||++.++...++.
T Consensus       271 ~l~~lik~mlqvdP~qRP~i~~ll~~~d~  299 (302)
T KOG2345|consen  271 ALHQLIKSMLQVDPNQRPTIPELLSKLDD  299 (302)
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHHHHHHh
Confidence            45556678999999999999999888764

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2

Probab=88.82  E-value=0.67  Score=28.66  Aligned_cols=23  Identities=26%  Similarity=0.290  Sum_probs=18.1

Q ss_pred             HHHHhcCcCccCCCCHHHHHHHhh
Q 038421           20 VGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        20 val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      +-..|. .+|.+||++.++++.|.
T Consensus       245 l~~~c~-~~P~~Rp~~~~i~~~l~  267 (268)
T cd05086         245 VLQFCW-LSPEKRATAEEVHRLLT  267 (268)
T ss_pred             HHHHHh-hCcccCCCHHHHHHHhc
Confidence            334577 46999999999998874

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin

Probab=88.82  E-value=0.66  Score=28.78  Aligned_cols=26  Identities=12%  Similarity=0.198  Sum_probs=21.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|.+.+|.+||++.+++.-
T Consensus       258 ~~~~li~~~l~~~p~~Rps~~ell~~  283 (286)
T cd06638         258 EFNDFIRKCLTKDYEKRPTVSDLLQH  283 (286)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhhc
Confidence            35566778999999999999998763

Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases

Probab=88.79  E-value=0.48  Score=29.52  Aligned_cols=27  Identities=11%  Similarity=0.081  Sum_probs=22.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+..+...|++.+|..||++.++....
T Consensus       241 ~~~~li~~~l~~dp~~Rpt~~e~~~~~  267 (284)
T cd06620         241 DLRDFVDACLLKDPTERPTPQQLCAMP  267 (284)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhcCc
Confidence            355667789999999999999998764

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd00180 PKc Catalytic domain of Protein Kinases

Probab=88.74  E-value=0.51  Score=27.05  Aligned_cols=27  Identities=11%  Similarity=0.005  Sum_probs=23.4

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      ..+.++...|++.+|..||++.+++..
T Consensus       188 ~~~~~~l~~~l~~~p~~R~~~~~l~~~  214 (215)
T cd00180         188 PELKDLIRKMLQKDPEKRPSAKEILEH  214 (215)
T ss_pred             HHHHHHHHHHhhCCcccCcCHHHHhhC
Confidence            577788899999999999999988754

Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases

Probab=88.42  E-value=0.55  Score=29.49  Aligned_cols=25  Identities=4%  Similarity=-0.041  Sum_probs=21.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       288 ~~~~~i~~~l~~~P~~Rps~~eil~  312 (316)
T cd07842         288 QGFDLLRKLLEYDPTKRITAEEALE  312 (316)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhc
Confidence            4677888999999999999988764

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase

Probab=88.38  E-value=0.63  Score=28.70  Aligned_cols=26  Identities=4%  Similarity=-0.037  Sum_probs=21.6

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+.++-..|++.+|.+||++.+++.
T Consensus       253 ~~~~~li~~~l~~~P~~R~~~~~~l~  278 (282)
T cd07831         253 AEGLDLLKKLLAYDPDERITAKQALR  278 (282)
T ss_pred             HHHHHHHHHHhccCcccccCHHHHhh
Confidence            45667778899999999999988764

Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7

Probab=88.22  E-value=0.65  Score=29.01  Aligned_cols=27  Identities=4%  Similarity=-0.057  Sum_probs=22.9

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      ..+.++...|++.+|..||++.+++..
T Consensus       256 ~~~~~li~~~l~~~P~~R~s~~e~l~~  282 (298)
T cd07841         256 DDALDLLQRLLTLNPNKRITARQALEH  282 (298)
T ss_pred             HHHHHHHHHHhcCCcccCcCHHHHhhC
Confidence            345677888999999999999999875

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases

Probab=88.11  E-value=0.56  Score=28.05  Aligned_cols=25  Identities=12%  Similarity=0.201  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|..||++.++..
T Consensus       226 ~~~~~i~~~l~~~p~~R~t~~~~l~  250 (253)
T cd05122         226 EFKDFLKKCLQKNPEKRPTAEQLLK  250 (253)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhc
Confidence            4556667899999999999988764

Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases

Probab=87.99  E-value=0.65  Score=28.67  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=20.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+...|+..+|.+||++.+++..
T Consensus       227 ~~~~l~~~l~~~p~~Rpt~~~il~~  251 (274)
T cd06609         227 FKDFVSLCLNKDPKERPSAKELLKH  251 (274)
T ss_pred             HHHHHHHHhhCChhhCcCHHHHhhC
Confidence            4556678999999999999998653

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4

Probab=87.89  E-value=0.65  Score=28.70  Aligned_cols=25  Identities=16%  Similarity=0.171  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       258 ~~~~li~~~l~~~p~~Rp~~~eil~  282 (286)
T cd07847         258 PALSFLKGCLQMDPTERLSCEELLE  282 (286)
T ss_pred             HHHHHHHHHhcCCccccCCHHHHhc
Confidence            3567788999999999999987753

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity

Probab=87.85  E-value=0.67  Score=28.12  Aligned_cols=26  Identities=8%  Similarity=-0.031  Sum_probs=21.7

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+.++-..|++.+|.+||++.+++.
T Consensus       231 ~~l~~li~~~l~~~p~~R~~~~~l~~  256 (260)
T PF00069_consen  231 EELRDLIKKMLSKDPEQRPSAEELLK  256 (260)
T ss_dssp             HHHHHHHHHHSSSSGGGSTTHHHHHT
T ss_pred             HHHHHHHHHHccCChhHCcCHHHHhc
Confidence            45666778899999999999998864

Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase

Probab=87.81  E-value=0.72  Score=28.32  Aligned_cols=25  Identities=8%  Similarity=0.153  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       244 ~~~~li~~~l~~~p~~Rpt~~~il~  268 (272)
T cd06637         244 KFQSFIESCLVKNHSQRPTTEQLMK  268 (272)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHhh
Confidence            3556667999999999999988764

Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4

Probab=87.80  E-value=0.78  Score=28.46  Aligned_cols=27  Identities=7%  Similarity=0.001  Sum_probs=22.4

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      ..+..+...|++.+|..||++.+++.-
T Consensus       227 ~~~~~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06640         227 KPFKEFIDACLNKDPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHhC
Confidence            456677889999999999999998554

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5

Probab=87.79  E-value=0.66  Score=28.15  Aligned_cols=24  Identities=17%  Similarity=0.134  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-.+|.+.+|.+||++.+++.
T Consensus       230 ~~~~i~~~l~~~p~~Rpt~~~ll~  253 (257)
T cd08225         230 LRSLISQLFKVSPRDRPSITSILK  253 (257)
T ss_pred             HHHHHHHHhccChhhCcCHHHHhh
Confidence            445557899999999999998864

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3

Probab=87.58  E-value=0.79  Score=28.42  Aligned_cols=26  Identities=8%  Similarity=0.051  Sum_probs=22.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|..||++.+++..
T Consensus       228 ~~~~~i~~~l~~~p~~Rp~~~~~l~~  253 (277)
T cd06641         228 PLKEFVEACLNKEPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHhC
Confidence            35567788999999999999998773

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin

Probab=87.57  E-value=0.59  Score=29.16  Aligned_cols=25  Identities=16%  Similarity=0.274  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|.+.+|.+||++.++..
T Consensus       262 ~l~~li~~~l~~~p~~Rps~~~il~  286 (291)
T cd06639         262 SFNHFISQCLIKDFEARPSVTHLLE  286 (291)
T ss_pred             HHHHHHHHHhhcChhhCcCHHHHhc
Confidence            4566788999999999999988764

Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5

Probab=87.35  E-value=0.6  Score=29.06  Aligned_cols=26  Identities=12%  Similarity=0.347  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+.++...|++.+|..||++.+++..
T Consensus       228 ~~~~li~~~l~~~P~~Rp~~~eil~~  253 (279)
T cd06619         228 KFVHFITQCMRKQPKERPAPENLMDH  253 (279)
T ss_pred             HHHHHHHHHhhCChhhCCCHHHHhcC
Confidence            35567778999999999999887654

Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase

Probab=86.96  E-value=0.66  Score=29.42  Aligned_cols=26  Identities=12%  Similarity=0.164  Sum_probs=21.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      +..+..+|++.+|.+||++.++....
T Consensus       263 ~~~li~~~l~~~P~~Rpt~~~ll~~~  288 (308)
T cd06615         263 FQDFVDKCLKKNPKERADLKELTKHP  288 (308)
T ss_pred             HHHHHHHHccCChhhCcCHHHHhcCh
Confidence            55777899999999999999887653

Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3

Probab=86.61  E-value=1  Score=27.71  Aligned_cols=22  Identities=27%  Similarity=0.235  Sum_probs=17.7

Q ss_pred             HHHhcCcCccCCCCHHHHHHHhh
Q 038421           21 GLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        21 al~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      --.|. .+|.+||++.+++..|.
T Consensus       247 ~~~c~-~~P~~Rpt~~~l~~~l~  268 (269)
T cd05087         247 MQFCW-LQPEQRPSAEEVHLLLS  268 (269)
T ss_pred             HHHHh-cCcccCCCHHHHHHHhc
Confidence            34566 47999999999998875

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like

Probab=86.57  E-value=0.72  Score=28.53  Aligned_cols=23  Identities=9%  Similarity=-0.049  Sum_probs=19.2

Q ss_pred             HHHHHHhcCcCccCCCCHHHHHH
Q 038421           18 IHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        18 ~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .++-..|++.+|.+||++.+++.
T Consensus       259 ~~li~~~l~~dP~~Rpt~~~ll~  281 (285)
T cd07861         259 LDLLEKMLIYDPAKRISAKKALN  281 (285)
T ss_pred             HHHHHHHhcCChhhCCCHHHHhc
Confidence            45667899999999999988764

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3

Probab=86.53  E-value=0.88  Score=27.70  Aligned_cols=25  Identities=16%  Similarity=0.073  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++..
T Consensus       228 ~~~li~~~l~~~P~~Rp~~~~il~~  252 (255)
T cd08219         228 LRSLIKQMFKRNPRSRPSATTILSR  252 (255)
T ss_pred             HHHHHHHHHhCCcccCCCHHHHhhc
Confidence            4455678999999999999988754

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases

Probab=86.48  E-value=0.97  Score=27.86  Aligned_cols=25  Identities=12%  Similarity=0.010  Sum_probs=20.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|..||++.+++.
T Consensus       259 ~~~~li~~~l~~dp~~Rp~~~~il~  283 (287)
T cd07838         259 EGLDLLKKMLTFNPHKRISAFEALQ  283 (287)
T ss_pred             HHHHHHHHHhccCCccCCCHHHHhc
Confidence            3456778899999999999988763

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both

>PLN00009 cyclin-dependent kinase A; Provisional

Probab=86.43  E-value=0.81  Score=28.57  Aligned_cols=25  Identities=4%  Similarity=-0.031  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++...|++.+|.+||++.+++.
T Consensus       259 ~~~~~i~~~l~~~P~~Rps~~~~l~  283 (294)
T PLN00009        259 AGVDLLSKMLRLDPSKRITARAALE  283 (294)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            3556778899999999999998875

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4

Probab=86.41  E-value=0.94  Score=27.57  Aligned_cols=24  Identities=13%  Similarity=0.142  Sum_probs=19.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       237 ~~~li~~~l~~~p~~R~~~~~i~~  260 (264)
T cd06626         237 GKDFLDRCLESDPKKRPTASELLQ  260 (264)
T ss_pred             HHHHHHHHccCCcccCCCHHHHhc
Confidence            345667899999999999988753

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases

Probab=86.39  E-value=0.91  Score=27.93  Aligned_cols=25  Identities=8%  Similarity=0.158  Sum_probs=20.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|..||++.+++.
T Consensus       244 ~~~~li~~~l~~~p~~Rps~~~il~  268 (272)
T cd06629         244 VALDFLNACFTINPDNRPTARELLQ  268 (272)
T ss_pred             HHHHHHHHHhcCChhhCCCHHHHhh
Confidence            4455667899999999999988764

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta

Probab=86.32  E-value=1.4  Score=28.18  Aligned_cols=26  Identities=27%  Similarity=0.337  Sum_probs=22.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       282 ~~~~~li~~~l~~dP~~Rpta~e~l~  307 (328)
T cd08226         282 PAFQNLVELCLQQDPEKRPSASSLLS  307 (328)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHhh
Confidence            45677888999999999999999864

Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5

Probab=86.27  E-value=0.64  Score=28.52  Aligned_cols=26  Identities=4%  Similarity=0.092  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+.++...|++.+|.+||++.+++..
T Consensus       240 ~~~~li~~~l~~~P~~Rp~~~~il~~  265 (267)
T cd06646         240 TFHNFVKISLTKNPKKRPTAERLLTH  265 (267)
T ss_pred             HHHHHHHHHhhCChhhCcCHHHHhcC
Confidence            44566678999999999999988753

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants

Probab=86.26  E-value=0.8  Score=29.48  Aligned_cols=26  Identities=8%  Similarity=-0.027  Sum_probs=22.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|.+||++.+++.-
T Consensus       266 ~~~~li~~~l~~~P~~Rps~~ell~h  291 (337)
T cd07858         266 LAIDLLEKMLVFDPSKRITVEEALAH  291 (337)
T ss_pred             HHHHHHHHHhcCChhhccCHHHHHcC
Confidence            45678889999999999999998655

Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein

Probab=86.18  E-value=0.88  Score=28.69  Aligned_cols=26  Identities=23%  Similarity=0.287  Sum_probs=21.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|.+.+|..||++.+++..
T Consensus       270 ~~~~li~~~l~~~P~~Rpt~~~ll~~  295 (314)
T cd08216         270 HFHQFVELCLQRDPESRPSASQLLNH  295 (314)
T ss_pred             HHHHHHHHHhhcCCCcCcCHHHHhcC
Confidence            45567788999999999999887653

Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases

Probab=86.15  E-value=0.74  Score=27.75  Aligned_cols=25  Identities=12%  Similarity=0.171  Sum_probs=20.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|+..+|++||++.+++.
T Consensus       226 ~~~~~i~~~l~~~p~~R~~~~~~l~  250 (254)
T cd06627         226 ELKDFLMQCFQKDPNLRPTAKQLLK  250 (254)
T ss_pred             HHHHHHHHHHhCChhhCcCHHHHhc
Confidence            4556778899999999999988763

Serine/threonine kinases (STKs), (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases

Probab=86.14  E-value=1.1  Score=27.63  Aligned_cols=25  Identities=16%  Similarity=0.025  Sum_probs=21.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++...|++.+|.+||++.+++.
T Consensus       254 ~~~~~i~~~l~~~P~~Rp~~~~~l~  278 (282)
T cd07829         254 EGIDLLSKMLQYNPAKRISAKEALK  278 (282)
T ss_pred             HHHHHHHHhhccCcccCCCHHHHhh
Confidence            4677888999999999999998864

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase

Probab=86.11  E-value=1  Score=27.43  Aligned_cols=25  Identities=16%  Similarity=0.263  Sum_probs=20.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|..||++.+++.
T Consensus       239 ~~~~li~~~l~~~p~~Rp~~~~ll~  263 (267)
T cd06610         239 SFRKMISLCLQKDPSKRPTAEELLK  263 (267)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHhh
Confidence            4556777899999999999888764

Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9

Probab=86.02  E-value=0.93  Score=27.57  Aligned_cols=26  Identities=15%  Similarity=0.130  Sum_probs=21.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|.+||++.+++..
T Consensus       228 ~~~~~i~~~l~~~p~~R~s~~~ll~~  253 (256)
T cd08221         228 ELISLVHSLLQQDPEKRPTADEVLDQ  253 (256)
T ss_pred             HHHHHHHHHcccCcccCCCHHHHhhC
Confidence            35566678999999999999988764

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase

Probab=85.84  E-value=1.2  Score=27.25  Aligned_cols=24  Identities=17%  Similarity=0.253  Sum_probs=19.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|+..+|.+||++.+++.
T Consensus       233 ~~~li~~~l~~~p~~Rpt~~~ll~  256 (265)
T cd06605         233 FQDFVNLCLIKDPRERPSYKELLE  256 (265)
T ss_pred             HHHHHHHHcCCCchhCcCHHHHhh
Confidence            455667899999999999998864

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase

Probab=85.68  E-value=1.1  Score=27.68  Aligned_cols=26  Identities=8%  Similarity=-0.086  Sum_probs=21.5

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       256 ~~~~~li~~~l~~~p~~R~~~~~~l~  281 (286)
T cd07832         256 PEALDLLKGLLVYDPSKRLSAAEALR  281 (286)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHhh
Confidence            45566778899999999999988764

Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2

Probab=85.62  E-value=1  Score=28.99  Aligned_cols=25  Identities=12%  Similarity=0.195  Sum_probs=21.0

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +.++-..|++.+|.+||++.+++.-
T Consensus       277 l~~li~~~L~~~P~~Rpt~~ell~h  301 (331)
T cd06649         277 FQEFVNKCLIKNPAERADLKMLMNH  301 (331)
T ss_pred             HHHHHHHHccCCcccCCCHHHHhcC
Confidence            4566778999999999999998654

Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha

Probab=85.51  E-value=0.79  Score=29.33  Aligned_cols=25  Identities=28%  Similarity=0.347  Sum_probs=21.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       282 ~~~~li~~~l~~dP~~Rpt~~ell~  306 (327)
T cd08227         282 HFHHFVEQCLQRNPDARPSASTLLN  306 (327)
T ss_pred             HHHHHHHHHHhhCchhcCCHHHHhc
Confidence            4556788999999999999998875

Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases

Probab=85.28  E-value=1.6  Score=27.06  Aligned_cols=30  Identities=17%  Similarity=0.161  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|...+|..||++.++...|...
T Consensus       239 ~~~~~~~~~l~~~p~~Rp~~~~l~~~l~~~  268 (279)
T cd05057         239 DVYMVLVKCWMIDAESRPTFKELINEFSKM  268 (279)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHHH
Confidence            455667789999999999999999998753

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7

Probab=85.20  E-value=1  Score=28.26  Aligned_cols=26  Identities=12%  Similarity=0.166  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+..+|.+.+|..||++.+++..
T Consensus       248 ~l~~li~~~l~~~p~~Rp~~~~il~~  273 (296)
T cd06618         248 DFCSFVDLCLTKDHRKRPKYRELLQH  273 (296)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhcC
Confidence            35666679999999999999888654

Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases

Probab=85.05  E-value=1.2  Score=27.39  Aligned_cols=26  Identities=15%  Similarity=0.176  Sum_probs=21.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|.+.+|.+||++.++...
T Consensus       230 ~~~~~i~~~l~~~p~~R~~~~~il~~  255 (277)
T cd06917         230 LLREFVAACLDEEPKERLSAEELLKS  255 (277)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHhhC
Confidence            45566678999999999999988653

Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9

Probab=85.04  E-value=1  Score=28.17  Aligned_cols=24  Identities=8%  Similarity=-0.047  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +.++...|++.+|.+||++.+++.
T Consensus       283 ~~dli~~~l~~~P~~R~t~~e~l~  306 (310)
T cd07865         283 ALDLIDKLLVLDPAKRIDADTALN  306 (310)
T ss_pred             HHHHHHHHhcCChhhccCHHHHhc
Confidence            456888999999999999988763

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3

Probab=85.03  E-value=1.1  Score=27.71  Aligned_cols=23  Identities=9%  Similarity=-0.024  Sum_probs=19.1

Q ss_pred             HHHHHHhcCcCccCCCCHHHHHH
Q 038421           18 IHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        18 ~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+-..|++.+|.+||++.+++.
T Consensus       258 ~~li~~~l~~~P~~Rpt~~~~l~  280 (284)
T cd07860         258 RDLLSQMLHYDPNKRISAKAALA  280 (284)
T ss_pred             HHHHHHhcCCCcccCCCHHHHhc
Confidence            45667899999999999988763

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15

Probab=84.98  E-value=1.1  Score=28.68  Aligned_cols=26  Identities=4%  Similarity=-0.047  Sum_probs=21.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+.++...|++.+|..||++.+++..
T Consensus       270 ~l~~li~~~l~~~P~~Rps~~~il~~  295 (337)
T cd07852         270 DALDLLKKLLVFNPNKRLTAEEALEH  295 (337)
T ss_pred             HHHHHHHHhccCCcccccCHHHHhhC
Confidence            35667788999999999999998754

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul

>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains

Probab=84.96  E-value=1.3  Score=26.74  Aligned_cols=25  Identities=8%  Similarity=-0.056  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.++..
T Consensus       228 ~~~~li~~~l~~~p~~Rp~~~~~l~  252 (256)
T cd08530         228 DLQNFIRSMLQVKPKLRPNCDKILA  252 (256)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHhc
Confidence            4667778999999999999988764

Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4

Probab=84.92  E-value=1.1  Score=27.89  Aligned_cols=26  Identities=12%  Similarity=0.207  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+.++...|.+.+|.+||++.++...
T Consensus       242 ~l~~li~~~l~~~p~~Rpt~~~i~~~  267 (288)
T cd06616         242 SFVNFINLCLIKDESKRPKYKELLEH  267 (288)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhcC
Confidence            45566779999999999999988653

Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1

Probab=84.77  E-value=1.1  Score=27.05  Aligned_cols=24  Identities=17%  Similarity=0.216  Sum_probs=19.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       231 ~~~li~~~l~~~p~~Rp~~~~~l~  254 (258)
T cd06632         231 AKDFILKCLQRDPSLRPTAAELLE  254 (258)
T ss_pred             HHHHHHHHhhcCcccCcCHHHHhc
Confidence            344567899999999999988764

Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins

Probab=84.60  E-value=1.1  Score=28.23  Aligned_cols=26  Identities=19%  Similarity=0.212  Sum_probs=21.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|.+.+|..||++.+++..
T Consensus       242 ~~~~li~~~l~~~p~~Rp~~~~il~~  267 (307)
T cd06607         242 YFRNFVDSCLQKIPQDRPSSEELLKH  267 (307)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhcC
Confidence            35566679999999999999999764

Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6

Probab=84.48  E-value=1.1  Score=27.83  Aligned_cols=24  Identities=21%  Similarity=0.162  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       263 ~~~li~~~l~~~P~~R~s~~~~l~  286 (290)
T cd07862         263 GKDLLLKCLTFNPAKRISAYSALS  286 (290)
T ss_pred             HHHHHHHHhccCchhcCCHHHHhc
Confidence            346778999999999999988763

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases

Probab=84.46  E-value=0.99  Score=28.99  Aligned_cols=26  Identities=8%  Similarity=0.121  Sum_probs=22.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|.+||++.+++..
T Consensus       267 ~~~~li~~~l~~dP~~Rpt~~e~l~h  292 (336)
T cd07849         267 KALDLLDKMLTFNPHKRITVEEALAH  292 (336)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHhcC
Confidence            35678889999999999999988765

Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases

Probab=84.46  E-value=1.1  Score=27.23  Aligned_cols=25  Identities=8%  Similarity=0.134  Sum_probs=21.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+..+|...+|..||++.+++.
T Consensus       235 ~~~~li~~~l~~~p~~Rpt~~~il~  259 (262)
T cd06613         235 VFHDFIKKCLTKDPKKRPTATKLLQ  259 (262)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHhc
Confidence            4567888999999999999988764

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins

Probab=84.10  E-value=1.2  Score=27.82  Aligned_cols=25  Identities=8%  Similarity=-0.055  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++...|++.+|.+||++.+++.
T Consensus       283 ~~~~~i~~~l~~~p~~R~t~~ell~  307 (311)
T cd07866         283 EGLDLLSKLLSLDPYKRLTASDALE  307 (311)
T ss_pred             hHHHHHHHHcccCcccCcCHHHHhc
Confidence            4567888899999999999887753

Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic

>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase

Probab=84.04  E-value=1.3  Score=26.63  Aligned_cols=25  Identities=16%  Similarity=0.177  Sum_probs=20.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|+..+|..||+..+++.
T Consensus       230 ~~~~~i~~~l~~~p~~Rp~~~~ll~  254 (258)
T cd08215         230 ELRNLVSSLLQKDPEERPSIAQILQ  254 (258)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHhc
Confidence            4556777999999999999988764

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1

Probab=83.40  E-value=1.5  Score=28.25  Aligned_cols=24  Identities=13%  Similarity=0.203  Sum_probs=20.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|.+.+|.+||++.+++.
T Consensus       275 ~~~li~~~L~~~P~~Rpt~~ell~  298 (333)
T cd06650         275 FQDFVNKCLIKNPAERADLKQLMV  298 (333)
T ss_pred             HHHHHHHhccCCcccCcCHHHHhh
Confidence            456778999999999999999853

Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3

Probab=83.25  E-value=1.2  Score=27.35  Aligned_cols=23  Identities=17%  Similarity=0.157  Sum_probs=17.3

Q ss_pred             HHHHHHhcCcCccCCCCHHHHHH
Q 038421           18 IHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        18 ~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ++..+.|...+|.+||++.++..
T Consensus       238 ~~~li~~~~~~p~~Rp~~~eil~  260 (266)
T cd06651         238 ARDFLGCIFVEARHRPSAEELLR  260 (266)
T ss_pred             HHHHHHHhcCChhhCcCHHHHhc
Confidence            33345688889999999988853

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4

Probab=83.15  E-value=1.5  Score=26.80  Aligned_cols=24  Identities=21%  Similarity=0.350  Sum_probs=19.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++..
T Consensus       238 ~~~~i~~~l~~~p~~Rp~~~~~l~  261 (265)
T cd06631         238 AIDFVTSCLTRDQHERPSALQLLR  261 (265)
T ss_pred             HHHHHHHHhcCCcccCCCHHHHhc
Confidence            455667899999999999987753

Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1

Probab=83.04  E-value=1.6  Score=27.79  Aligned_cols=26  Identities=15%  Similarity=0.262  Sum_probs=21.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      +..+...|++.+|.+||++.++...+
T Consensus       253 l~~li~~~l~~~p~~Rpt~~~il~~~  278 (317)
T cd06635         253 FRNFVDSCLQKIPQDRPTSEELLKHM  278 (317)
T ss_pred             HHHHHHHHccCCcccCcCHHHHHhCh
Confidence            45667789999999999999998754

Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12

Probab=83.02  E-value=1.4  Score=27.53  Aligned_cols=25  Identities=4%  Similarity=-0.025  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|.+.+|.+||++.+++.
T Consensus       274 ~~~~li~~~l~~~P~~Rp~~~~il~  298 (302)
T cd07864         274 PALDLLDHMLTLDPSKRCTAEEALN  298 (302)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhc
Confidence            4567778899999999999988764

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase

Probab=82.84  E-value=1.4  Score=28.50  Aligned_cols=25  Identities=8%  Similarity=-0.028  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.++..
T Consensus       273 ~l~dli~~~l~~~P~~Rpt~~ell~  297 (343)
T cd07851         273 LAIDLLEKMLVLDPDKRITAAEALA  297 (343)
T ss_pred             HHHHHHHHhCCCChhhCCCHHHHhc
Confidence            4567778899999999999998754

Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK

>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase

Probab=82.68  E-value=1.1  Score=27.87  Aligned_cols=29  Identities=3%  Similarity=-0.111  Sum_probs=23.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|++.+|..||++.+|...|+..
T Consensus       239 l~~li~~~l~~~p~~R~t~~~~~~~l~~~  267 (288)
T cd05583         239 ARDFIQKLLEKDPKKRLGANGADEIKNHP  267 (288)
T ss_pred             HHHHHHHHhcCCHhhccCcchHHHHhcCc
Confidence            34566789999999999999998888753

Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases

Probab=82.64  E-value=2.1  Score=26.26  Aligned_cols=23  Identities=22%  Similarity=0.258  Sum_probs=18.0

Q ss_pred             HHHHhcCcCccCCCCHHHHHHHhh
Q 038421           20 VGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        20 val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      +-..|. .+|.+||++.+|.+.|.
T Consensus       246 ~~~~~~-~dp~~Rpt~~~v~~~l~  268 (269)
T cd05042         246 VMQFCW-LDPETRPTAEEVHELLT  268 (269)
T ss_pred             HHHHHh-cCcccccCHHHHHHHhc
Confidence            444565 49999999999998874

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina

>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11

Probab=82.51  E-value=1.8  Score=26.37  Aligned_cols=25  Identities=8%  Similarity=0.002  Sum_probs=19.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.++..
T Consensus       232 ~~~~li~~~l~~~p~~Rp~~~~il~  256 (260)
T cd08222         232 QLNSIMQSMLNKDPSLRPSAAEILR  256 (260)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhh
Confidence            3455667899999999999988764

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins

Probab=82.43  E-value=2  Score=26.10  Aligned_cols=26  Identities=15%  Similarity=0.188  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|+..+|..||++.+++..
T Consensus       231 ~l~~li~~~l~~~p~~R~~~~~ll~~  256 (264)
T cd06623         231 EFRDFISACLQKDPKKRPSAAELLQH  256 (264)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHhC
Confidence            45566677999999999999988763

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases

Probab=82.38  E-value=1.5  Score=27.23  Aligned_cols=25  Identities=16%  Similarity=0.097  Sum_probs=20.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+.++...|++.+|.+||++.+++.
T Consensus       263 ~~~~li~~~L~~~p~~Rps~~e~l~  287 (291)
T cd07844         263 HGEELALKFLQYEPKKRISAAEAMK  287 (291)
T ss_pred             hHHHHHHHHhccCcccccCHHHHhc
Confidence            4456778899999999999988753

Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3

Probab=82.34  E-value=1.5  Score=28.35  Aligned_cols=26  Identities=8%  Similarity=-0.044  Sum_probs=21.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|++.+|.+||++.+++.-
T Consensus       286 ~~~~li~~mL~~dP~~Rps~~ell~h  311 (355)
T cd07874         286 QARDLLSKMLVIDPAKRISVDEALQH  311 (355)
T ss_pred             HHHHHHHHHhcCCchhcCCHHHHhcC
Confidence            34567789999999999999998764

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1

Probab=82.03  E-value=1.8  Score=27.04  Aligned_cols=24  Identities=8%  Similarity=-0.097  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|++||++.+++.
T Consensus       266 ~~~li~~~l~~~p~~R~t~~ell~  289 (293)
T cd07843         266 GFDLLNRLLTYDPAKRISAEDALK  289 (293)
T ss_pred             HHHHHHHHhccCccccCCHHHHhc
Confidence            445667899999999999988764

Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5

Probab=82.01  E-value=1.6  Score=27.06  Aligned_cols=25  Identities=8%  Similarity=-0.149  Sum_probs=20.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       256 ~~~~li~~~l~~~P~~R~t~~~il~  280 (284)
T cd07839         256 TGRDLLQNLLVCNPVQRISAEEALQ  280 (284)
T ss_pred             HHHHHHHHHhcCChhhcCCHHHHhc
Confidence            3446678899999999999988754

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase

Probab=81.92  E-value=1.6  Score=27.14  Aligned_cols=24  Identities=8%  Similarity=0.004  Sum_probs=19.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       267 ~~~~i~~~l~~~P~~R~~~~eil~  290 (295)
T cd07837         267 GLDLLQKMLRYDPAKRISAKAALT  290 (295)
T ss_pred             HHHHHHHHccCChhhcCCHHHHhc
Confidence            455668899999999999987753

Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants

Probab=81.07  E-value=1.9  Score=27.46  Aligned_cols=25  Identities=8%  Similarity=0.003  Sum_probs=20.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       266 ~~~li~~~l~~~P~~Rpt~~e~l~h  290 (338)
T cd07859         266 ALRLLERLLAFDPKDRPTAEEALAD  290 (338)
T ss_pred             HHHHHHHHcCcCcccCCCHHHHhcC
Confidence            3567788999999999999988753

Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases

Probab=81.04  E-value=1.7  Score=26.88  Aligned_cols=24  Identities=13%  Similarity=0.185  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+...|.+.+|.+||++.+++.
T Consensus       238 ~~~li~~~l~~~p~~Rps~~~il~  261 (280)
T cd06611         238 FNDFLKSCLVKDPDDRPTAAELLK  261 (280)
T ss_pred             HHHHHHHHhccChhhCcCHHHHhc
Confidence            445667899999999999988854

Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85

Probab=80.85  E-value=1.9  Score=26.59  Aligned_cols=24  Identities=17%  Similarity=-0.035  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +.++-..|++.+|.+||++.+++.
T Consensus       257 ~~~~i~~~l~~~p~~R~~~~~~l~  280 (284)
T cd07836         257 GIDLLHRLLQLNPELRISAHDALQ  280 (284)
T ss_pred             HHHHHHHHhcCCcccCCCHHHHhc
Confidence            345667899999999999988763

Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment.

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases

Probab=80.57  E-value=2.4  Score=25.89  Aligned_cols=24  Identities=8%  Similarity=0.039  Sum_probs=18.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|.+.+|.+||++.++..
T Consensus       240 ~~~li~~~l~~~p~~Rp~~~~il~  263 (267)
T cd06628         240 AIDFLEKTFEIDHNKRPTAAELLK  263 (267)
T ss_pred             HHHHHHHHccCCchhCcCHHHHhh
Confidence            344556899999999999888764

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase

Probab=80.34  E-value=2.1  Score=27.66  Aligned_cols=24  Identities=8%  Similarity=0.093  Sum_probs=20.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       273 ~~~li~~~l~~dP~~R~~~~e~l~  296 (342)
T cd07879         273 AVDLLEKMLELDVDKRLTATEALE  296 (342)
T ss_pred             HHHHHHHHcCCChhhCcCHHHHhc
Confidence            557778899999999999999873

Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5

Probab=80.31  E-value=2.2  Score=27.34  Aligned_cols=26  Identities=8%  Similarity=0.085  Sum_probs=21.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|++.+|.+||++.+++..
T Consensus       269 ~~~~li~~~l~~~P~~Rpt~~~~l~~  294 (334)
T cd07855         269 EALDLLSQMLQFDPEERITVEQALQH  294 (334)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHhC
Confidence            45667788999999999999987764

Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase

Probab=80.22  E-value=1.9  Score=26.76  Aligned_cols=24  Identities=13%  Similarity=0.218  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +.++-..|.+.+|.+||++.+++.
T Consensus       238 ~~~li~~~l~~~p~~Rp~~~~il~  261 (282)
T cd06643         238 FKDFLKKCLEKNVDARWTTTQLLQ  261 (282)
T ss_pred             HHHHHHHHccCChhhCcCHHHHhc
Confidence            455667899999999999987754

Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1

Probab=80.06  E-value=2.3  Score=27.27  Aligned_cols=24  Identities=8%  Similarity=-0.025  Sum_probs=20.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      .+..+...|++.+|..||++.+++
T Consensus       267 ~~~~li~~~l~~~P~~R~t~~~ll  290 (332)
T cd07857         267 LALDLLEKLLAFDPTKRISVEEAL  290 (332)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHh
Confidence            456778889999999999998864

Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1

Probab=80.03  E-value=2.2  Score=26.91  Aligned_cols=25  Identities=16%  Similarity=0.155  Sum_probs=20.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|...+|..||++.+++..
T Consensus       246 l~~li~~~l~~~p~~Rpt~~eil~~  270 (296)
T cd06654         246 FRDFLNRCLDMDVEKRGSAKELLQH  270 (296)
T ss_pred             HHHHHHHHCcCCcccCcCHHHHhhC
Confidence            4556678999999999999988763

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	73
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	8e-08
3uim_A	326	Brassinosteroid insensitive 1-associated receptor;	8e-07

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307

 Score = 46.0 bits (110), Expect = 8e-08
 Identities = 9/47 (19%), Positives = 17/47 (36%), Gaps = 1/47 (2%)

Query: 1   MDPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSEIV 47
           +D  + ++D    +     V   C+ E  + R  I  V  +L     
Sbjct: 261 IDKKMNDADST-SVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA 306

>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326

 Score = 43.3 bits (103), Expect = 8e-07
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 2   DPVLLESDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSE 45
           D  L  +  + E+ + I V LLC Q    +R  +S V+ ML  +
Sbjct: 266 DVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGD 309

