Citrus Sinensis ID: 038524

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
KTSWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
ccccccccccccccccccEEEEcccccccccEEcEEEEcccccEEEEEEEccccEEEEEEEcccccEEEEEEEEEEEEEcccccccccEEEEEcccccccccEEEEEEEEEEcccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHEEEcccccccccccc
cccEEEccccHcccccccEEEEEccccccccccccEEccccccEEEEEEEccccEEEEEEccccccEEccccccEEEEEccHHHHcccEEEEEEcccccEEcEEEEEEEEEccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ktswryqsiqfndtsnnhvgidvnrltsvgsvpatyfsdekgtnkslklisgdpmqtWIDYMGSEKLHEIQClslstsvdLSQLLLDTMCVgfsaatgslatEHYILGCslnksgqagslnistlpsfhlptrkqqkLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
ktswryqsiqfndtsnnhvgidVNRLTSVGSVPatyfsdekgtnkslklisgDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLttvgaavyivrkkkydevyedwer
KTSWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
********IQFNDTSNNHVGIDVNRLTSVGSVPATYFSD*****KSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYE****
**SWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAG********************VTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWE*
KTSWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
*TSWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KTSWRYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q9LSR9 657 L-type lectin-domain cont yes no 0.96 0.255 0.460 2e-32
Q9M3E5 682 Putative L-type lectin-do no no 0.96 0.246 0.414 1e-27
Q9FJI4 675 Putative L-type lectin-do no no 0.965 0.250 0.419 2e-27
Q9SZD5 669 L-type lectin-domain cont no no 0.942 0.246 0.376 3e-27
Q9M3D8 664 L-type lectin-domain cont no no 0.96 0.253 0.403 1e-26
Q9M1G3 669 Probable L-type lectin-do no no 0.96 0.251 0.4 2e-26
Q9LSR8 766 L-type lectin-domain cont no no 0.942 0.215 0.398 2e-26
O80939 675 L-type lectin-domain cont no no 0.897 0.232 0.423 2e-26
Q9FIF1 674 Probable L-type lectin-do no no 0.914 0.237 0.381 4e-26
Q9M2S4 684 L-type lectin-domain cont no no 0.954 0.244 0.412 1e-25
>sp|Q9LSR9|LRK18_ARATH L-type lectin-domain containing receptor kinase I.8 OS=Arabidopsis thaliana GN=LECRK18 PE=2 SV=1 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 114/178 (64%), Gaps = 10/178 (5%)

Query: 7   QSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEK 66
           QS +F+D  NNHVGIDVN LTSV S PA+YFSD+KG NKS+ L+SGD +Q W+D+ G+  
Sbjct: 144 QSAEFDDIDNNHVGIDVNSLTSVESAPASYFSDKKGLNKSISLLSGDSIQVWVDFDGTVL 203

Query: 67  LHEIQCLS--------LSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQA- 117
              +  L         +S S++LS+++ D M VGFSAATG LA  HYILG S ++S  + 
Sbjct: 204 NVSLAPLGIRKPSQSLISRSMNLSEVIQDRMFVGFSAATGQLANNHYILGWSFSRSKASL 263

Query: 118 GSLNISTLPSFHLPTRKQQKLVTCVILVALVSVLTTVGAAVYIVRKKKYDEVYEDWER 175
            SL+IS LP    P  K   L+  +++V  + +L  +  A Y+ R+ KY EV E+WE+
Sbjct: 264 QSLDISKLPQVPHPKMKTSLLLILLLIVLGIILLVLLVGA-YLYRRNKYAEVREEWEK 320

