BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038429
         (258 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1H0H|B Chain B, Tungsten Containing Formate Dehydrogenase From
          Desulfovibrio Gigas
 pdb|1H0H|L Chain L, Tungsten Containing Formate Dehydrogenase From
          Desulfovibrio Gigas
          Length = 214

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 3/54 (5%)

Query: 14 HPNPTTLTVNNG-HQRHPHFLTNQKQLKRIHAQMLST--DFFFDPYSASKLFTP 64
          H NP T T N G HQ  P F  +  +L R+H Q +    D+ F P        P
Sbjct: 25 HGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAP 78


>pdb|2WZS|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
          Length = 738

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 74  EYARKMFDQIPQPNLYTWNTLIRAYSSSDEPIQSFMIFLQLVYNSPYFPNEFTLPFVIKA 133
           E  +   +Q+ Q     WN ++         +  +  F   +Y S  FP +F   + + A
Sbjct: 246 ELGKDNIEQLAQKGKDAWNQVLGKIEVEGGNLDQYRTFYSCLYRSLLFPRKF---YELDA 302

Query: 134 AARPVQFR--VGQAIHG-MFED 152
             +P+ +    GQ + G MF D
Sbjct: 303 NGQPIHYSPYNGQVLPGYMFTD 324


>pdb|2WVZ|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW1|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
          Length = 744

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 74  EYARKMFDQIPQPNLYTWNTLIRAYSSSDEPIQSFMIFLQLVYNSPYFPNEFTLPFVIKA 133
           E  +   +Q+ Q     WN ++         +  +  F   +Y S  FP +F   + + A
Sbjct: 246 ELGKDNIEQLAQKGKDAWNQVLGKIEVEGGNLDQYRTFYSCLYRSLLFPRKF---YELDA 302

Query: 134 AARPVQFR--VGQAIHG-MFED 152
             +P+ +    GQ + G MF D
Sbjct: 303 NGQPIHYSPYNGQVLPGYMFTD 324


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,634,273
Number of Sequences: 62578
Number of extensions: 296535
Number of successful extensions: 909
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 909
Number of HSP's gapped (non-prelim): 3
length of query: 258
length of database: 14,973,337
effective HSP length: 97
effective length of query: 161
effective length of database: 8,903,271
effective search space: 1433426631
effective search space used: 1433426631
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)