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	73
3uim_A	326	Brassinosteroid insensitive 1-associated receptor;	97.29
2qkw_B	321	Protein kinase; three-helix bundle motif, AVRPTO-P	96.87
3omv_A	307	RAF proto-oncogene serine/threonine-protein kinas;	96.6
3hmm_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	96.58
4gt4_A	308	Tyrosine-protein kinase transmembrane receptor RO;	96.29
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	96.12
4aoj_A	329	High affinity nerve growth factor receptor; transf	96.11
3lxl_A	327	Tyrosine-protein kinase JAK3; TYK2, inflammation,	95.99
4asz_A	299	BDNF/NT-3 growth factors receptor; transferase, TR	95.77
3gxj_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	95.67
2eva_A	307	TAK1 kinase - TAB1 chimera fusion protein; transfe	95.33
3soc_A	322	Activin receptor type-2A; structural genomics cons	95.31
3q4u_A	301	Activin receptor type-1; structural genomics conso	95.3
1b6c_B	342	TGF-B superfamily receptor type I; complex (isomer	95.29
4ase_A	353	Vascular endothelial growth factor receptor 2; tra	94.97
3mdy_A	337	Bone morphogenetic protein receptor type-1B; compl	94.91
3lb7_A	307	RAF proto-oncogene serine/threonine-protein kinas;	94.91
3poz_A	327	Epidermal growth factor receptor; kinase domain, a	94.82
3ugc_A	295	Tyrosine-protein kinase JAK2; small molecule inhib	94.79
3dtc_A	271	Mitogen-activated protein kinase kinase kinase 9;	94.75
2qol_A	373	Ephrin receptor; receptor tyrosine kinase, juxtame	94.74
3uzp_A	296	CKI-delta, CKID, casein kinase I isoform delta; CK	94.46
3lxp_A	318	Non-receptor tyrosine-protein kinase TYK2; JAK3, i	94.45
3kul_A	325	Ephrin type-A receptor 8; ATP-binding, kinase, nuc	94.44
3g2f_A	336	Bone morphogenetic protein receptor type-2; kinase	94.41
4hgt_A	296	Casein kinase I isoform delta; CK1D, inhibitor, tr	94.32
3s95_A	310	LIMK-1, LIM domain kinase 1; structural genomics,	94.3
2w1i_A	326	JAK2; chromosomal rearrangement, nucleotide-bindin	94.29
2y4i_B	319	KSR2, HKSR2, kinase suppressor of RAS 2; transfera	94.27
2buj_A	317	Serine/threonine-protein kinase 16; transferase, A	94.26
3sxs_A	268	Cytoplasmic tyrosine-protein kinase BMX; transfera	94.25
1fmk_A	452	C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros	94.18
4f0f_A	287	Serine/threonine-protein kinase ROCO4; LRRK2, ATP-	94.17
3t9t_A	267	Tyrosine-protein kinase ITK/TSK; kinase domain, al	94.17
3og7_A	289	AKAP9-BRAF fusion protein; proto-oncogene, V600E,	94.16
3vhe_A	359	Vascular endothelial growth factor receptor 2; kin	94.11
1xbb_A	291	Tyrosine-protein kinase SYK; gleevec, STI-571, ima	94.08
1qpc_A	279	LCK kinase; alpha beta fold, transferase; HET: PTR	94.05
2i1m_A	333	Macrophage colony-stimulating factor 1 receptor; k	94.01
1csn_A	298	Casein kinase-1; phosphotransferase; HET: ATP; 2.0	94.0
1mqb_A	333	Ephrin type-A receptor 2; tyrosine protein kinase,	93.98
1t46_A	313	HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom	93.97
4hcu_A	269	Tyrosine-protein kinase ITK/TSK; transferase-trans	93.97
4e5w_A	302	Tyrosine-protein kinase JAK1; kinase domain, trans	93.96
3kmu_A	271	ILK, integrin-linked kinase; cell adhesion, ANK re	93.91
3f66_A	298	Hepatocyte growth factor receptor; C-Met, protein	93.86
2wqm_A	310	Serine/threonine-protein kinase NEK7; ATP-binding,	93.83
1u46_A	291	ACK-1, activated CDC42 kinase 1; tyrosine kinase,	93.82
2v62_A	345	Serine/threonine-protein kinase VRK2; transferase,	93.81
2ivs_A	314	Proto-oncogene tyrosine-protein kinase receptor RE	93.75
3tt0_A	382	Basic fibroblast growth factor receptor 1; kinase	93.71
3cc6_A	281	Protein tyrosine kinase 2 beta; focal adhesion kin	93.65
1qcf_A	454	Haematopoetic cell kinase (HCK); tyrosine kinase-i	93.62
1byg_A	278	CSK, protein (C-terminal SRC kinase); protein kina	93.6
3cbl_A	377	C-FES, proto-oncogene tyrosine-protein kinase FES/	93.59
3kfa_A	288	Tyrosine-protein kinase ABL1; CML, drug resistance	93.57
3gen_A	283	Tyrosine-protein kinase BTK; bruton'S tyrosine kin	93.54
3pls_A	298	Macrophage-stimulating protein receptor; protein k	93.5
2xir_A	316	Vascular endothelial growth factor receptor 2; ang	93.46
2jii_A	352	Serine/threonine-protein kinase VRK3 molecule: VA	93.44
1mp8_A	281	Focal adhesion kinase 1; tyrosine protein kinase,	93.42
1opk_A	495	P150, C-ABL, proto-oncogene tyrosine-protein kinas	93.33
3l9p_A	367	Anaplastic lymphoma kinase; kinase domain, ATP-bin	93.26
1luf_A	343	Muscle-specific tyrosine kinase receptor MUSK; pho	93.24
3p86_A	309	Serine/threonine-protein kinase CTR1; ETR1, ERS1,	93.23
4fvq_A	289	Tyrosine-protein kinase JAK2; janus protein kinase	93.22
2pvf_A	334	Fibroblast growth factor receptor 2; kinase domain	93.05
3lzb_A	327	Epidermal growth factor receptor; epidermal growth	93.01
3qup_A	323	Tyrosine-protein kinase receptor TYRO3; protein ki	92.96
3brb_A	313	Proto-oncogene tyrosine-protein kinase MER; ATP-bi	92.95
1p4o_A	322	Insulin-like growth factor I receptor protein; IGF	92.91
2yfx_A	327	Tyrosine-protein kinase receptor; nucleotide-bindi	92.91
1rjb_A	344	FL cytokine receptor; kinase, structure, autoinhib	92.89
2a19_B	284	Interferon-induced, double-stranded RNA-activated	92.75
2psq_A	370	Fibroblast growth factor receptor 2; kinase domain	92.6
3c1x_A	373	Hepatocyte growth factor receptor; receptor tyrosi	92.54
1u59_A	287	Tyrosine-protein kinase ZAP-70; transferase; HET:	92.45
3kex_A	325	Receptor tyrosine-protein kinase ERBB-3; kinase do	92.32
2h8h_A	535	Proto-oncogene tyrosine-protein kinase SRC; SRC ki	92.27
3op5_A	364	Serine/threonine-protein kinase VRK1; adenosine tr	92.17
1fvr_A	327	Tyrosine-protein kinase TIE-2; tyrosine kinase, tr	92.09
3ll6_A	337	Cyclin G-associated kinase; transferase, protein k	91.52
1k9a_A	450	Carboxyl-terminal SRC kinase; COOH-terminal SRC ki	91.44
3sv0_A	483	Casein kinase I-like; typical kinase domain fold,	91.06
2ozo_A	613	Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t	91.04
4fl3_A	635	Tyrosine-protein kinase SYK; transferase; HET: ANP	90.32
2izr_A	330	Casein kinase I isoform gamma-3; serine/threonine-	90.28
2w5a_A	279	Serine/threonine-protein kinase NEK2; Ser/Thr prot	89.48
4agu_A	311	Cyclin-dependent kinase-like 1; transferase, phosp	89.27
1zy4_A	303	Serine/threonine-protein kinase GCN2; translation	89.22
3is5_A	285	Calcium-dependent protein kinase; CDPK, structural	89.03
1x8b_A	289	WEE1HU, WEE1-like protein kinase; cell cycle, tran	88.99
2h6d_A	276	5'-AMP-activated protein kinase catalytic subunit	88.98
3dbq_A	343	Dual specificity protein kinase TTK; MPS1 structur	88.8
3p1a_A	311	MYT1 kinase, membrane-associated tyrosine- and thr	88.78
3fme_A	290	Dual specificity mitogen-activated protein kinase;	88.58
1wak_A	397	Serine/threonine-protein kinase SPRK1; SRPK, trans	88.45
2vwi_A	303	Serine/threonine-protein kinase OSR1; STE kinase,	88.33
3cek_A	313	Dual specificity protein kinase TTK; HMPS1, PYT, E	88.04
2j0j_A	656	Focal adhesion kinase 1; cell migration, FERM, tra	87.94
2iwi_A	312	Serine/threonine-protein kinase PIM-2; nucleotide-	87.92
1z57_A	339	Dual specificity protein kinase CLK1; protein tyro	87.86
1t4h_A	290	Serine/threonine-protein kinase WNK1; protein seri	87.83
3aln_A	327	Dual specificity mitogen-activated protein kinase;	87.78
2zmd_A	390	Dual specificity protein kinase TTK; MPS1, T686A,	87.55
2clq_A	295	Mitogen-activated protein kinase kinase kinase 5;	87.33
3fdn_A	279	Serine/threonine-protein kinase 6; aurora kinase i	87.31
3a99_A	320	Proto-oncogene serine/threonine-protein kinase PI;	87.26
2wtk_C	305	Serine/threonine-protein kinase 11; transferase-me	87.11
2ac3_A	316	MAP kinase-interacting serine/threonine kinase 2;	87.01
3llt_A	360	Serine/threonine kinase-1, pflammer; lammer kinase	86.94
2dyl_A	318	Dual specificity mitogen-activated protein kinase	86.89
3bhy_A	283	Death-associated protein kinase 3; death associate	86.84
2h34_A	309	Serine/threonine-protein kinase PKNE; apoenzyme, t	86.82
3an0_A	340	Dual specificity mitogen-activated protein kinase;	86.65
2eue_A	275	Carbon catabolite derepressing protein kinase; kin	86.59
3m2w_A	299	MAP kinase-activated protein kinase 2; small molec	86.36
3cok_A	278	Serine/threonine-protein kinase PLK4; POLO-like ki	86.33
2eu9_A	355	Dual specificity protein kinase CLK3; kinase domai	86.32
3a7i_A	303	MST3 kinase, serine/threonine kinase 24 (STE20 hom	86.18
3qd2_B	332	Eukaryotic translation initiation factor 2-alpha;	86.17
2vx3_A	382	Dual specificity tyrosine-phosphorylation- regula	86.11
2wei_A	287	Calmodulin-domain protein kinase 1, putative; nucl	85.92
3kk8_A	284	Calcium/calmodulin dependent protein kinase II; AT	85.9
3g33_A	308	Cell division protein kinase 4; Ser/Thr protein ki	85.86
1q8y_A	373	SR protein kinase; transferase; HET: ADP ADE; 2.05	85.83
2c30_A	321	Serine/threonine-protein kinase PAK 6; CRIB domain	85.66
3byv_A	377	Rhoptry kinase; malaria, transferase, structural g	85.59
1ob3_A	288	PFPK5, cell division control protein 2 homolog; tr	85.47
3fhr_A	336	MAP kinase-activated protein kinase 3; kinase-inhi	85.34
2j7t_A	302	Serine/threonine-protein kinase 10; transferase, A	85.33
2yex_A	276	Serine/threonine-protein kinase CHK1; transferase,	85.16
4aaa_A	331	Cyclin-dependent kinase-like 2; transferase, phosp	85.13
2zv2_A	298	Calcium/calmodulin-dependent protein kinase kinas;	85.02
3eqc_A	360	Dual specificity mitogen-activated protein kinase;	84.81
2b9h_A	353	MAP kinase FUS3, mitogen-activated protein kinase	84.74
3dls_A	335	PAS domain-containing serine/threonine-protein KI;	84.63
2y0a_A	326	Death-associated protein kinase 1; transferase, ca	84.58
2r3i_A	299	Cell division protein kinase 2; serine/threonine-p	84.51
2i6l_A	320	Mitogen-activated protein kinase 6; MAPK6, ERK3, e	84.47
2ycf_A	322	Serine/threonine-protein kinase CHK2; transferase,	84.31
3fxz_A	297	Serine/threonine-protein kinase PAK 1; transferase	84.18
1blx_A	326	Cyclin-dependent kinase 6; inhibitor protein, cycl	84.18
3gbz_A	329	Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-	84.1
3niz_A	311	Rhodanese family protein; structural genomics, str	84.06
3e3p_A	360	Protein kinase, putative glycogen synthase kinase;	83.75
3hko_A	345	Calcium/calmodulin-dependent protein kinase with d	83.74
3o0g_A	292	Cell division protein kinase 5; kinase activator c	83.56
3nsz_A	330	CK II alpha, casein kinase II subunit alpha; inhib	83.49
3kvw_A	429	DYRK2, dual specificity tyrosine-phosphorylation-r	83.37
2pml_X	348	PFPK7, Ser/Thr protein kinase; phosphorylati trans	83.37
2rio_A	434	Serine/threonine-protein kinase/endoribonuclease I	83.32
4g3f_A	336	NF-kappa-beta-inducing kinase; non-RD kinase, prot	83.2
3com_A	314	Serine/threonine-protein kinase 4; MST1, STE20-lik	83.05
3fpq_A	290	Serine/threonine-protein kinase WNK1; protein seri	82.91
3lm5_A	327	Serine/threonine-protein kinase 17B; STK17B, serin	82.74
1phk_A	298	Phosphorylase kinase; glycogen metabolism, transfe	82.73
2a2a_A	321	Death-associated protein kinase 2; autoinhibition,	82.56
3f3z_A	277	Calcium/calmodulin-dependent protein kinase with d	82.52
2vgo_A	284	Serine/threonine-protein kinase 12-A; nucleotide-b	82.39
2y7j_A	365	Phosphorylase B kinase gamma catalytic chain, test	82.33
3gni_B	389	Strad alpha; kinase fold, pseudokinase, alpha heli	82.3
2x7f_A	326	TRAF2 and NCK-interacting protein kinase; serine/t	82.27
3pg1_A	362	Mitogen-activated protein kinase, putative (MAP K	81.68
3uqc_A	286	Probable conserved transmembrane protein; structur	81.65
1u5q_A	348	Serine/threonine protein kinase TAO2; transferase;	81.31
1ua2_A	346	CAK, cell division protein kinase 7; cell cycle, p	81.25
1tki_A	321	Titin; serine kinase, muscle, autoinhibition; 2.00	81.22
3i6u_A	419	CDS1, serine/threonine-protein kinase CHK2; Ser/Th	81.02
2jam_A	304	Calcium/calmodulin-dependent protein kinase type 1	81.0
3qyz_A	364	Mitogen-activated protein kinase 1; transferase, s	80.93
3tki_A	323	Serine/threonine-protein kinase CHK1; cell checkpo	80.71
3mi9_A	351	Cell division protein kinase 9; P-TEFB, HIV-1, pro	80.67
3q60_A	371	ROP5B; pseudokinase, transferase; HET: ATP; 1.72A	80.64
3mtl_A	324	Cell division protein kinase 16; pctaire1, indirub	80.17

>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A*

Probab=97.29  E-value=0.00058  Score=42.37  Aligned_cols=38  Identities=32%  Similarity=0.487  Sum_probs=33.5

Q ss_pred             CCcHHHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421            8 SDFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus         8 ~~~~~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.......+.++...|++.+|.+||++.++++.|++.
T Consensus       272 ~~~~~~~~~l~~li~~cl~~dP~~Rps~~ell~~L~~~  309 (326)
T 3uim_A          272 NYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGD  309 (326)
T ss_dssp             SCCHHHHHHHHHHHHHHTCSCGGGSCCHHHHHHHHHTS
T ss_pred             ccCHHHHHHHHHHHHHHhCcCCccCCCHHHHHHHhcCc
Confidence            44566778899999999999999999999999999875

>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A*

Probab=96.87  E-value=0.0024  Score=39.59  Aligned_cols=37  Identities=16%  Similarity=0.136  Sum_probs=31.4

Q ss_pred             CcHHHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421            9 DFELEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus         9 ~~~~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ...+....+..+...|++.+|.+||++.+++..|+..
T Consensus       277 ~~~~~~~~l~~li~~~l~~dP~~Rps~~ell~~L~~~  313 (321)
T 2qkw_B          277 IRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYA  313 (321)
T ss_dssp             SCHHHHHHHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             cCHHHHHHHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            3456667788889999999999999999999999753

>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens}

Probab=96.60  E-value=0.0019  Score=40.98  Aligned_cols=35  Identities=17%  Similarity=0.245  Sum_probs=27.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcCCCCCC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSEIVDLP   50 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~~~~~~   50 (73)
                      .+.++...|.+.+|.+||++.+|+..|+..+..++
T Consensus       269 ~l~~li~~cl~~dP~~RPs~~ei~~~Le~l~~~lp  303 (307)
T 3omv_A          269 AMKRLVADCVKKVKEERPLFPQILSSIELLQHSLP  303 (307)
T ss_dssp             HHHHHHHHHTCSSSTTSCCHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHHhccCC
Confidence            45567789999999999999999998875433333

>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A*

Probab=96.58  E-value=0.0023  Score=40.23  Aligned_cols=33  Identities=12%  Similarity=-0.003  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           12 LEILRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        12 ~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +....+.++...|.+.+|.+||++.+|++.|+.
T Consensus       262 ~~~~~l~~li~~cl~~dP~~RPt~~ei~~~L~~  294 (303)
T 3hmm_A          262 EALRVMAKIMRECWYANGAARLTALRIKKTLSQ  294 (303)
T ss_dssp             HHHHHHHHHHHTTCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            345567788999999999999999999999865

>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A

Probab=96.29  E-value=0.0041  Score=39.36  Aligned_cols=29  Identities=17%  Similarity=0.271  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.+|+..|+.
T Consensus       275 ~~~~li~~C~~~dP~~RPs~~ei~~~L~a  303 (308)
T 4gt4_A          275 WVYALMIECWNEFPSRRPRFKDIHSRLRA  303 (308)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            45677889999999999999999999975

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A*

Probab=96.12  E-value=0.016  Score=35.43  Aligned_cols=35  Identities=20%  Similarity=0.285  Sum_probs=29.4

Q ss_pred             HHHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           11 ELEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        11 ~~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ......+..+...|++.+|.+||++.+++..|+..
T Consensus       270 ~~~~~~l~~li~~cl~~~p~~Rps~~~l~~~L~~l  304 (307)
T 2nru_A          270 STSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEM  304 (307)
T ss_dssp             HHHHHHHHHHHHHHTCSSTTTSCCHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            34455677888999999999999999999999753

>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens}

Probab=96.11  E-value=0.0063  Score=38.84  Aligned_cols=30  Identities=23%  Similarity=0.166  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+|+..|+..
T Consensus       288 ~~~~li~~cl~~dP~~RPs~~ei~~~L~~l  317 (329)
T 4aoj_A          288 EVYAIMRGCWQREPQQRHSIKDVHARLQAL  317 (329)
T ss_dssp             HHHHHHHHHCCSSTTTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCcChhHCcCHHHHHHHHHHH
Confidence            356677899999999999999999999864

>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A*

Probab=95.99  E-value=0.007  Score=37.59  Aligned_cols=30  Identities=23%  Similarity=0.193  Sum_probs=26.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|++.+|.+||++.++++.|+..
T Consensus       272 ~l~~li~~~l~~dP~~Rps~~ell~~L~~~  301 (327)
T 3lxl_A          272 EVHELMKLCWAPSPQDRPSFSALGPQLDML  301 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHC
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            456777889999999999999999999865

>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A*

Probab=95.77  E-value=0.0099  Score=37.44  Aligned_cols=30  Identities=23%  Similarity=0.270  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|.+.+|.+||++.+++..|+..
T Consensus       258 ~~~~li~~cl~~dP~~RPs~~~i~~~L~~~  287 (299)
T 4asz_A          258 EVYELMLGCWQREPHMRKNIKGIHTLLQNL  287 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            456677899999999999999999998753

>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens}

Probab=95.33  E-value=0.031  Score=34.50  Aligned_cols=30  Identities=10%  Similarity=0.182  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       232 ~l~~li~~~l~~dp~~Rps~~ell~~L~~~  261 (307)
T 2eva_A          232 PIESLMTRCWSKDPSQRPSMEEIVKIMTHL  261 (307)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHHH
Confidence            345677889999999999999999998754

>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A*

Probab=95.31  E-value=0.023  Score=35.26  Aligned_cols=31  Identities=13%  Similarity=0.020  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           14 ILRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        14 ~~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ...+..+...|++.+|.+||++.++++.|+.
T Consensus       285 ~~~l~~li~~cl~~dP~~Rps~~ell~~L~~  315 (322)
T 3soc_A          285 MAMLCETIEECWDHDAEARLSAGCVGERITQ  315 (322)
T ss_dssp             HHHHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            3447788899999999999999999999875

>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A*

Probab=95.30  E-value=0.025  Score=34.39  Aligned_cols=31  Identities=10%  Similarity=0.069  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           14 ILRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        14 ~~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ...+.++...|++.+|.+||++.++++.|+.
T Consensus       269 ~~~l~~li~~cl~~dP~~Rps~~~i~~~L~~  299 (301)
T 3q4u_A          269 LTSLAKLMKECWYQNPSARLTALRIKKTLTK  299 (301)
T ss_dssp             HHHHHHHHHHHCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhcChhhCCCHHHHHHHHhc
Confidence            3557788899999999999999999999874

>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A*

Probab=95.29  E-value=0.024  Score=35.08  Aligned_cols=34  Identities=12%  Similarity=-0.030  Sum_probs=28.9

Q ss_pred             HHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           12 LEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        12 ~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +....+.++...|++.+|.+||++.+++..|+..
T Consensus       301 ~~~~~l~~li~~cl~~dp~~Rps~~~i~~~L~~i  334 (342)
T 1b6c_B          301 EALRVMAKIMRECWYANGAARLTALRIKKTLSQL  334 (342)
T ss_dssp             HHHHHHHHHHHHHCCSSGGGSCCHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHhccChhhCCCHHHHHHHHHHH
Confidence            3445677888999999999999999999999753

>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A*

Probab=94.97  E-value=0.023  Score=36.59  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       316 ~~~~li~~c~~~dP~~RPt~~eil~~L~~  344 (353)
T 4ase_A          316 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  344 (353)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCcChhHCcCHHHHHHHHHH
Confidence            34566678999999999999999998864

>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7

Probab=94.91  E-value=0.036  Score=34.15  Aligned_cols=34  Identities=12%  Similarity=-0.025  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           12 LEILRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        12 ~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +....+.++...|++.+|.+||++.++++.|+..
T Consensus       296 ~~~~~l~~li~~~l~~dP~~Rps~~ell~~L~~l  329 (337)
T 3mdy_A          296 ECLRQMGKLMTECWAHNPASRLTALRVKKTLAKM  329 (337)
T ss_dssp             HHHHHHHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhhhChhhCCCHHHHHHHHHHH
Confidence            3445577888999999999999999999999753

>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ...