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9M3E5|LRK11_ARATH Putative L-type lectin-domain containing receptor kinase I.1 OS=Arabidopsis thaliana GN=LECRK11 PE=3 SV=1 Back     alignment and function description
>sp|Q9FJI4|LK111_ARATH Putative L-type lectin-domain containing receptor kinase I.11 OS=Arabidopsis thaliana GN=LECRK111 PE=3 SV=1 Back     alignment and function description
>sp|Q9SZD5|LRK59_ARATH L-type lectin-domain containing receptor kinase V.9 OS=Arabidopsis thaliana GN=LECRK59 PE=2 SV=1 Back     alignment and function description
>sp|Q9M3D8|LRK13_ARATH L-type lectin-domain containing receptor kinase I.3 OS=Arabidopsis thaliana GN=LECRK13 PE=1 SV=1 Back     alignment and function description
>sp|Q9M1G3|LRK16_ARATH Probable L-type lectin-domain containing receptor kinase I.6 OS=Arabidopsis thaliana GN=LECRK16 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSR8|LRK19_ARATH L-type lectin-domain containing receptor kinase I.9 OS=Arabidopsis thaliana GN=LECRK19 PE=1 SV=2 Back     alignment and function description
>sp|O80939|LRK41_ARATH L-type lectin-domain containing receptor kinase IV.1 OS=Arabidopsis thaliana GN=LECRK41 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIF1|LRK21_ARATH Probable L-type lectin-domain containing receptor kinase II.1 OS=Arabidopsis thaliana GN=LECRK21 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4 OS=Arabidopsis thaliana GN=LECRKS4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
255559006 667 kinase, putative [Ricinus communis] gi|2 0.942 0.247 0.488 2e-38
224106407 675 predicted protein [Populus trichocarpa] 0.96 0.248 0.472 3e-37
224106419 607 predicted protein [Populus trichocarpa] 0.954 0.275 0.453 1e-35
255558978 662 kinase, putative [Ricinus communis] gi|2 0.965 0.255 0.434 4e-35
224059452 599 predicted protein [Populus trichocarpa] 0.954 0.278 0.502 1e-34
255559000 670 kinase, putative [Ricinus communis] gi|2 0.925 0.241 0.497 2e-34
225434861 675 PREDICTED: L-type lectin-domain containi 0.897 0.232 0.485 5e-34
224106425 674 predicted protein [Populus trichocarpa] 0.954 0.247 0.483 1e-33
297793585 659 lectin protein kinase family protein [Ar 0.96 0.254 0.455 1e-31
15239261 657 concanavalin A-like lectin kinase-like p 0.96 0.255 0.460 9e-31
>gi|255559006|ref|XP_002520526.1| kinase, putative [Ricinus communis] gi|223540368|gb|EEF41939.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 119/178 (66%), Gaps = 13/178 (7%)

Query: 10  QFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHE 69
           +F D   NHVG+DVN LTS+ SV A+YFS+ +  NKSL+L SG PMQ WIDY   EKL  
Sbjct: 156 EFGDIDGNHVGVDVNNLTSIQSVSASYFSETEEKNKSLELTSGRPMQMWIDYDEMEKLLN 215

Query: 70  IQCLS----------LSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAGS 119
           +              LST++DLS LLL++M VGFSA+TGS+++ HYILG S N+SGQA S
Sbjct: 216 VTLAPIERMKPEKPLLSTNIDLSALLLESMYVGFSASTGSVSSNHYILGWSFNRSGQAQS 275

Query: 120 LNISTLPSFHLPTRKQQKLVTCVI--LVALVSVLTTVGAAVYIVRKKKYDEVYEDWER 175
           L+ S LPS     + + KL   ++  LV ++ +L T+ A +YI+R K+Y+E+ EDWE+
Sbjct: 276 LDPSKLPSLPQERKSRGKLAMKIMLPLVIVIVLLMTISATIYIMR-KRYEEIREDWEQ 332

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106407|ref|XP_002314156.1| predicted protein [Populus trichocarpa] gi|222850564|gb|EEE88111.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106419|ref|XP_002314159.1| predicted protein [Populus trichocarpa] gi|222850567|gb|EEE88114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558978|ref|XP_002520512.1| kinase, putative [Ricinus communis] gi|223540354|gb|EEF41925.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224059452|ref|XP_002299853.1| predicted protein [Populus trichocarpa] gi|222847111|gb|EEE84658.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255559000|ref|XP_002520523.1| kinase, putative [Ricinus communis] gi|223540365|gb|EEF41936.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225434861|ref|XP_002280641.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106425|ref|XP_002314160.1| predicted protein [Populus trichocarpa] gi|222850568|gb|EEE88115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297793585|ref|XP_002864677.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297310512|gb|EFH40936.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15239261|ref|NP_200836.1| concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] gi|75335417|sp|Q9LSR9.1|LRK18_ARATH RecName: Full=L-type lectin-domain containing receptor kinase I.8; Short=LecRK-I.8; Flags: Precursor gi|8885578|dbj|BAA97508.1| receptor-like protein kinase [Arabidopsis thaliana] gi|34365777|gb|AAQ65200.1| At5g60280 [Arabidopsis thaliana] gi|62320942|dbj|BAD93956.1| receptor like protein kinase [Arabidopsis thaliana] gi|332009919|gb|AED97302.1| concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:2144025 657 AT5G60280 [Arabidopsis thalian 0.954 0.254 0.463 1e-33
TAIR|locus:2158309 675 AT5G60320 [Arabidopsis thalian 0.965 0.250 0.419 8.9e-29
TAIR|locus:2078332 682 AT3G45330 [Arabidopsis thalian 0.954 0.244 0.423 2.5e-28
TAIR|locus:2085587 669 AT3G45440 [Arabidopsis thalian 0.954 0.249 0.414 3.9e-28
TAIR|locus:2078337 664 AT3G45410 [Arabidopsis thalian 0.965 0.254 0.405 3.6e-27
TAIR|locus:2040681 675 RLK "receptor lectin kinase" [ 0.954 0.247 0.430 2.2e-26
TAIR|locus:2168509 674 AT5G59260 [Arabidopsis thalian 0.56 0.145 0.417 2.8e-26
TAIR|locus:2099941 684 AT3G55550 [Arabidopsis thalian 0.954 0.244 0.412 1.6e-25
TAIR|locus:2119936 669 AT4G29050 [Arabidopsis thalian 0.965 0.252 0.379 4.2e-25
TAIR|locus:2144045 766 LecRK-I.9 "lectin receptor kin 0.942 0.215 0.398 4.1e-24
TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 1.0e-33, P = 1.0e-33
 Identities = 83/179 (46%), Positives = 115/179 (64%)

