BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038470
         (168 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ZU3|A Chain A, Structure Of The Enoyl-Acp Reductase Fabv From Yersinia
           Pestis With The Cofactor Nadh (Mr, Cleaved Histag)
 pdb|3ZU4|A Chain A, Structure Of The Enoyl-Acp Reductase Fabv From Yersinia
           Pestis With The Cofactor Nadh And The 2-Pyridone
           Inhibitor Pt172
 pdb|3ZU5|A Chain A, Structure Of The Enoyl-Acp Reductase Fabv From Yersinia
           Pestis With The Cofactor Nadh And The 2-Pyridone
           Inhibitor Pt173
          Length = 405

 Score = 26.9 bits (58), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 52  PPLPVFWSIRSRPKLEKRGNSGCWVQVYSKGDVYKD 87
           P +P++ S+  +   EK  + GC  QVYS   +YKD
Sbjct: 289 PMMPLYLSLLFKVMKEKGTHEGCIEQVYS---LYKD 321


>pdb|3ZU2|A Chain A, Structure Of The Enoyl-Acp Reductase Fabv From Yersinia
           Pestis With The Cofactor Nadh (Siras)
          Length = 422

 Score = 26.9 bits (58), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 52  PPLPVFWSIRSRPKLEKRGNSGCWVQVYSKGDVYKD 87
           P +P++ S+  +   EK  + GC  QVYS   +YKD
Sbjct: 306 PMMPLYLSLLFKVMKEKGTHEGCIEQVYS---LYKD 338


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.139    0.477 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,037,529
Number of Sequences: 62578
Number of extensions: 237326
Number of successful extensions: 397
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 15
Number of HSP's that attempted gapping in prelim test: 397
Number of HSP's gapped (non-prelim): 15
length of query: 168
length of database: 14,973,337
effective HSP length: 92
effective length of query: 76
effective length of database: 9,216,161
effective search space: 700428236
effective search space used: 700428236
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)