Probab=94.82  E-value=0.028  Score=35.02  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       247 ~~~~li~~~l~~~p~~Rps~~ell~~l~~  275 (327)
T 3poz_A          247 DVYMIMVKCWMIDADSRPKFRELIIEFSK  275 (327)
T ss_dssp             HHHHHHHHHTCSCGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHH
Confidence            46677889999999999999999998864

>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ...

Probab=94.79  E-value=0.032  Score=33.95  Aligned_cols=30  Identities=13%  Similarity=0.140  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       260 ~l~~li~~~l~~dp~~Rps~~el~~~L~~l  289 (295)
T 3ugc_A          260 EIYMIMTECWNNNVNQRPSFRDLALRVDQI  289 (295)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHHH
Confidence            456677899999999999999999998753

>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0

Probab=94.75  E-value=0.035  Score=33.24  Aligned_cols=29  Identities=17%  Similarity=0.268  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.++++.|+.
T Consensus       242 ~~~~li~~~l~~~p~~Rps~~e~l~~L~~  270 (271)
T 3dtc_A          242 PFAKLMEDCWNPDPHSRPSFTNILDQLTT  270 (271)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHC
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHHHHHhc
Confidence            35667788999999999999999999874

>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ...

Probab=94.74  E-value=0.032  Score=35.65  Aligned_cols=29  Identities=21%  Similarity=0.345  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.+++..|+.
T Consensus       278 ~l~~li~~cl~~dp~~RPs~~~i~~~L~~  306 (373)
T 2qol_A          278 ALYQLMLDCWQKDRNNRPKFEQIVSILDK  306 (373)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhCcChhhCcCHHHHHHHHHH
Confidence            46677889999999999999999999864

>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A

Probab=94.46  E-value=0.05  Score=32.90  Aligned_cols=29  Identities=10%  Similarity=0.123  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       249 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~  277 (296)
T 3uzp_A          249 EFATYLNFCRSLRFDDKPDYSYLRQLFRN  277 (296)
T ss_dssp             HHHHHHHHHHTSCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCcCcCCCHHHHHHHHHH
Confidence            45677789999999999999999999975

>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A*

Probab=94.45  E-value=0.042  Score=33.97  Aligned_cols=30  Identities=17%  Similarity=0.254  Sum_probs=25.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|++.+|.+||++.+++..|+..
T Consensus       279 ~l~~li~~~l~~dP~~Rps~~ell~~L~~l  308 (318)
T 3lxp_A          279 EVYHLMKNCWETEASFRPTFENLIPILKTV  308 (318)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHH
Confidence            456677899999999999999999998753

>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens}

Probab=94.44  E-value=0.042  Score=34.23  Aligned_cols=30  Identities=20%  Similarity=0.253  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       282 ~l~~li~~~l~~dp~~Rps~~eil~~L~~l  311 (325)
T 3kul_A          282 ALHQLMLDCWHKDRAQRPRFSQIVSVLDAL  311 (325)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            456677899999999999999999999764

>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens}

Probab=94.41  E-value=0.057  Score=33.37  Aligned_cols=31  Identities=6%  Similarity=-0.105  Sum_probs=27.1

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      ..+..+...|++.+|.+||++.++++.|+..
T Consensus       286 ~~l~~li~~cl~~dP~~Rps~~e~l~~L~~l  316 (336)
T 3g2f_A          286 RSLKETIEDCWDQDAEARLTAQXAEERMAEL  316 (336)
T ss_dssp             HHHHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCChhhCcchHHHHHHHHHH
Confidence            3577788899999999999999999999764

>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A

Probab=94.32  E-value=0.056  Score=32.62  Aligned_cols=29  Identities=10%  Similarity=0.123  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       249 ~l~~li~~~l~~~p~~Rpt~~~l~~~l~~  277 (296)
T 4hgt_A          249 EFATYLNFCRSLRFDDKPDYSYLRQLFRN  277 (296)
T ss_dssp             HHHHHHHHHHTSCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCCCCCHHHHHHHHHH
Confidence            45667788999999999999999999875

>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens}

Probab=94.30  E-value=0.04  Score=33.78  Aligned_cols=29  Identities=14%  Similarity=0.171  Sum_probs=25.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|++.+|.+||++.++++.|+..
T Consensus       252 l~~li~~~l~~dP~~Rps~~~l~~~L~~l  280 (310)
T 3s95_A          252 FFPITVRCCDLDPEKRPSFVKLEHWLETL  280 (310)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            56677899999999999999999998754

>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens}

Probab=94.29  E-value=0.048  Score=33.79  Aligned_cols=29  Identities=14%  Similarity=0.175  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       291 ~l~~li~~cl~~dP~~Rps~~el~~~L~~  319 (326)
T 2w1i_A          291 EIYMIMTECWNNNVNQRPSFRDLALRVDQ  319 (326)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45667789999999999999999999875

>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens}

Probab=94.27  E-value=0.054  Score=33.18  Aligned_cols=29  Identities=17%  Similarity=0.296  Sum_probs=25.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|+..+|.+||++.+++..|+..
T Consensus       272 l~~li~~~l~~~p~~Rpt~~~l~~~l~~l  300 (319)
T 2y4i_B          272 ISDILLFCWAFEQEERPTFTKLMDMLEKL  300 (319)
T ss_dssp             HHHHHHHHHCSSTTTSCCHHHHHHHHTTC
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHHHHH
Confidence            45677889999999999999999999865

>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens}

Probab=94.26  E-value=0.068  Score=32.74  Aligned_cols=31  Identities=16%  Similarity=0.056  Sum_probs=26.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcCC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSEI   46 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~~   46 (73)
                      .+..+-..|++.+|.+||++.+++..|+...
T Consensus       275 ~l~~li~~~l~~dp~~Rps~~~ll~~L~~~~  305 (317)
T 2buj_A          275 ALWQLLNSMMTVDPHQRPHIPLLLSQLEALQ  305 (317)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHTC
T ss_pred             HHHHHHHHHhhcChhhCCCHHHHHHHhhhcC
Confidence            3556778899999999999999999998753

>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A*

Probab=94.25  E-value=0.049  Score=32.60  Aligned_cols=30  Identities=13%  Similarity=0.259  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++-..|++.+|.+||++.++++.|+..
T Consensus       233 ~l~~li~~~l~~~p~~Rps~~~ll~~L~~l  262 (268)
T 3sxs_A          233 TIYQIMYSCWHELPEKRPTFQQLLSSIEPL  262 (268)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            355677889999999999999999999864

>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ...

Probab=94.18  E-value=0.11  Score=34.01  Aligned_cols=30  Identities=10%  Similarity=0.139  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|.+.+|.+||++.+++..|+..
T Consensus       409 ~l~~li~~cl~~dP~~Rpt~~~l~~~L~~~  438 (452)
T 1fmk_A          409 SLHDLMCQCWRKEPEERPTFEYLQAFLEDY  438 (452)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            355677899999999999999999999865

>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A*

Probab=94.17  E-value=0.055  Score=32.69  Aligned_cols=29  Identities=28%  Similarity=0.274  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++-..|++.+|.+||++.++++.|+.
T Consensus       258 ~l~~li~~~l~~dp~~Rps~~~ll~~L~~  286 (287)
T 4f0f_A          258 RLRNVIELCWSGDPKKRPHFSYIVKELSE  286 (287)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHT
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHh
Confidence            35567788999999999999999999874

>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=94.17  E-value=0.055  Score=32.22  Aligned_cols=29  Identities=21%  Similarity=0.336  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       233 ~l~~li~~~l~~~p~~Rps~~~ll~~L~~  261 (267)
T 3t9t_A          233 HVYQIMNHCWRERPEDRPAFSRLLRQLAE  261 (267)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            35567789999999999999999999875

>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ...

Probab=94.16  E-value=0.054  Score=32.93  Aligned_cols=30  Identities=13%  Similarity=0.284  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|++.+|.+||++.+++..|+..
T Consensus       257 ~l~~li~~~l~~~p~~Rps~~ell~~L~~l  286 (289)
T 3og7_A          257 RMKRLMAECLKKKRDERPSFPRILAEIEEL  286 (289)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHHH
Confidence            456677889999999999999999999764

>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A*

Probab=94.11  E-value=0.05  Score=33.92  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|++.+|.+||++.+++..|+.
T Consensus       324 ~l~~li~~~l~~dP~~Rps~~ell~~L~~  352 (359)
T 3vhe_A          324 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  352 (359)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHHHHHH
Confidence            35566788999999999999999999874

>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A*

Probab=94.08  E-value=0.071  Score=32.38  Aligned_cols=29  Identities=21%  Similarity=0.204  Sum_probs=25.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       248 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~  276 (291)
T 1xbb_A          248 EMYDLMNLCWTYDVENRPGFAAVELRLRN  276 (291)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35567788999999999999999999975

>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ...

Probab=94.05  E-value=0.059  Score=32.41  Aligned_cols=29  Identities=24%  Similarity=0.335  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       238 ~l~~li~~~l~~~p~~Rps~~~l~~~l~~  266 (279)
T 1qpc_A          238 ELYQLMRLCWKERPEDRPTFDYLRSVLED  266 (279)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhccChhhCCCHHHHHHHHHH
Confidence            45567788999999999999999999875

>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A*

Probab=94.01  E-value=0.059  Score=33.31  Aligned_cols=29  Identities=14%  Similarity=0.169  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       295 ~l~~li~~~l~~~p~~Rps~~~l~~~L~~  323 (333)
T 2i1m_A          295 NIYSIMQACWALEPTHRPTFQQICSFLQE  323 (333)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhccChhhCcCHHHHHHHHHH
Confidence            35567788999999999999999999864

>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A*

Probab=94.00  E-value=0.056  Score=32.72  Aligned_cols=30  Identities=3%  Similarity=-0.093  Sum_probs=25.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       252 ~l~~li~~~l~~dp~~RP~~~~l~~~l~~~  281 (298)
T 1csn_A          252 EFYKYMHYARNLAFDATPDYDYLQGLFSKV  281 (298)
T ss_dssp             HHHHHHHHHHHCCTTCCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHHHHHHHH
Confidence            456677889999999999999999998753

>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=93.98  E-value=0.073  Score=33.21  Aligned_cols=29  Identities=17%  Similarity=0.329  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       278 ~l~~li~~~l~~~p~~Rps~~~l~~~L~~  306 (333)
T 1mqb_A          278 AIYQLMMQCWQQERARRPKFADIVSILDK  306 (333)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35667789999999999999999999865

>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A*

Probab=93.97  E-value=0.062  Score=32.75  Aligned_cols=29  Identities=7%  Similarity=0.221  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       276 ~l~~li~~~l~~dp~~Rps~~ell~~L~~  304 (313)
T 1t46_A          276 EMYDIMKTCWDADPLKRPTFKQIVQLIEK  304 (313)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHH
Confidence            45567789999999999999999999875

>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=93.97  E-value=0.064  Score=32.17  Aligned_cols=28  Identities=21%  Similarity=0.341  Sum_probs=24.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+-..|++.+|.+||++.++++.|+.
T Consensus       236 ~~~li~~~l~~~p~~Rps~~~ll~~l~~  263 (269)
T 4hcu_A          236 VYQIMNHCWRERPEDRPAFSRLLRQLAE  263 (269)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCCcccCcCHHHHHHHHHH
Confidence            4566778999999999999999999864

>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A*

Probab=93.96  E-value=0.059  Score=32.73  Aligned_cols=29  Identities=14%  Similarity=0.175  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++++.|+.
T Consensus       271 ~l~~li~~~l~~dp~~Rps~~~ll~~L~~  299 (302)
T 4e5w_A          271 EVYQLMRKCWEFQPSNRTSFQNLIEGFEA  299 (302)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCCCCCCCHHHHHHHHHH
Confidence            45677789999999999999999999874

>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A*

Probab=93.91  E-value=0.067  Score=31.81  Aligned_cols=29  Identities=14%  Similarity=0.320  Sum_probs=24.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+-..|++.+|.+||++.++++.|+..
T Consensus       240 ~~~li~~~l~~~p~~Rps~~~il~~L~~l  268 (271)
T 3kmu_A          240 VSKLMKICMNEDPAKRPKFDMIVPILEKM  268 (271)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHHh
Confidence            45566789999999999999999998753

>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ...

Probab=93.86  E-value=0.061  Score=32.66  Aligned_cols=30  Identities=27%  Similarity=0.259  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++-..|++.+|.+||++.+++..|+..
T Consensus       260 ~l~~li~~~l~~~p~~Rps~~ell~~L~~~  289 (298)
T 3f66_A          260 PLYEVMLKCWHPKAEMRPSFSELVSRISAI  289 (298)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            355677889999999999999999999753

>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A*

Probab=93.83  E-value=0.068  Score=32.69  Aligned_cols=30  Identities=10%  Similarity=0.189  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       266 ~l~~li~~~l~~dp~~Rps~~~il~~l~~l  295 (310)
T 2wqm_A          266 ELRQLVNMCINPDPEKRPDVTYVYDVAKRM  295 (310)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHHH
Confidence            355667789999999999999999998754

>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B*

Probab=93.82  E-value=0.07  Score=32.18  Aligned_cols=30  Identities=17%  Similarity=0.226  Sum_probs=25.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|+..+|.+||++.+++..|+..
T Consensus       253 ~l~~li~~~l~~~p~~Rps~~~l~~~l~~~  282 (291)
T 1u46_A          253 DIYNVMVQCWAHKPEDRPTFVALRDFLLEA  282 (291)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHHHHHh
Confidence            355677889999999999999999999754

>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens}

Probab=93.81  E-value=0.13  Score=32.23  Aligned_cols=30  Identities=3%  Similarity=0.040  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++-..|+..+|.+||++.+++..|+..
T Consensus       297 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~~  326 (345)
T 2v62_A          297 EIAQFLVCAHSLAYDEKPNYQALKKILNPH  326 (345)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHCTT
T ss_pred             HHHHHHHHHhhcCcccCCCHHHHHHHHhcc
Confidence            455666799999999999999999999864

>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A*

Probab=93.75  E-value=0.072  Score=32.48  Aligned_cols=29  Identities=14%  Similarity=0.202  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       280 ~~~~li~~~l~~dp~~Rps~~~l~~~l~~  308 (314)
T 2ivs_A          280 EMYRLMLQCWKQEPDKRPVFADISKDLEK  308 (314)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            45567788999999999999999999875

>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens}

Probab=93.71  E-value=0.07  Score=33.96  Aligned_cols=30  Identities=10%  Similarity=0.091  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.++++.|+..
T Consensus       321 ~l~~li~~~l~~dP~~Rps~~ell~~L~~~  350 (382)
T 3tt0_A          321 ELYMMMRDCWHAVPSQRPTFKQLVEDLDRI  350 (382)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            355677889999999999999999999753

>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A*

Probab=93.65  E-value=0.078  Score=31.98  Aligned_cols=28  Identities=18%  Similarity=0.202  Sum_probs=24.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+-..|++.+|.+||++.+++..|+.
T Consensus       243 l~~li~~~l~~~p~~Rps~~ell~~L~~  270 (281)
T 3cc6_A          243 LYTLMTRCWDYDPSDRPRFTELVCSLSD  270 (281)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCCchhCcCHHHHHHHHHH
Confidence            5566788999999999999999999864

>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B

Probab=93.62  E-value=0.074  Score=34.76  Aligned_cols=30  Identities=13%  Similarity=0.249  Sum_probs=26.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       413 ~l~~li~~cl~~dp~~RPt~~~i~~~L~~~  442 (454)
T 1qcf_A          413 ELYNIMMRCWKNRPEERPTFEYIQSVLDDF  442 (454)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHHH
Confidence            355677899999999999999999999865

>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A*

Probab=93.60  E-value=0.074  Score=32.03  Aligned_cols=30  Identities=17%  Similarity=0.010  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|++.+|.+||++.+++..|+..
T Consensus       242 ~l~~li~~~l~~~p~~Rps~~~l~~~L~~i  271 (278)
T 1byg_A          242 AVYEVMKNCWHLDAAMRPSFLQLREQLEHI  271 (278)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCCCHHHHHHHHHHH
Confidence            345566789999999999999999998753

>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A*

Probab=93.59  E-value=0.076  Score=33.79  Aligned_cols=29  Identities=24%  Similarity=0.184  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       343 ~l~~li~~cl~~dP~~Rps~~~i~~~L~~  371 (377)
T 3cbl_A          343 AVFRLMEQCWAYEPGQRPSFSTIYQELQS  371 (377)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHH
Confidence            34566788999999999999999999875

>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ...

