BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038502
         (100 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3D30|A Chain A, Structure Of An Expansin Like Protein From Bacillus
           Subtilis At 1.9a Resolution
 pdb|4FER|A Chain A, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Cellohexaose
 pdb|4FER|B Chain B, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Cellohexaose
 pdb|4FFT|A Chain A, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Mixed-Linkage Glucan
 pdb|4FFT|B Chain B, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Mixed-Linkage Glucan
 pdb|4FG2|A Chain A, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Cellotetraose
 pdb|4FG2|B Chain B, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Cellotetraose
 pdb|4FG4|A Chain A, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Hemithiocellodextrin
 pdb|4FG4|B Chain B, Crystal Structure Of Bacillus Subtilis Expansin (Exlx1) In
           Complex With Hemithiocellodextrin
          Length = 208

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 55  QGSSSVVVKIVDLCPAGSCRGTIDLSQEAFASIADTACGVINISYQ 100
           +G ++V V   DL P G  RG +DLS  AF  I +   G INI ++
Sbjct: 62  KGKTTVYV--TDLYPEG-ARGALDLSPNAFRKIGNMKDGKINIKWR 104


>pdb|2BH0|A Chain A, Crystal Structure Of A Semet Derivative Of Expa From
           Bacillus Subtilis At 2.5 Angstrom
          Length = 208

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 55  QGSSSVVVKIVDLCPAGSCRGTIDLSQEAFASIADTACGVINISYQ 100
           +G ++V V   DL P G  RG +DLS  AF  I +   G INI ++
Sbjct: 62  KGKTTVYV--TDLYPEG-ARGALDLSPNAFRKIGNXKDGKINIKWR 104


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,038,834
Number of Sequences: 62578
Number of extensions: 110062
Number of successful extensions: 200
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 195
Number of HSP's gapped (non-prelim): 7
length of query: 100
length of database: 14,973,337
effective HSP length: 66
effective length of query: 34
effective length of database: 10,843,189
effective search space: 368668426
effective search space used: 368668426
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)