Probab=93.57  E-value=0.082  Score=31.88  Aligned_cols=29  Identities=17%  Similarity=0.223  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.++++.|+.
T Consensus       240 ~l~~li~~~l~~dp~~Rps~~~~~~~l~~  268 (288)
T 3kfa_A          240 KVYELMRACWQWNPSDRPSFAEIHQAFET  268 (288)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhCCChhhCcCHHHHHHHHHH
Confidence            35567788999999999999999998864

>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A

Probab=93.54  E-value=0.079  Score=31.92  Aligned_cols=29  Identities=14%  Similarity=0.310  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..|..
T Consensus       249 ~l~~li~~~l~~~p~~Rps~~~ll~~L~~  277 (283)
T 3gen_A          249 KVYTIMYSCWHEKADERPTFKILLSNILD  277 (283)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHH
Confidence            35567788999999999999999998864

>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7

Probab=93.50  E-value=0.085  Score=31.90  Aligned_cols=30  Identities=10%  Similarity=0.090  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       256 ~l~~li~~~l~~~p~~Rps~~~ll~~l~~~  285 (298)
T 3pls_A          256 SLYQVMQQCWEADPAVRPTFRVLVGEVEQI  285 (298)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            355677899999999999999999998753

>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ...

Probab=93.46  E-value=0.079  Score=32.32  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       279 ~l~~li~~~l~~dp~~Rps~~ell~~L~~  307 (316)
T 2xir_A          279 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  307 (316)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35566678999999999999999999875

>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens}

Probab=93.44  E-value=0.097  Score=32.78  Aligned_cols=29  Identities=3%  Similarity=-0.038  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       305 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~  333 (352)
T 2jii_A          305 TLQKYLKVVMALTYEEKPPYAMLRNNLEA  333 (352)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCChhhCCCHHHHHHHHHH
Confidence            35566678999999999999999999875

>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A*

Probab=93.42  E-value=0.09  Score=31.76  Aligned_cols=29  Identities=14%  Similarity=0.093  Sum_probs=24.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..|+.
T Consensus       245 ~l~~li~~~l~~~p~~Rps~~~l~~~l~~  273 (281)
T 1mp8_A          245 TLYSLMTKCWAYDPSRRPRFTELKAQLST  273 (281)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            34566788999999999999999999875

>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A

Probab=93.33  E-value=0.086  Score=34.94  Aligned_cols=30  Identities=17%  Similarity=0.193  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       447 ~l~~li~~cl~~dP~~RPs~~el~~~L~~~  476 (495)
T 1opk_A          447 KVYELMRACWQWNPSDRPSFAEIHQAFETM  476 (495)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHHcCcChhHCcCHHHHHHHHHHH
Confidence            455667899999999999999999999864

>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens}

Probab=93.26  E-value=0.092  Score=33.32  Aligned_cols=29  Identities=14%  Similarity=0.257  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.++++.|+.
T Consensus       314 ~l~~li~~~l~~dP~~Rps~~eil~~l~~  342 (367)
T 3l9p_A          314 PVYRIMTQCWQHQPEDRPNFAIILERIEY  342 (367)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            35567789999999999999999999865

>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7

Probab=93.24  E-value=0.096  Score=32.36  Aligned_cols=30  Identities=20%  Similarity=0.300  Sum_probs=26.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       304 ~l~~li~~~l~~~p~~Rps~~~~~~~L~~~  333 (343)
T 1luf_A          304 ELYNLMRLCWSKLPADRPSFCSIHRILQRM  333 (343)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcccCcccCCCHHHHHHHHHHH
Confidence            455677889999999999999999999865

>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A*

Probab=93.23  E-value=0.089  Score=32.58  Aligned_cols=29  Identities=17%  Similarity=0.196  Sum_probs=25.0

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+-..|++.+|.+||++.++++.|+..
T Consensus       268 l~~li~~~l~~dP~~Rps~~~ll~~L~~~  296 (309)
T 3p86_A          268 VAAIIEGCWTNEPWKRPSFATIMDLLRPL  296 (309)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            45667789999999999999999998753

>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A*

Probab=93.22  E-value=0.072  Score=32.15  Aligned_cols=29  Identities=21%  Similarity=0.170  Sum_probs=25.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|++.+|.+||++.+++..|+..
T Consensus       245 l~~li~~~l~~dp~~Rps~~~ll~~l~~l  273 (289)
T 4fvq_A          245 LANLINNCMDYEPDHRPSFRAIIRDLNSL  273 (289)
T ss_dssp             THHHHHHHSCSSGGGSCCHHHHHHHHHTC
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            45567789999999999999999999865

>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ...

Probab=93.05  E-value=0.098  Score=32.48  Aligned_cols=30  Identities=10%  Similarity=0.091  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       287 ~l~~li~~~l~~dp~~Rps~~ell~~L~~l  316 (334)
T 2pvf_A          287 ELYMMMRDCWHAVPSQRPTFKQLVEDLDRI  316 (334)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            355677889999999999999999998753

>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens}

Probab=93.01  E-value=0.11  Score=32.38  Aligned_cols=29  Identities=14%  Similarity=0.100  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       247 ~l~~li~~~l~~dp~~Rps~~ell~~L~~  275 (327)
T 3lzb_A          247 DVYMIMRKCWMIDADSRPKFRELIIEFSK  275 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35567788999999999999999999875

>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus}

Probab=92.96  E-value=0.11  Score=31.99  Aligned_cols=30  Identities=13%  Similarity=0.118  Sum_probs=25.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       267 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~~  296 (323)
T 3qup_A          267 EVYDLMYQCWSADPKQRPSFTCLRMELENI  296 (323)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            456777899999999999999999998753

>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A*

Probab=92.95  E-value=0.099  Score=31.99  Aligned_cols=30  Identities=17%  Similarity=0.136  Sum_probs=25.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|++.+|.+||++.+++..|+..
T Consensus       277 ~l~~li~~~l~~dp~~Rps~~~l~~~L~~l  306 (313)
T 3brb_A          277 ELYEIMYSCWRTDPLDRPTFSVLRLQLEKL  306 (313)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            456677889999999999999999998753

>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ...

Probab=92.91  E-value=0.13  Score=31.57  Aligned_cols=29  Identities=24%  Similarity=0.263  Sum_probs=25.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+-..|++.+|.+||++.+++..|+..
T Consensus       269 l~~li~~~l~~dp~~Rps~~e~l~~L~~~  297 (322)
T 1p4o_A          269 LFELMRMCWQYNPKMRPSFLEIISSIKEE  297 (322)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHcCCCcccCcCHHHHHHHHHHh
Confidence            45667789999999999999999999764

>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A*

Probab=92.91  E-value=0.11  Score=32.17  Aligned_cols=29  Identities=14%  Similarity=0.257  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       273 ~l~~li~~~l~~dp~~Rps~~~ll~~l~~  301 (327)
T 2yfx_A          273 PVYRIMTQCWQHQPEDRPNFAIILERIEY  301 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHH
Confidence            35567788999999999999999999864

>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7

Probab=92.89  E-value=0.12  Score=32.11  Aligned_cols=30  Identities=17%  Similarity=0.165  Sum_probs=25.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|++.+|.+||++.+++..|+..
T Consensus       303 ~l~~li~~~l~~dp~~Rps~~~l~~~l~~~  332 (344)
T 1rjb_A          303 EIYIIMQSCWAFDSRKRPSFPNLTSFLGCQ  332 (344)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHHHHHHHH
Confidence            455677889999999999999999999764

>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B*

Probab=92.75  E-value=0.13  Score=30.79  Aligned_cols=29  Identities=14%  Similarity=0.047  Sum_probs=24.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+-..|++.+|.+||++.+++..|...
T Consensus       244 ~~~li~~~l~~dp~~Rps~~e~l~~l~~~  272 (284)
T 2a19_B          244 EKTLLQKLLSKKPEDRPNTSEILRTLTVW  272 (284)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            34566789999999999999999998764

>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A

Probab=92.60  E-value=0.13  Score=32.70  Aligned_cols=29  Identities=10%  Similarity=0.125  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..|+.
T Consensus       333 ~l~~li~~~l~~dP~~Rpt~~ell~~L~~  361 (370)
T 2psq_A          333 ELYMMMRDCWHAVPSQRPTFKQLVEDLDR  361 (370)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            45566678999999999999999999875

>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7

Probab=92.54  E-value=0.13  Score=32.83  Aligned_cols=30  Identities=27%  Similarity=0.259  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|.+.+|.+||++.+++..|+..
T Consensus       324 ~l~~li~~cl~~dp~~RPs~~ell~~L~~i  353 (373)
T 3c1x_A          324 PLYEVMLKCWHPKAEMRPSFSELVSRISAI  353 (373)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHH
Confidence            355667889999999999999999999753

>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=92.45  E-value=0.14  Score=30.97  Aligned_cols=29  Identities=17%  Similarity=0.049  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..|+.
T Consensus       241 ~l~~li~~~l~~~p~~Rps~~~l~~~l~~  269 (287)
T 1u59_A          241 ELYALMSDCWIYKWEDRPDFLTVEQRMRA  269 (287)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            35556688999999999999999999875

>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A*

Probab=92.32  E-value=0.092  Score=32.52  Aligned_cols=28  Identities=11%  Similarity=0.076  Sum_probs=24.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+...|++.+|.+||++.+++..|+.
T Consensus       246 ~~~li~~~l~~dp~~Rps~~el~~~l~~  273 (325)
T 3kex_A          246 VYMVMVKCWMIDENIRPTFKELANEFTR  273 (325)
T ss_dssp             TTHHHHHHTCSCTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHHH
Confidence            3456678999999999999999999865

>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7

Probab=92.27  E-value=0.29  Score=32.75  Aligned_cols=29  Identities=10%  Similarity=0.146  Sum_probs=25.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+-..|.+.+|.+||++.+++..|+..
T Consensus       493 l~~li~~cl~~dP~~RPt~~~l~~~L~~~  521 (535)
T 2h8h_A          493 LHDLMCQCWRKEPEERPTFEYLQAFLEDY  521 (535)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             HHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            45667889999999999999999999865

>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A

Probab=92.17  E-value=0.18  Score=31.69  Aligned_cols=29  Identities=3%  Similarity=-0.133  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       298 ~~~~li~~cl~~~p~~RP~~~~l~~~l~~  326 (364)
T 3op5_A          298 EIAKYMETVKLLDYTEKPLYENLRDILLQ  326 (364)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCCCCCCCHHHHHHHHHH
Confidence            34566778999999999999999998864

>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A*

Probab=92.09  E-value=0.17  Score=31.23  Aligned_cols=29  Identities=17%  Similarity=0.263  Sum_probs=24.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..|..
T Consensus       269 ~l~~li~~~l~~dp~~Rps~~ell~~L~~  297 (327)
T 1fvr_A          269 EVYDLMRQCWREKPYERPSFAQILVSLNR  297 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHH
Confidence            35566788999999999999999998864

>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens}

Probab=91.52  E-value=0.15  Score=31.26  Aligned_cols=29  Identities=21%  Similarity=0.117  Sum_probs=24.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      +..+...|++.+|.+||++.+++..|+..
T Consensus       278 ~~~li~~~l~~~p~~Rps~~e~l~~l~~~  306 (337)
T 3ll6_A          278 FHSLIRAMLQVNPEERLSIAEVVHQLQEI  306 (337)
T ss_dssp             GHHHHHHHSCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhhCcCHHHHHHHHHHH
Confidence            44567789999999999999999998753

>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A

Probab=91.44  E-value=0.19  Score=32.81  Aligned_cols=30  Identities=13%  Similarity=0.036  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++-..|.+.+|.+||++.+++..|+..
T Consensus       414 ~l~~li~~cl~~dp~~Rpt~~~l~~~L~~i  443 (450)
T 1k9a_A          414 AVYDVMKNCWHLDAATRPTFLQLREQLEHI  443 (450)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHH
Confidence            345566789999999999999999998753

>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group}

Probab=91.06  E-value=0.27  Score=32.79  Aligned_cols=29  Identities=10%  Similarity=0.099  Sum_probs=25.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       247 ~l~~li~~cl~~dP~~RPs~~el~~~L~~  275 (483)
T 3sv0_A          247 EFASYFHYCRSLRFDDKPDYSYLKRLFRD  275 (483)
T ss_dssp             HHHHHHHHHHTCCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHHHHHHH
Confidence            46678889999999999999999988753

>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens}

Probab=91.04  E-value=0.26  Score=33.65  Aligned_cols=29  Identities=17%  Similarity=0.049  Sum_probs=25.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       567 ~l~~li~~cl~~dP~~RPs~~~l~~~L~~  595 (613)
T 2ozo_A          567 ELYALMSDCWIYKWEDRPDFLTVEQRMRA  595 (613)
T ss_dssp             HHHHHHHHTTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            45667789999999999999999999875

>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A*

Probab=90.32  E-value=0.34  Score=33.27  Aligned_cols=29  Identities=21%  Similarity=0.204  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|.+.+|.+||++.+++..|+.
T Consensus       600 ~l~~li~~cl~~dP~~RPs~~~l~~~L~~  628 (635)
T 4fl3_A          600 EMYDLMNLCWTYDVENRPGFAAVELRLRN  628 (635)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            35566788999999999999999999874

>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A*

Probab=90.28  E-value=0.28  Score=30.36  Aligned_cols=28  Identities=0%  Similarity=-0.063  Sum_probs=24.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|.+.+|..||++.++...|+
T Consensus       250 ~~~~li~~~l~~~p~~RP~~~~l~~~l~  277 (330)
T 2izr_A          250 EMATYLRYVRRLDFFEKPDYDYLRKLFT  277 (330)
T ss_dssp             HHHHHHHHHHHCCTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCCCCCHHHHHHHHH
Confidence            4566778899999999999999999885

>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A*

Probab=89.48  E-value=0.28  Score=29.32  Aligned_cols=29  Identities=7%  Similarity=-0.093  Sum_probs=23.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+-..|++.+|.+||++.+++..+..
T Consensus       243 ~l~~li~~~l~~~p~~Rps~~~ll~~~~~  271 (279)
T 2w5a_A          243 ELNEIITRMLNLKDYHRPSVEEILENPLI  271 (279)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHTSTTC
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHhChhh
Confidence            35566788999999999999999887653

>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens}

Probab=89.27  E-value=0.36  Score=29.37  Aligned_cols=25  Identities=8%  Similarity=0.139  Sum_probs=21.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       261 ~~~li~~~L~~dP~~Rpt~~ell~h  285 (311)
T 4agu_A          261 ALGLLKGCLHMDPTERLTCEQLLHH  285 (311)
T ss_dssp             HHHHHHHHCCSSTTTSCCHHHHHTS
T ss_pred             HHHHHHHHccCChhhcCCHHHHhcC
Confidence            5667788999999999999998753

>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A

Probab=89.22  E-value=0.39  Score=28.81  Aligned_cols=24  Identities=13%  Similarity=0.117  Sum_probs=20.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       260 ~~~li~~~l~~dp~~Rps~~~ll~  283 (303)
T 1zy4_A          260 EKKIIRLLIDHDPNKRPGARTLLN  283 (303)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHHhcCcccCcCHHHHhC
Confidence            456778899999999999998875

>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii}

Probab=89.03  E-value=0.35  Score=29.27  Aligned_cols=24  Identities=13%  Similarity=0.124  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       255 ~~~li~~~L~~dP~~Rps~~e~l~  278 (285)
T 3is5_A          255 AVDLLKQMLTKDPERRPSAAQVLH  278 (285)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCcCHHHHhc
Confidence            446667899999999999998864

>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A*

Probab=88.99  E-value=0.32  Score=28.93  Aligned_cols=24  Identities=8%  Similarity=0.073  Sum_probs=19.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       256 ~~~li~~~l~~dp~~Rps~~~ll~  279 (289)
T 1x8b_A          256 FTELLKVMIHPDPERRPSAMALVK  279 (289)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHhCCCcccCCCHHHHhh
Confidence            455667899999999999988764

>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A*

Probab=88.98  E-value=0.42  Score=28.50  Aligned_cols=25  Identities=16%  Similarity=0.072  Sum_probs=21.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       238 l~~li~~~l~~~p~~Rps~~~~l~h  262 (276)
T 2h6d_A          238 VATLLMHMLQVDPLKRATIKDIREH  262 (276)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHS
T ss_pred             HHHHHHHHccCChhhCCCHHHHHhC
Confidence            4556788999999999999998763

>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens}

Probab=88.80  E-value=0.39  Score=29.91  Aligned_cols=26  Identities=19%  Similarity=0.245  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+...|++.+|.+||++.+++.-
T Consensus       249 ~l~~li~~~L~~dp~~Rpt~~e~l~h  274 (343)
T 3dbq_A          249 DLQDVLKCCLKRDPKQRISIPELLAH  274 (343)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHTS
T ss_pred             HHHHHHHHHcCCChhHCCCHHHHHhC
Confidence            35567778999999999999998643

>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens}

Probab=88.78  E-value=0.4  Score=29.45  Aligned_cols=25  Identities=12%  Similarity=0.113  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       280 ~l~~li~~~L~~dP~~Rpt~~ell~  304 (311)
T 3p1a_A          280 ELRSVLVMMLEPDPKLRATAEALLA  304 (311)
T ss_dssp             HHHHHHHHHSCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHh
Confidence            4566778899999999999998875

>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A

Probab=88.58  E-value=0.27  Score=29.51  Aligned_cols=24  Identities=8%  Similarity=0.355  Sum_probs=20.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+...|++.+|.+||++.+++.
T Consensus       243 ~~~li~~~l~~~p~~Rpt~~e~l~  266 (290)
T 3fme_A          243 FVDFTSQCLKKNSKERPTYPELMQ  266 (290)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHhhcChhhCcCHHHHHh
Confidence            556677899999999999999865

>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A*

Probab=88.45  E-value=0.45  Score=29.77  Aligned_cols=29  Identities=14%  Similarity=0.046  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           12 LEILRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        12 ~~~~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..-..+..+-..|++.+|.+||++.+++.
T Consensus       363 ~~~~~~~~li~~~L~~dP~~Rpt~~e~l~  391 (397)
T 1wak_A          363 EEAAGFTDFLLPMLELIPEKRATAAECLR  391 (397)
T ss_dssp             HHHHHHHHHHGGGGCSSGGGSCCHHHHHT
T ss_pred             hhHHHHHHHHHHHhccChhhcCCHHHHhh
Confidence            34456777888999999999999998864

>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A*

Probab=88.33  E-value=0.38  Score=29.00  Aligned_cols=24  Identities=17%  Similarity=0.293  Sum_probs=20.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+...|++.+|.+||++.+++.
T Consensus       264 ~~~li~~~l~~dp~~Rps~~~ll~  287 (303)
T 2vwi_A          264 FRKMISLCLQKDPEKRPTAAELLR  287 (303)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCcCHHHHhh
Confidence            456677899999999999998865

>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A*

Probab=88.04  E-value=0.48  Score=28.91  Aligned_cols=25  Identities=20%  Similarity=0.259  Sum_probs=20.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       269 l~~li~~~l~~dp~~Rps~~ell~h  293 (313)
T 3cek_A          269 LQDVLKCCLKRDPKQRISIPELLAH  293 (313)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHTS
T ss_pred             HHHHHHHHccCCcccCcCHHHHhcC
Confidence            4556678999999999999998753

>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A*

Probab=87.94  E-value=0.49  Score=32.62  Aligned_cols=29  Identities=14%  Similarity=0.093  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|++.+|.+||++.+++..|+.
T Consensus       620 ~l~~li~~~l~~dP~~RPs~~el~~~L~~  648 (656)
T 2j0j_A          620 TLYSLMTKCWAYDPSRRPRFTELKAQLST  648 (656)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            45567788999999999999999999864

>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens}

Probab=87.92  E-value=0.59  Score=28.45  Aligned_cols=25  Identities=16%  Similarity=0.300  Sum_probs=21.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+...|++.+|.+||++.+++..
T Consensus       260 ~~~li~~~l~~~p~~Rps~~e~l~~  284 (312)
T 2iwi_A          260 CCALIRRCLAPKPSSRPSLEEILLD  284 (312)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHHS
T ss_pred             HHHHHHHHccCChhhCcCHHHHhcC
Confidence            4566678999999999999999874

>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A*

Probab=87.86  E-value=0.39  Score=29.31  Aligned_cols=26  Identities=8%  Similarity=0.019  Sum_probs=22.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+-..|++.+|.+||++.+++.
T Consensus       303 ~~l~~li~~~L~~dP~~Rpt~~ell~  328 (339)
T 1z57_A          303 ERLFDLIQKMLEYDPAKRITLREALK  328 (339)
T ss_dssp             HHHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHHHhCcCcccccCHHHHhc
Confidence            45667888999999999999988764

>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A

Probab=87.83  E-value=0.38  Score=28.99  Aligned_cols=25  Identities=16%  Similarity=0.298  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       258 ~l~~li~~~l~~dp~~Rps~~ell~  282 (290)
T 1t4h_A          258 EVKEIIEGCIRQNKDERYSIKDLLN  282 (290)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhh
Confidence            3566778899999999999998875

>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A*

Probab=87.78  E-value=0.32  Score=29.91  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       261 ~l~~li~~~l~~dp~~Rps~~ell~  285 (327)
T 3aln_A          261 SFINFVNLCLTKDESKRPKYKELLK  285 (327)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHHhhCChhhCcCHHHHHh
Confidence            4556678899999999999999854

>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A*

Probab=87.55  E-value=0.51  Score=30.17  Aligned_cols=25  Identities=20%  Similarity=0.272  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       296 ~~~~li~~~L~~dP~~Rps~~ell~  320 (390)
T 2zmd_A          296 DLQDVLKCCLKRDPKQRISIPELLA  320 (390)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcccChhhCCCHHHHhh
Confidence            3456667899999999999999864

>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens}

Probab=87.33  E-value=0.65  Score=27.88  Aligned_cols=24  Identities=17%  Similarity=0.211  Sum_probs=20.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       255 ~~~li~~~l~~dp~~Rps~~~ll~  278 (295)
T 2clq_A          255 AKAFILKCFEPDPDKRACANDLLV  278 (295)
T ss_dssp             HHHHHHHTTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCCCHHHHhc
Confidence            445667899999999999998864

>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ...

Probab=87.31  E-value=0.62  Score=27.89  Aligned_cols=25  Identities=8%  Similarity=0.034  Sum_probs=20.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       234 ~~~li~~~l~~~p~~Rps~~e~l~h  258 (279)
T 3fdn_A          234 ARDLISRLLKHNPSQRPMLREVLEH  258 (279)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHHHC
T ss_pred             HHHHHHHHhccChhhCCCHHHHhhC
Confidence            4456678999999999999998754

>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ...

Probab=87.26  E-value=0.46  Score=29.28  Aligned_cols=26  Identities=19%  Similarity=0.386  Sum_probs=21.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|++.+|.+||++.+++.-
T Consensus       269 ~~~~li~~~l~~dp~~Rps~~~ll~h  294 (320)
T 3a99_A          269 ECQHLIRWCLALRPSDRPTFEEIQNH  294 (320)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHTS
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhcC
Confidence            35566778999999999999998763

>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens}

Probab=87.11  E-value=0.78  Score=27.72  Aligned_cols=25  Identities=12%  Similarity=-0.116  Sum_probs=21.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++..
T Consensus       240 l~~li~~~l~~dp~~Rps~~~ll~~  264 (305)
T 2wtk_C          240 LSDLLKGMLEYEPAKRFSIRQIRQH  264 (305)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHHS
T ss_pred             HHHHHHHHccCChhhCCCHHHHhcC
Confidence            4566778999999999999999853

>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A

Probab=87.01  E-value=0.79  Score=27.89  Aligned_cols=25  Identities=12%  Similarity=0.025  Sum_probs=21.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       271 ~~~~li~~~L~~dP~~Rps~~e~l~  295 (316)
T 2ac3_A          271 AAKDLISKLLVRDAKQRLSAAQVLQ  295 (316)
T ss_dssp             HHHHHHHHHSCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHHhhCChhhCCCHHHHhc
Confidence            3556778899999999999998876

>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7}

Probab=86.94  E-value=0.38  Score=29.98  Aligned_cols=25  Identities=12%  Similarity=-0.104  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       331 ~l~~li~~~L~~dP~~Rpta~elL~  355 (360)
T 3llt_A          331 LFCDFLYSILQIDPTLRPSPAELLK  355 (360)
T ss_dssp             HHHHHHHHHCCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHHhcCChhhCCCHHHHhc
Confidence            4557788999999999999988753

>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens}

Probab=86.89  E-value=0.47  Score=28.82  Aligned_cols=24  Identities=8%  Similarity=0.124  Sum_probs=20.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       260 l~~li~~~l~~dp~~Rps~~~ll~  283 (318)
T 2dyl_A          260 FQSFVKDCLTKDHRKRPKYNKLLE  283 (318)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             HHHHHHHHccCChhHCcCHHHHhh
Confidence            455667899999999999998854

>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ...

Probab=86.84  E-value=0.55  Score=28.09  Aligned_cols=24  Identities=8%  Similarity=-0.021  Sum_probs=20.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+...|++.+|.+||++.+++.
T Consensus       242 ~~~li~~~l~~dp~~Rps~~~~l~  265 (283)
T 3bhy_A          242 AKDFIRRLLVKDPKRRMTIAQSLE  265 (283)
T ss_dssp             HHHHHHTTSCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHccCCHhHCcCHHHHHh
Confidence            556778899999999999999875

>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis}

Probab=86.82  E-value=0.7  Score=28.29  Aligned_cols=29  Identities=10%  Similarity=-0.043  Sum_probs=24.8

Q ss_pred             HHHHHHHhcCcCccCCC-CHHHHHHHhhcC
Q 038421           17 CIHVGLLCVQEYVHDRA-SISTVISMLSSE   45 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP-~m~~vv~~l~~~   45 (73)
                      +..+-..|++.+|.+|| ++.++...|+..
T Consensus       265 l~~li~~~l~~dP~~Rp~s~~~l~~~l~~~  294 (309)
T 2h34_A          265 FDAVIARGMAKNPEDRYVTCGDLSAAAHAA  294 (309)
T ss_dssp             HHHHHHHHTCSSGGGSCSSHHHHHHHHHHT
T ss_pred             HHHHHHHhccCCHHHHHHhHHHHHHHHHHH
Confidence            45567789999999999 999999999764

>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A*

Probab=86.36  E-value=0.69  Score=28.12  Aligned_cols=25  Identities=8%  Similarity=0.020  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       232 ~~~~li~~~l~~dP~~Rps~~e~l~  256 (299)
T 3m2w_A          232 EVKMLIRNLLKTEPTQRMTITEFMN  256 (299)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcccChhhCCCHHHHhc
Confidence            3555667899999999999999876

>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens}

Probab=86.33  E-value=0.44  Score=28.48  Aligned_cols=25  Identities=20%  Similarity=0.199  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       238 ~~~~li~~~l~~dp~~Rps~~~~l~  262 (278)
T 3cok_A          238 EAKDLIHQLLRRNPADRLSLSSVLD  262 (278)
T ss_dssp             HHHHHHHHHSCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHHcccCHhhCCCHHHHhc
Confidence            3456678899999999999988764

>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A*

Probab=86.32  E-value=0.53  Score=28.95  Aligned_cols=25  Identities=4%  Similarity=-0.004  Sum_probs=21.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       309 ~l~~li~~~L~~dP~~Rpt~~e~l~  333 (355)
T 2eu9_A          309 QLFDLMRRMLEFDPAQRITLAEALL  333 (355)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhc
Confidence            5667778999999999999998863

>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A*

Probab=86.18  E-value=0.45  Score=28.86  Aligned_cols=25  Identities=8%  Similarity=0.065  Sum_probs=20.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++..
T Consensus       247 l~~li~~~l~~dp~~Rps~~~ll~~  271 (303)
T 3a7i_A          247 LKEFVEACLNKEPSFRPTAKELLKH  271 (303)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHTTC
T ss_pred             HHHHHHHHcCCChhhCcCHHHHhhC
Confidence            4566778999999999999998653

>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus}

Probab=86.17  E-value=0.64  Score=28.28  Aligned_cols=24  Identities=8%  Similarity=-0.016  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++++
T Consensus       302 ~~~li~~~l~~~p~~Rps~~~~l~  325 (332)
T 3qd2_B          302 EHMMVQDMLSPSPTERPEATDIIE  325 (332)
T ss_dssp             HHHHHHHHHCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHccCCCCcCCCHHHHhh
Confidence            455667899999999999998875

>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A*

Probab=86.11  E-value=0.68  Score=29.29  Aligned_cols=27  Identities=11%  Similarity=-0.016  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           14 ILRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        14 ~~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ...+..+-..|++.+|.+||++.+++.
T Consensus       346 ~~~~~dli~~mL~~dP~~Rpta~e~L~  372 (382)
T 2vx3_A          346 YLKFKDLILRMLDYDPKTRIQPYYALQ  372 (382)
T ss_dssp             HHHHHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             hHHHHHHHHHhcCCChhhCCCHHHHhc
Confidence            346777888999999999999998754

>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A*

Probab=85.92  E-value=0.8  Score=27.55  Aligned_cols=24  Identities=4%  Similarity=-0.140  Sum_probs=20.7

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       253 ~~~li~~~l~~dp~~Rps~~ell~  276 (287)
T 2wei_A          253 AKDLIRKMLTFHPSLRITATQCLE  276 (287)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHcccChhhCcCHHHHhc
Confidence            456678899999999999999876

>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A*

Probab=85.90  E-value=0.59  Score=27.97  Aligned_cols=24  Identities=4%  Similarity=-0.075  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       238 ~~~li~~~l~~dp~~Rps~~~~l~  261 (284)
T 3kk8_A          238 AKSLIDSMLTVNPKKRITADQALK  261 (284)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHcccChhhCCCHHHHhc
Confidence            455667899999999999999866

>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens}

Probab=85.86  E-value=0.76  Score=27.97  Aligned_cols=25  Identities=16%  Similarity=0.036  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       272 ~~~~li~~~L~~dP~~R~t~~e~l~  296 (308)
T 3g33_A          272 SGAQLLLEMLTFNPHKRISAFRALQ  296 (308)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHhcCCCccCCCHHHHhc
Confidence            3456667899999999999988764

>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A

Probab=85.83  E-value=0.86  Score=28.33  Aligned_cols=27  Identities=11%  Similarity=-0.053  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           14 ILRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        14 ~~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      -..+..+-..|++.+|.+||++.+++.
T Consensus       307 ~~~~~~li~~~L~~dP~~Rpt~~ell~  333 (373)
T 1q8y_A          307 AKEISDFLSPMLQLDPRKRADAGGLVN  333 (373)
T ss_dssp             HHHHHHHHGGGGCSSTTTCBCHHHHHT
T ss_pred             HHHHHHHHHHHhccCccccCCHHHHhh
Confidence            345667778999999999999999876

>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A*

Probab=85.66  E-value=0.77  Score=28.38  Aligned_cols=25  Identities=8%  Similarity=-0.024  Sum_probs=20.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       271 l~~li~~~l~~dp~~Rps~~ell~h  295 (321)
T 2c30_A          271 LRDFLERMLVRDPQERATAQELLDH  295 (321)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHHTS
T ss_pred             HHHHHHHHccCChhhCcCHHHHhcC
Confidence            4455678999999999999998763

>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A

Probab=85.59  E-value=0.64  Score=29.36  Aligned_cols=24  Identities=8%  Similarity=-0.183  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+...|++.+|.+||++.+++.
T Consensus       336 ~~~li~~~L~~dp~~Rpt~~e~l~  359 (377)
T 3byv_A          336 VRALLEGFLRYPKEDRLLPLQAME  359 (377)
T ss_dssp             HHHHHHHHTCSSGGGCCCHHHHHT
T ss_pred             HHHHHHHHcCCCchhCCCHHHHhh
Confidence            455667899999999999999864

>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A

Probab=85.47  E-value=0.82  Score=27.58  Aligned_cols=24  Identities=8%  Similarity=0.009  Sum_probs=19.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       257 ~~~li~~~L~~dP~~Rpt~~e~l~  280 (288)
T 1ob3_A          257 GIDLLSKMLKLDPNQRITAKQALE  280 (288)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHcCCCcccCCCHHHHhc
Confidence            445667899999999999988764

>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A*

Probab=85.34  E-value=0.86  Score=28.35  Aligned_cols=24  Identities=13%  Similarity=0.171  Sum_probs=20.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       264 ~~~li~~~L~~dP~~Rpt~~ell~  287 (336)
T 3fhr_A          264 AKQLIRLLLKTDPTERLTITQFMN  287 (336)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHCCCChhHCcCHHHHhc
Confidence            455667899999999999999987

>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A*

Probab=85.33  E-value=0.64  Score=28.07  Aligned_cols=24  Identities=8%  Similarity=0.106  Sum_probs=19.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       252 l~~li~~~l~~dp~~Rps~~~ll~  275 (302)
T 2j7t_A          252 FRDFLKIALDKNPETRPSAAQLLE  275 (302)
T ss_dssp             HHHHHHHHSCSCTTTSCCHHHHTT
T ss_pred             HHHHHHHHcccChhhCCCHHHHhc
Confidence            455667899999999999988754

>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ...

Probab=85.16  E-value=0.62  Score=27.70  Aligned_cols=24  Identities=13%  Similarity=0.034  Sum_probs=19.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       238 ~~~li~~~l~~~p~~Rps~~~il~  261 (276)
T 2yex_A          238 PLALLHKILVENPSARITIPDIKK  261 (276)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHCCCCchhCCCHHHHhc
Confidence            455678899999999999988764

>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A*

Probab=85.13  E-value=0.29  Score=30.24  Aligned_cols=25  Identities=12%  Similarity=0.203  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.++++
T Consensus       282 ~l~~li~~~L~~dP~~Rpt~~ell~  306 (331)
T 4aaa_A          282 VVIDLAKKCLHIDPDKRPFCAELLH  306 (331)
T ss_dssp             HHHHHHHHHTCSSGGGSCCGGGGGG
T ss_pred             HHHHHHHHHhccCcccCCCHHHHhc
Confidence            4566778999999999999988754

>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens}

Probab=85.02  E-value=0.67  Score=28.07  Aligned_cols=23  Identities=4%  Similarity=-0.018  Sum_probs=19.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      +..+-..|++.+|.+||++.+++
T Consensus       269 l~~li~~~l~~dp~~R~s~~e~l  291 (298)
T 2zv2_A          269 LKDLITRMLDKNPESRIVVPEIK  291 (298)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHT
T ss_pred             HHHHHHHHhhcChhhCCCHHHHh
Confidence            45566789999999999998874

>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ...

Probab=84.81  E-value=0.82  Score=28.49  Aligned_cols=24  Identities=13%  Similarity=0.203  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       301 ~~~li~~~L~~dP~~Rpt~~ell~  324 (360)
T 3eqc_A          301 FQDFVNKCLIKNPAERADLKQLMV  324 (360)
T ss_dssp             HHHHHHHHHCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHhhcChhhCCCHHHHhh
Confidence            456667899999999999999854

>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A*

Probab=84.74  E-value=0.68  Score=28.64  Aligned_cols=25  Identities=8%  Similarity=-0.091  Sum_probs=21.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       282 ~~~li~~~L~~dP~~Rpt~~ell~h  306 (353)
T 2b9h_A          282 GIDLLQRMLVFDPAKRITAKEALEH  306 (353)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHTS
T ss_pred             HHHHHHHhcCcCcccCCCHHHHhcC
Confidence            4567788999999999999998763

>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens}

Probab=84.63  E-value=0.97  Score=28.19  Aligned_cols=25  Identities=8%  Similarity=0.080  Sum_probs=20.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       251 l~~li~~~L~~dP~~Rps~~ell~h  275 (335)
T 3dls_A          251 LMSLVSGLLQPVPERRTTLEKLVTD  275 (335)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHC
T ss_pred             HHHHHHHHccCChhhCcCHHHHhcC
Confidence            4456678999999999999998774

>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens}

Probab=84.58  E-value=0.98  Score=27.96  Aligned_cols=24  Identities=8%  Similarity=-0.022  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       248 ~~~li~~~L~~dP~~Rpt~~e~l~  271 (326)
T 2y0a_A          248 AKDFIRRLLVKDPKKRMTIQDSLQ  271 (326)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHccCChhhCCCHHHHhc
Confidence            445667899999999999999875

>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ...

Probab=84.51  E-value=0.96  Score=27.21  Aligned_cols=25  Identities=8%  Similarity=-0.060  Sum_probs=20.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       259 ~~~~li~~~L~~dP~~Rpt~~~~l~  283 (299)
T 2r3i_A          259 DGRSLLSQMLHYDPNKRISAKAALA  283 (299)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHhcCcCcccCCCHHHHhc
Confidence            3455667899999999999998876

>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens}

Probab=84.47  E-value=0.63  Score=28.15  Aligned_cols=25  Identities=12%  Similarity=0.024  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       281 ~~~~li~~~L~~dP~~Rpt~~ell~  305 (320)
T 2i6l_A          281 EAVDFLEQILTFSPMDRLTAEEALS  305 (320)
T ss_dssp             HHHHHHHTTSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHcCCCccccCCHHHHhC
Confidence            3556778899999999999999865

>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A*

Probab=84.31  E-value=0.98  Score=27.69  Aligned_cols=25  Identities=4%  Similarity=-0.005  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+...|++.+|.+||++.+++.
T Consensus       250 ~~~~li~~~l~~dP~~Rps~~~~l~  274 (322)
T 2ycf_A          250 KALDLVKKLLVVDPKARFTTEEALR  274 (322)
T ss_dssp             HHHHHHHHHSCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcccCHhhCCCHHHHhh
Confidence            4566778999999999999999853

>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A*

Probab=84.18  E-value=0.77  Score=28.01  Aligned_cols=24  Identities=17%  Similarity=0.191  Sum_probs=20.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       246 ~~~li~~~l~~dp~~Rps~~ell~  269 (297)
T 3fxz_A          246 FRDFLNRCLEMDVEKRGSAKELLQ  269 (297)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHccCChhHCcCHHHHhh
Confidence            455667899999999999998865

>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B

Probab=84.18  E-value=1.2  Score=27.14  Aligned_cols=24  Identities=21%  Similarity=0.162  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       273 ~~~li~~~L~~dP~~Rpt~~e~l~  296 (326)
T 1blx_A          273 GKDLLLKCLTFNPAKRISAYSALS  296 (326)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHcCCCcccCCCHHHHhc
Confidence            445667899999999999999874

>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A*

Probab=84.10  E-value=0.82  Score=28.27  Aligned_cols=25  Identities=8%  Similarity=0.003  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.++++
T Consensus       294 ~~~~li~~~L~~dP~~R~t~~e~l~  318 (329)
T 3gbz_A          294 EGLDLLTAMLEMDPVKRISAKNALE  318 (329)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhC
Confidence            3456778899999999999998875

>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A*

Probab=84.06  E-value=1  Score=27.68  Aligned_cols=25  Identities=12%  Similarity=-0.059  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       276 ~~~~li~~~L~~dP~~Rpt~~ell~  300 (311)
T 3niz_A          276 EGIDLLSNMLCFDPNKRISARDAMN  300 (311)
T ss_dssp             HHHHHHHHHSCSCTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCCCHHHHhc
Confidence            3456678899999999999998875

>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major}

Probab=83.75  E-value=0.67  Score=28.76  Aligned_cols=27  Identities=7%  Similarity=-0.054  Sum_probs=22.4

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      ..+..+...|++.+|.+||++.+++.-
T Consensus       289 ~~~~~li~~~L~~dP~~Rpt~~e~l~h  315 (360)
T 3e3p_A          289 KEAYDLLSALLQYLPEERMKPYEALCH  315 (360)
T ss_dssp             HHHHHHHHHHTCSSGGGSCCHHHHTTS
T ss_pred             HHHHHHHHHHhccCccccCCHHHHhcC
Confidence            356677789999999999999988653

>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II}

Probab=83.74  E-value=1.4  Score=27.16  Aligned_cols=24  Identities=8%  Similarity=0.015  Sum_probs=20.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       307 ~~~li~~~l~~~p~~Rps~~~~l~  330 (345)
T 3hko_A          307 ARDLLSNLLNRNVDERFDAMRALQ  330 (345)
T ss_dssp             HHHHHHHHSCSCTTTSCCHHHHHH
T ss_pred             HHHHHHHHcCCChhHCCCHHHHhc
Confidence            455667899999999999999876

>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A

Probab=83.56  E-value=0.91  Score=27.38  Aligned_cols=24  Identities=8%  Similarity=-0.111  Sum_probs=19.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++++
T Consensus       259 ~~~li~~~L~~dP~~R~t~~e~l~  282 (292)
T 3o0g_A          259 GRDLLQNLLKCNPVQRISAEEALQ  282 (292)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHhccChhhCCCHHHHhc
Confidence            445667899999999999988765

>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ...

Probab=83.49  E-value=0.73  Score=28.21  Aligned_cols=25  Identities=4%  Similarity=-0.045  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.++++
T Consensus       295 ~~~~li~~~L~~dP~~Rpta~e~l~  319 (330)
T 3nsz_A          295 EALDFLDKLLRYDHQSRLTAREAME  319 (330)
T ss_dssp             HHHHHHHTTSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHhc
Confidence            3556667899999999999998875

>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A*

Probab=83.37  E-value=0.98  Score=29.28  Aligned_cols=25  Identities=8%  Similarity=0.011  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       384 ~~~dli~~~L~~dP~~Rpta~e~L~  408 (429)
T 3kvw_A          384 LFLDFLKQCLEWDPAVRMTPGQALR  408 (429)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHCCCChhhCCCHHHHhC
Confidence            3566778999999999999998865

>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X*

Probab=83.37  E-value=0.92  Score=27.97  Aligned_cols=25  Identities=12%  Similarity=0.114  Sum_probs=20.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       298 ~l~~li~~~L~~dP~~Rps~~e~l~  322 (348)
T 2pml_X          298 EDIDFLKLFLRKNPAERITSEDALK  322 (348)
T ss_dssp             HHHHHHHHHCCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhc
Confidence            3455667899999999999998875

>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A*

Probab=83.32  E-value=0.88  Score=29.49  Aligned_cols=26  Identities=8%  Similarity=0.015  Sum_probs=22.0

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       270 ~~~~~li~~~L~~dP~~Rps~~eil~  295 (434)
T 2rio_A          270 AEATDLISQMIDHDPLKRPTAMKVLR  295 (434)
T ss_dssp             HHHHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHHHhhCChhhCCCHHHHHh
Confidence            45667778999999999999999864

>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A*

Probab=83.20  E-value=1.3  Score=28.39  Aligned_cols=28  Identities=11%  Similarity=-0.061  Sum_probs=22.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+-..|++.+|.+||+..++.+.|..
T Consensus       286 ~~~li~~~L~~dP~~R~sa~el~~~l~~  313 (336)
T 4g3f_A          286 TAQAIQEGLRKEPVHRASAMELRRKVGK  313 (336)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCCHhHCcCHHHHHHHHHH
Confidence            3445578999999999999999877643

>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens}

Probab=83.05  E-value=0.91  Score=27.58  Aligned_cols=25  Identities=12%  Similarity=0.230  Sum_probs=20.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       254 ~l~~li~~~l~~dp~~Rpt~~~ll~  278 (314)
T 3com_A          254 NFTDFVKQCLVKSPEQRATATQLLQ  278 (314)
T ss_dssp             HHHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHh
Confidence            3456667899999999999999864

>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus}

Probab=82.91  E-value=0.9  Score=28.39  Aligned_cols=24  Identities=17%  Similarity=0.304  Sum_probs=19.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       259 ~~~li~~~L~~dP~~R~s~~e~l~  282 (290)
T 3fpq_A          259 VKEIIEGCIRQNKDERYSIKDLLN  282 (290)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCChhHCcCHHHHhc
Confidence            445667899999999999988754

>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A*

Probab=82.74  E-value=0.78  Score=28.35  Aligned_cols=25  Identities=8%  Similarity=-0.012  Sum_probs=20.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       264 ~~~li~~~L~~dP~~Rpt~~~ll~h  288 (327)
T 3lm5_A          264 ATDFIQSLLVKNPEKRPTAEICLSH  288 (327)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHTTC
T ss_pred             HHHHHHHHcCCChhhCcCHHHHhCC
Confidence            4556788999999999999988654

>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A*

Probab=82.73  E-value=0.8  Score=27.57  Aligned_cols=25  Identities=4%  Similarity=-0.059  Sum_probs=20.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       259 ~l~~li~~~l~~dp~~Rps~~~ll~  283 (298)
T 1phk_A          259 TVKDLVSRFLVVQPQKRYTAEEALA  283 (298)
T ss_dssp             HHHHHHHHHCCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHHccCCcccCCCHHHHHh
Confidence            3556778899999999999988764

>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A

Probab=82.56  E-value=1.3  Score=27.12  Aligned_cols=24  Identities=8%  Similarity=0.007  Sum_probs=20.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       249 ~~~li~~~l~~dp~~Rps~~e~l~  272 (321)
T 2a2a_A          249 AKDFIRKLLVKETRKRLTIQEALR  272 (321)
T ss_dssp             HHHHHHTTSCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHcCCChhhCcCHHHHhc
Confidence            456677899999999999998875

>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A*

Probab=82.52  E-value=1  Score=26.86  Aligned_cols=25  Identities=4%  Similarity=-0.052  Sum_probs=20.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       237 ~~~~li~~~l~~dp~~R~s~~~~l~  261 (277)
T 3f3z_A          237 QAESLIRRLLTKSPKQRITSLQALE  261 (277)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            3455667899999999999988854

>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ...

Probab=82.39  E-value=1.1  Score=26.87  Aligned_cols=24  Identities=8%  Similarity=-0.022  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       239 ~~~li~~~l~~~p~~Rps~~~ll~  262 (284)
T 2vgo_A          239 SKDLISKLLRYHPPQRLPLKGVME  262 (284)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHhhcCHhhCCCHHHHhh
Confidence            445667899999999999999865

>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A

Probab=82.33  E-value=1.6  Score=27.47  Aligned_cols=24  Identities=8%  Similarity=-0.061  Sum_probs=20.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       336 ~~~li~~~L~~dP~~Rps~~ell~  359 (365)
T 2y7j_A          336 VKDLISRLLQVDPEARLTAEQALQ  359 (365)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHhc
Confidence            556777899999999999998875

>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B*

Probab=82.30  E-value=0.97  Score=28.55  Aligned_cols=24  Identities=29%  Similarity=0.353  Sum_probs=20.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       310 ~~~li~~~L~~dP~~Rpta~ell~  333 (389)
T 3gni_B          310 FHHFVEQCLQRNPDARPSASTLLN  333 (389)
T ss_dssp             HHHHHHHHTCSCTTTSCCHHHHTT
T ss_pred             HHHHHHHHhhcCcccCCCHHHHhc
Confidence            566778999999999999999864

>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens}

Probab=82.27  E-value=1.1  Score=27.37  Aligned_cols=24  Identities=8%  Similarity=0.116  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|+..+|.+||++.+++.
T Consensus       263 l~~li~~~l~~dp~~Rps~~~ll~  286 (326)
T 2x7f_A          263 FQSFIESCLVKNHSQRPATEQLMK  286 (326)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHhccChhhCCCHHHHhh
Confidence            445667899999999999999876

>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A*

Probab=81.68  E-value=1.1  Score=27.95  Aligned_cols=25  Identities=8%  Similarity=0.018  Sum_probs=21.3

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       293 ~~~li~~~L~~dP~~Rpt~~ell~h  317 (362)
T 3pg1_A          293 ALDLIAKMLEFNPQRRISTEQALRH  317 (362)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHTS
T ss_pred             HHHHHHHHhcCChhhCCCHHHHHcC
Confidence            5567788999999999999998754

>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A

Probab=81.65  E-value=2  Score=26.19  Aligned_cols=29  Identities=24%  Similarity=0.171  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+-..|++.+|.+| ++.+++..|+..
T Consensus       235 ~l~~li~~~l~~dP~~R-s~~el~~~L~~~  263 (286)
T 3uqc_A          235 QISAVAARSVQGDGGIR-SASTLLNLMQQA  263 (286)
T ss_dssp             HHHHHHHHHHCTTSSCC-CHHHHHHHHHHH
T ss_pred             HHHHHHHHHcccCCccC-CHHHHHHHHHHH
Confidence            35566788999999999 999999999753

>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A*

Probab=81.31  E-value=0.93  Score=28.51  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=19.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       282 l~~li~~~l~~dP~~Rps~~~ll~  305 (348)
T 1u5q_A          282 FRNFVDSCLQKIPQDRPTSEVLLK  305 (348)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHcccChhhCcCHHHHhh
Confidence            345667899999999999998864

>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7

Probab=81.25  E-value=1.4  Score=27.43  Aligned_cols=27  Identities=7%  Similarity=-0.092  Sum_probs=22.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISML   42 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l   42 (73)
                      .+..+-..|++.+|.+||++.+++..-
T Consensus       267 ~~~~li~~~L~~dP~~Rpt~~ell~h~  293 (346)
T 1ua2_A          267 DLLDLIQGLFLFNPCARITATQALKMK  293 (346)
T ss_dssp             HHHHHHHHHHCSSTTTSCCHHHHHTSG
T ss_pred             HHHHHHHHHhccChhhCCCHHHHhcCh
Confidence            455677889999999999999987653

>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7

Probab=81.22  E-value=1.3  Score=27.45  Aligned_cols=25  Identities=8%  Similarity=0.012  Sum_probs=21.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       233 ~~~~li~~~L~~dp~~Rpt~~e~l~  257 (321)
T 1tki_A          233 EAMDFVDRLLVKERKSRMTASEALQ  257 (321)
T ss_dssp             HHHHHHHTTSCSSGGGSCCHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHhc
Confidence            3456677899999999999999876

>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A

Probab=81.02  E-value=1.9  Score=27.78  Aligned_cols=25  Identities=4%  Similarity=-0.005  Sum_probs=21.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||++.+++.
T Consensus       375 ~~~~li~~~L~~dP~~Rps~~e~l~  399 (419)
T 3i6u_A          375 KALDLVKKLLVVDPKARFTTEEALR  399 (419)
T ss_dssp             HHHHHHHHHSCSSTTTSCCHHHHHH
T ss_pred             HHHHHHHHHccCChhHCcCHHHHhC
Confidence            4566778899999999999998865

>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A

Probab=81.00  E-value=1.5  Score=26.61  Aligned_cols=25  Identities=8%  Similarity=0.024  Sum_probs=20.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      .+..+-..|++.+|.+||+..+++.
T Consensus       237 ~~~~li~~~l~~dp~~Rps~~~~l~  261 (304)
T 2jam_A          237 SAKDFICHLLEKDPNERYTCEKALS  261 (304)
T ss_dssp             HHHHHHHHHHCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHhc
Confidence            3455667899999999999999875

>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ...

Probab=80.93  E-value=1.4  Score=27.58  Aligned_cols=26  Identities=8%  Similarity=0.106  Sum_probs=21.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      .+..+-..|++.+|.+||++.+++.-
T Consensus       289 ~~~~li~~~L~~dP~~R~t~~e~l~h  314 (364)
T 3qyz_A          289 KALDLLDKMLTFNPHKRIEVEQALAH  314 (364)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHTS
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHhcC
Confidence            35567788999999999999998763

>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A*

Probab=80.71  E-value=1.2  Score=27.51  Aligned_cols=25  Identities=12%  Similarity=-0.007  Sum_probs=20.5

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++..
T Consensus       238 ~~~li~~~L~~dP~~R~t~~eil~h  262 (323)
T 3tki_A          238 PLALLHKILVENPSARITIPDIKKD  262 (323)
T ss_dssp             HHHHHHHHSCSSTTTSCCHHHHTTC
T ss_pred             HHHHHHHHccCChhhCcCHHHHhhC
Confidence            4456678999999999999888654

>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A*

Probab=80.67  E-value=1.2  Score=27.61  Aligned_cols=25  Identities=4%  Similarity=-0.104  Sum_probs=21.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISM   41 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~   41 (73)
                      +..+-..|++.+|.+||++.+++.-
T Consensus       288 ~~~li~~~L~~dP~~R~t~~e~l~h  312 (351)
T 3mi9_A          288 ALDLIDKLLVLDPAQRIDSDDALNH  312 (351)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHTS
T ss_pred             HHHHHHHHhcCChhhCCCHHHHhCC
Confidence            5567788999999999999888763

>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A*

Probab=80.64  E-value=1.3  Score=27.88  Aligned_cols=24  Identities=4%  Similarity=-0.308  Sum_probs=19.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHH
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      .+..+-..|++.+|.+||++.+++
T Consensus       328 ~~~~li~~~L~~dP~~Rpt~~e~l  351 (371)
T 3q60_A          328 FVKTLIGRFLNFDRRRRLLPLEAM  351 (371)
T ss_dssp             HHHHHHHHHTCSSTTTCCCHHHHT
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHh
Confidence            344566789999999999998875

>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens}

Probab=80.17  E-value=1.1  Score=27.64  Aligned_cols=24  Identities=13%  Similarity=-0.057  Sum_probs=20.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       258 ~~~li~~~L~~dP~~R~t~~e~l~  281 (324)
T 3mtl_A          258 GADLLTKLLQFEGRNRISAEDAMK  281 (324)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHcCcCcccCCCHHHHhc
Confidence            456778899999999999999876

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	73
d1fmka3	285	c-src tyrosine kinase {Human (Homo sapiens) [TaxId	96.66
d1mqba_	283	epha2 receptor tyrosine kinase {Human (Homo sapien	96.39
d1sm2a_	263	Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie	96.35
d1p4oa_	308	Insulin-like growth factor 1 receptor {Human (Homo	96.26
d1r0pa_	311	Hepatocyte growth factor receptor, c-MET {Human (H	96.23
d1lufa_	301	Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax	96.23
d1qpca_	272	Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax	96.2
d1vjya_	303	Type I TGF-beta receptor R4 {Human (Homo sapiens)	96.15
d1t46a_	311	c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]	96.05
d1jpaa_	299	ephb2 receptor tyrosine kinase {Mouse (Mus musculu	96.0
d1fgka_	299	Fibroblast growth factor receptor 1 {Human (Homo s	95.91
d1uwha_	276	B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}	95.71
d1fvra_	309	Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}	95.66
d1byga_	262	Carboxyl-terminal src kinase (csk) {Human (Homo sa	95.63
d1opja_	287	Abelsone tyrosine kinase (abl) {Mouse (Mus musculu	95.53
d1ywna1	299	Vascular endothelial growth factor receptor 2 (kdr	95.5
d1xbba_	277	Tyrosine-protein kinase SYK {Human (Homo sapiens)	95.44
d1rjba_	325	Fl cytokine receptor {Human (Homo sapiens) [TaxId:	95.42
d1u46a_	273	Activated CDC42 kinase 1, ACK1 {Human (Homo sapien	95.28
d1u59a_	285	Tyrosine-protein kinase ZAP-70 {Human (Homo sapien	95.01
d1k2pa_	258	Bruton's tyrosine kinase (Btk) {Human (Homo sapien	95.0
d1xkka_	317	EGF receptor tyrosine kinase, Erbb-1 {Human (Homo	94.64
d1mp8a_	273	Focal adhesion kinase 1 (fak) {Human (Homo sapiens	94.23
d2java1	269	Serine/threonine-protein kinase Nek2 {Human (Homo	86.51
d1t4ha_	270	Protein kinase wnk1 {Human (Homo sapiens) [TaxId:	86.19
d1ckia_	299	Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax	85.07
d2j4za1	263	Aurora-related kinase 1 (aurora-2) {Human (Homo sa	84.76
d1o6ya_	277	Mycobacterial protein kinase PknB, catalytic domai	84.21
d1ob3a_	286	Cyclin-dependent PK, CDK2 {(Plasmodium falciparum)	83.22
d1phka_	277	gamma-subunit of glycogen phosphorylase kinase (Ph	83.03
d1nvra_	271	Cell cycle checkpoint kinase chk1 {Human (Homo sap	82.68
d1xwsa_	273	Proto-oncogene serine/threonine-protein kinase Pim	82.5
d1s9ja_	322	Dual specificity mitogen-activated protein kinase	81.6
d1q8ya_	362	Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T	81.49
d1u5ra_	309	Serine/threonine protein kinase TAO2 {Rat (Rattus	81.21
d1ua2a_	299	Cell division protein kinase 7, CDK7 {Human (Homo	80.5

>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.66  E-value=0.0019  Score=38.89  Aligned_cols=30  Identities=10%  Similarity=0.139  Sum_probs=26.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|.+.+|.+||++.+|+.+|+..
T Consensus       242 ~l~~li~~cl~~dP~~Rps~~~i~~~L~~~  271 (285)
T d1fmka3         242 SLHDLMCQCWRKEPEERPTFEYLQAFLEDY  271 (285)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHcccCHhHCcCHHHHHHHHhhh
Confidence            456677899999999999999999999864

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.39  E-value=0.0019  Score=38.56  Aligned_cols=30  Identities=17%  Similarity=0.295  Sum_probs=26.3

Q ss_pred             HHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           15 LRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        15 ~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      ..+.++..+|.+.+|.+||++.++++.|+.
T Consensus       240 ~~l~~li~~cl~~~p~~RPt~~eil~~L~~  269 (283)
T d1mqba_         240 SAIYQLMMQCWQQERARRPKFADIVSILDK  269 (283)
T ss_dssp             HHHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCcCCHhHCcCHHHHHHHHHH
Confidence            346678899999999999999999999875

>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.35  E-value=0.0017  Score=38.35  Aligned_cols=29  Identities=21%  Similarity=0.336  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.++++.|+.
T Consensus       230 ~l~~li~~cl~~~p~~Rps~~~il~~L~~  258 (263)
T d1sm2a_         230 HVYQIMNHCWKERPEDRPAFSRLLRQLAE  258 (263)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHHHH
Confidence            45677789999999999999999999874

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Insulin-like growth factor 1 receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.26  E-value=0.0022  Score=38.74  Aligned_cols=30  Identities=23%  Similarity=0.235  Sum_probs=26.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|.+.+|.+||++.+|+..|+..
T Consensus       263 ~l~~li~~cl~~~P~~RPs~~~il~~L~~~  292 (308)
T d1p4oa_         263 MLFELMRMCWQYNPKMRPSFLEIISSIKEE  292 (308)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHGGG
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            466778899999999999999999999864

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Hepatocyte growth factor receptor, c-MET
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.23  E-value=0.002  Score=39.16  Aligned_cols=30  Identities=27%  Similarity=0.259  Sum_probs=26.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|.+.+|.+||+|.+|++.|+..
T Consensus       262 ~l~~li~~cl~~dP~~RPs~~ei~~~L~~i  291 (311)
T d1r0pa_         262 PLYEVMLKCWHPKAEMRPSFSELVSRISAI  291 (311)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            456677899999999999999999998753

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Musk tyrosine kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=96.23  E-value=0.0019  Score=38.79  Aligned_cols=30  Identities=20%  Similarity=0.300  Sum_probs=26.7

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+|+++|+..
T Consensus       270 ~~~~li~~cl~~~P~~RPt~~ev~~~L~~i  299 (301)
T d1lufa_         270 ELYNLMRLCWSKLPADRPSFCSIHRILQRM  299 (301)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHHh
Confidence            466788999999999999999999999864

>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.20  E-value=0.0023  Score=38.00  Aligned_cols=29  Identities=24%  Similarity=0.335  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       238 ~l~~li~~cl~~~P~~Rpt~~ei~~~L~~  266 (272)
T d1qpca_         238 ELYQLMRLCWKERPEDRPTFDYLRSVLED  266 (272)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHhhh
Confidence            35567789999999999999999998864

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Type I TGF-beta receptor R4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.15  E-value=0.0026  Score=38.38  Aligned_cols=33  Identities=12%  Similarity=-0.003  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           12 LEILRCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        12 ~~~~~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +....+..+...|.+.+|.+||++.+|++.|..
T Consensus       262 ~~~~~l~~li~~cl~~dp~~Rps~~ei~~~L~~  294 (303)
T d1vjya_         262 EALRVMAKIMRECWYANGAARLTALRIKKTLSQ  294 (303)
T ss_dssp             HHHHHHHHHHHTTCCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            345567788999999999999999999998864

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-KIT receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.05  E-value=0.003  Score=38.17  Aligned_cols=29  Identities=7%  Similarity=0.221  Sum_probs=25.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+..+|.+.+|.+||++.+++++|+.
T Consensus       276 ~l~~Li~~cl~~dP~~RPs~~~il~~L~~  304 (311)
T d1t46a_         276 EMYDIMKTCWDADPLKRPTFKQIVQLIEK  304 (311)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            45667789999999999999999999974

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.00  E-value=0.004  Score=37.52  Aligned_cols=29  Identities=17%  Similarity=0.259  Sum_probs=25.3

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.+++..|+.
T Consensus       261 ~l~~li~~cl~~~P~~RPs~~ei~~~L~~  289 (299)
T d1jpaa_         261 ALHQLMLDCWQKDRNHRPKFGQIVNTLDK  289 (299)
T ss_dssp             HHHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            45667789999999999999999999864

>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fibroblast growth factor receptor 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.91  E-value=0.0034  Score=37.66  Aligned_cols=30  Identities=10%  Similarity=0.091  Sum_probs=26.2

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++..+|.+.+|..||++.+|++.|+..
T Consensus       265 ~l~~li~~cl~~dP~~Rps~~eil~~L~~i  294 (299)
T d1fgka_         265 ELYMMMRDCWHAVPSQRPTFKQLVEDLDRI  294 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHHHHH
Confidence            456778999999999999999999999753

>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.71  E-value=0.003  Score=37.74  Aligned_cols=30  Identities=7%  Similarity=0.161  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+..+...|.+.+|.+||++.+++..|+..
T Consensus       241 ~l~~li~~cl~~dp~~RPt~~~il~~Le~l  270 (276)
T d1uwha_         241 AMKRLMAECLKKKRDERPLFPQILASIELL  270 (276)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            355667899999999999999999998754

>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tie2 kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.66  E-value=0.005  Score=37.11  Aligned_cols=29  Identities=17%  Similarity=0.263  Sum_probs=24.6

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|+.
T Consensus       254 ~~~~li~~cl~~dP~~RPs~~eil~~L~~  282 (309)
T d1fvra_         254 EVYDLMRQCWREKPYERPSFAQILVSLNR  282 (309)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35556678999999999999999998865

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Carboxyl-terminal src kinase (csk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.63  E-value=0.0053  Score=36.36  Aligned_cols=29  Identities=17%  Similarity=0.041  Sum_probs=24.9

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++-..|.+.+|.+||++.++++.|+.
T Consensus       228 ~~~~li~~cl~~dP~~Rps~~~l~~~L~~  256 (262)
T d1byga_         228 AVYEVMKNCWHLDAAMRPSFLQLREQLEH  256 (262)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcccCHhHCcCHHHHHHHHHH
Confidence            34566689999999999999999999874

>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.53  E-value=0.0065  Score=36.32  Aligned_cols=30  Identities=17%  Similarity=0.193  Sum_probs=26.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhcC
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSSE   45 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~~   45 (73)
                      .+.++...|.+.+|.+||++.++++.|+..
T Consensus       244 ~l~~li~~cl~~dP~~Rps~~ei~~~L~~~  273 (287)
T d1opja_         244 KVYELMRACWQWNPSDRPSFAEIHQAFETM  273 (287)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHHH
Confidence            456677899999999999999999988754

>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Vascular endothelial growth factor receptor 2 (kdr)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.50  E-value=0.0062  Score=36.29  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=25.1

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.++++.|+.
T Consensus       265 ~l~~li~~cl~~dP~~Rpt~~eil~~L~~  293 (299)
T d1ywna1         265 EMYQTMLDCWHGEPSQRPTFSELVEHLGN  293 (299)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHH
Confidence            35667789999999999999999998864

>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase SYK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.44  E-value=0.009  Score=35.50  Aligned_cols=28  Identities=21%  Similarity=0.207  Sum_probs=24.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+...|.+.+|.+||++.+|+..|+.
T Consensus       239 ~~~li~~cl~~dp~~RPs~~~i~~~L~~  266 (277)
T d1xbba_         239 MYDLMNLCWTYDVENRPGFAAVELRLRN  266 (277)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHhhC
Confidence            4566789999999999999999988864

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.42  E-value=0.0073  Score=36.61  Aligned_cols=28  Identities=18%  Similarity=0.156  Sum_probs=24.4

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhh
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLS   43 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~   43 (73)
                      .+..+...|.+.+|.+||++.++++.|.
T Consensus       295 ~l~~li~~cl~~dP~~RPt~~ei~~~L~  322 (325)
T d1rjba_         295 EIYIIMQSCWAFDSRKRPSFPNLTSFLG  322 (325)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHh
Confidence            3556778999999999999999999985

>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Activated CDC42 kinase 1, ACK1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.28  E-value=0.0082  Score=35.62  Aligned_cols=29  Identities=17%  Similarity=0.234  Sum_probs=25.0

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+.++...|.+.+|.+||++.++.+.|..
T Consensus       243 ~l~~li~~cl~~dp~~RPt~~ei~~~L~~  271 (273)
T d1u46a_         243 DIYNVMVQCWAHKPEDRPTFVALRDFLLE  271 (273)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            35567789999999999999999998863

>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase ZAP-70
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.01  E-value=0.01  Score=35.46  Aligned_cols=29  Identities=17%  Similarity=0.049  Sum_probs=24.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.++++.|+.
T Consensus       240 ~l~~li~~cl~~~p~~RPs~~~i~~~L~~  268 (285)
T d1u59a_         240 ELYALMSDCWIYKWEDRPDFLTVEQRMRA  268 (285)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            34567789999999999999999998864

>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Bruton's tyrosine kinase (Btk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.00  E-value=0.013  Score=34.48  Aligned_cols=29  Identities=14%  Similarity=0.310  Sum_probs=24.8

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|..
T Consensus       229 ~l~~li~~cl~~dP~~RPt~~eil~~L~d  257 (258)
T d1k2pa_         229 KVYTIMYSCWHEKADERPTFKILLSNILD  257 (258)
T ss_dssp             HHHHHHHHTTCSSGGGSCCHHHHHHHHHC
T ss_pred             HHHHHHHHHccCCHhHCcCHHHHHHHhhC
Confidence            45567788999999999999999998853

>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: EGF receptor tyrosine kinase, Erbb-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.64  E-value=0.017  Score=34.81  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=24.5

Q ss_pred             HHHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           16 RCIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        16 ~~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      .+..+...|.+.+|.+||++.+++..|..
T Consensus       241 ~~~~li~~cl~~dP~~RPs~~eil~~l~~  269 (317)
T d1xkka_         241 DVYMIMVKCWMIDADSRPKFRELIIEFSK  269 (317)
T ss_dssp             HHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHhCCCChhhCcCHHHHHHHHHH
Confidence            45667789999999999999999887653

>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Focal adhesion kinase 1 (fak)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.23  E-value=0.024  Score=33.27  Aligned_cols=28  Identities=14%  Similarity=0.099  Sum_probs=24.0

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+-..|...+|.+||++.+++..|+.
T Consensus       238 ~~~li~~cl~~dp~~Rps~~ei~~~L~~  265 (273)
T d1mp8a_         238 LYSLMTKCWAYDPSRRPRFTELKAQLST  265 (273)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHHHHcCCCHhHCcCHHHHHHHHHH
Confidence            4556679999999999999999988864

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=86.51  E-value=0.26  Score=28.79  Aligned_cols=23  Identities=9%  Similarity=-0.005  Sum_probs=18.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      +..+-..|++.+|.+||++.+++
T Consensus       242 l~~li~~~L~~dp~~Rps~~ell  264 (269)
T d2java1         242 LNEIITRMLNLKDYHRPSVEEIL  264 (269)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHH
T ss_pred             HHHHHHHHcCCChhHCcCHHHHH
Confidence            34455789999999999998875

>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=86.19  E-value=0.25  Score=28.90  Aligned_cols=24  Identities=17%  Similarity=0.304  Sum_probs=19.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +.++-..|++.+|.+||++.+++.
T Consensus       242 ~~~li~~~l~~dp~~R~s~~ell~  265 (270)
T d1t4ha_         242 VKEIIEGCIRQNKDERYSIKDLLN  265 (270)
T ss_dssp             HHHHHHHHSCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCCHhHCcCHHHHhC
Confidence            455668999999999999988754

>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=85.07  E-value=0.46  Score=27.69  Aligned_cols=28  Identities=11%  Similarity=0.122  Sum_probs=22.9

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRASISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~~l~~   44 (73)
                      +..+-..|.+.+|.+||+..++.+.|+.
T Consensus       248 ~~~li~~cl~~~p~~RP~~~~i~~~l~~  275 (299)
T d1ckia_         248 FATYLNFCRSLRFDDKPDYSYLRQLFRN  275 (299)
T ss_dssp             HHHHHHHHHHSCTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHccCChhHCcCHHHHHHHHHH
Confidence            4556678999999999999988777753

>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=84.76  E-value=0.35  Score=28.11  Aligned_cols=24  Identities=8%  Similarity=0.054  Sum_probs=19.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++++
T Consensus       231 ~~~li~~~L~~dp~~R~t~~eil~  254 (263)
T d2j4za1         231 ARDLISRLLKHNPSQRPMLREVLE  254 (263)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCCHhHCcCHHHHHc
Confidence            334556899999999999998864

>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Mycobacterial protein kinase PknB, catalytic domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=84.21  E-value=0.57  Score=27.05  Aligned_cols=28  Identities=14%  Similarity=0.037  Sum_probs=21.9

Q ss_pred             HHHHHHHhcCcCccCCC-CHHHHHHHhhc
Q 038421           17 CIHVGLLCVQEYVHDRA-SISTVISMLSS   44 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP-~m~~vv~~l~~   44 (73)
                      +..+-..|++.+|.+|| ++.++...|..
T Consensus       245 l~~li~~~L~~dp~~R~~sa~~l~~~l~r  273 (277)
T d1o6ya_         245 LDAVVLKALAKNPENRYQTAAEMRADLVR  273 (277)
T ss_dssp             HHHHHHHHTCSSGGGSCSSHHHHHHHHHH
T ss_pred             HHHHHHHHccCCHhHCHhHHHHHHHHHHH
Confidence            44455789999999999 78888777753

>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK2
species: (Plasmodium falciparum) [TaxId: 5833]

Probab=83.22  E-value=0.5  Score=27.36  Aligned_cols=23  Identities=9%  Similarity=0.007  Sum_probs=19.1

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      +..+--.|++.+|.+||+..++.
T Consensus       257 ~~dli~~~L~~dP~~R~s~~ell  279 (286)
T d1ob3a_         257 GIDLLSKMLKLDPNQRITAKQAL  279 (286)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHH
T ss_pred             HHHHHHHHccCChhHCcCHHHHh
Confidence            44566789999999999998875

>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=83.03  E-value=0.32  Score=28.49  Aligned_cols=23  Identities=4%  Similarity=-0.077  Sum_probs=19.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv   39 (73)
                      +..+-..|++.+|.+||++.++.
T Consensus       246 ~~~li~~~L~~~p~~R~s~~eil  268 (277)
T d1phka_         246 VKDLVSRFLVVQPQKRYTAEEAL  268 (277)
T ss_dssp             HHHHHHHHCCSSGGGSCCHHHHT
T ss_pred             HHHHHHHHccCChhHCcCHHHHH
Confidence            45566899999999999998774

>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=82.68  E-value=0.45  Score=27.77  Aligned_cols=22  Identities=14%  Similarity=0.083  Sum_probs=17.9

Q ss_pred             HHHHHHhcCcCccCCCCHHHHH
Q 038421           18 IHVGLLCVQEYVHDRASISTVI   39 (73)
Q Consensus        18 ~~val~C~~~~p~~RP~m~~vv   39 (73)
                      ..+-..|++.+|.+||++.++.
T Consensus       237 ~~li~~~L~~dP~~R~t~~eil  258 (271)
T d1nvra_         237 LALLHKILVENPSARITIPDIK  258 (271)
T ss_dssp             HHHHHHHSCSSTTTSCCHHHHT
T ss_pred             HHHHHHHcCCChhHCcCHHHHh
Confidence            3455689999999999988773

>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Proto-oncogene serine/threonine-protein kinase Pim-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=82.50  E-value=0.45  Score=27.57  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=19.4

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++..
T Consensus       231 ~~~li~~~L~~dp~~R~s~~eil~  254 (273)
T d1xwsa_         231 CQHLIRWCLALRPSDRPTFEEIQN  254 (273)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHHT
T ss_pred             HHHHHHHHccCCHhHCcCHHHHhc
Confidence            344556899999999999998764

>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=81.60  E-value=0.67  Score=27.51  Aligned_cols=24  Identities=13%  Similarity=0.203  Sum_probs=19.8

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.++.+
T Consensus       274 ~~dli~~~L~~dP~~R~ta~e~L~  297 (322)
T d1s9ja_         274 FQDFVNKCLIKNPAERADLKQLMV  297 (322)
T ss_dssp             HHHHHHHHTCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHcCCChhHCcCHHHHhh
Confidence            445566899999999999999864

>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Sky1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=81.49  E-value=0.78  Score=27.17  Aligned_cols=27  Identities=11%  Similarity=-0.053  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHhcCcCccCCCCHHHHHH
Q 038421           14 ILRCIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        14 ~~~~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      -..+..+-..|+..+|.+||++.++++
T Consensus       301 ~~~~~dll~~mL~~dP~~Rpta~e~L~  327 (362)
T d1q8ya_         301 AKEISDFLSPMLQLDPRKRADAGGLVN  327 (362)
T ss_dssp             HHHHHHHHGGGGCSSTTTCBCHHHHHT
T ss_pred             CHHHHHHHHHHCCCChhHCcCHHHHhc
Confidence            345666778899999999999999865

>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine protein kinase TAO2
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=81.21  E-value=0.44  Score=28.35  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=19.6

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||++.+++.
T Consensus       243 ~~~li~~~L~~dP~~Rpt~~ell~  266 (309)
T d1u5ra_         243 FRNFVDSCLQKIPQDRPTSEVLLK  266 (309)
T ss_dssp             HHHHHHHHTCSSGGGSCCHHHHTT
T ss_pred             HHHHHHHHCcCChhHCcCHHHHHh
Confidence            344557899999999999999864

>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell division protein kinase 7, CDK7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=80.50  E-value=1.5  Score=25.38  Aligned_cols=24  Identities=4%  Similarity=-0.130  Sum_probs=20.2

Q ss_pred             HHHHHHHhcCcCccCCCCHHHHHH
Q 038421           17 CIHVGLLCVQEYVHDRASISTVIS   40 (73)
Q Consensus        17 ~~~val~C~~~~p~~RP~m~~vv~   40 (73)
                      +..+-..|++.+|.+||+..++..
T Consensus       256 ~~dll~~~L~~dP~~R~sa~e~L~  279 (299)
T d1ua2a_         256 LLDLIQGLFLFNPCARITATQALK  279 (299)
T ss_dssp             HHHHHHHHHCSSTTTSCCHHHHHT
T ss_pred             HHHHHHHHccCChhhCcCHHHHhC
Confidence            455667899999999999999875