Query:     7 QSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEK 66
             QS +F+D  NNHVGIDVN LTSV S PA+YFSD+KG NKS+ L+SGD +Q W+D+ G+  
Sbjct:   144 QSAEFDDIDNNHVGIDVNSLTSVESAPASYFSDKKGLNKSISLLSGDSIQVWVDFDGTVL 203

Query:    67 LHEIQCLSL--------STSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKS-GQA 117
                +  L +        S S++LS+++ D M VGFSAATG LA  HYILG S ++S    
Sbjct:   204 NVSLAPLGIRKPSQSLISRSMNLSEVIQDRMFVGFSAATGQLANNHYILGWSFSRSKASL 263

Query:   118 GSLNISTLPSFHLPTRKQQKLVTCVILV-ALVSVLTTVGAAVYIVRKKKYDEVYEDWER 175
              SL+IS LP    P  K   L+  +++V  ++ ++  VGA  Y+ R+ KY EV E+WE+
Sbjct:   264 QSLDISKLPQVPHPKMKTSLLLILLLIVLGIILLVLLVGA--YLYRRNKYAEVREEWEK 320
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2158309 AT5G60320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078332 AT3G45330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085587 AT3G45440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078337 AT3G45410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040681 RLK "receptor lectin kinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168509 AT5G59260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119936 AT4G29050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144045 LecRK-I.9 "lectin receptor kinase I.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IX.4059.1
hypothetical protein (607 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 6e-30
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 2e-29
cd01951223 cd01951, lectin_L-type, legume lectins 2e-08
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information 
 Score =  108 bits (273), Expect = 6e-30
 Identities = 47/115 (40%), Positives = 63/115 (54%), Gaps = 16/115 (13%)

Query: 6   YQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSE 65
           + + +FND  +NHVGIDVN + SV S  A+           L L SG P+Q WIDY GS 
Sbjct: 125 FLNPEFNDIDDNHVGIDVNSIISVASESAS--------FVPLDLNSGKPIQVWIDYDGSS 176

Query: 66  K--------LHEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLN 112
           K         ++ +   LS SVDLS +L + + VGFSA+TG     HY+L  S +
Sbjct: 177 KRLSVTLAYPNKPKRPLLSASVDLSTVLPEWVYVGFSASTGGATESHYVLSWSFS 231

Length = 231
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 99.95
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 99.94
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.88
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 97.99
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 97.53
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 96.95
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 96.45
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 96.3
KOG3839351 consensus Lectin VIP36, involved in the transport 95.62
PF15065350 NCU-G1: Lysosomal transcription factor, NCU-G1 95.26
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 94.57
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 93.36
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 89.73
PF15102146 TMEM154: TMEM154 protein family 89.46
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 87.45
PF14610189 DUF4448: Protein of unknown function (DUF4448) 85.33
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 85.04
PF05454 290 DAG1: Dystroglycan (Dystrophin-associated glycopro 83.82
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 83.19
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=99.95  E-value=2.4e-28  Score=203.25  Aligned_cols=102  Identities=47%  Similarity=0.685  Sum_probs=90.5

Q ss_pred             eeecCCCCCCCCCeeEEEcCCCccccceecceecCCCCCcccccccCCCcEEEEEEeeCCCceEEEee----------ee
Q 038524            5 RYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQC----------LS   74 (175)
Q Consensus         5 T~~n~e~~D~~~nHVGIdiNs~~S~~s~~~~~~~~~~~~~~~~~l~sG~~~~vwIdYd~~~~~L~v~l----------Pl   74 (175)
                      |++|.+++||++||||||+|++.|..+..   |+.     ..+.|.+|+.++|||+||+.+++|+|.+          |+
T Consensus       124 T~~n~~~~D~~~nHigIdvn~~~S~~~~~---~~~-----~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~  195 (236)
T cd06899         124 TFQNPEFGDPDDNHVGIDVNSLVSVKAGY---WDD-----DGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPL  195 (236)
T ss_pred             cccCcccCCCCCCeEEEEcCCcccceeec---ccc-----ccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCE
Confidence            67888889999999999999987776544   322     2345789999999999999999999988          68


Q ss_pred             eeeeecCCccCCCceEEEEEeecCCceeeeEEeeeEEeeC
Q 038524           75 LSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKS  114 (175)
Q Consensus        75 ls~~idLs~~l~~~~yVGFSAsTG~~~~~h~IlsWsF~~~  114 (175)
                      |+.++||+.+|+++||||||||||...|.|+|++|+|++.
T Consensus       196 ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         196 LSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             EEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            9999999999999999999999999999999999999875

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF14610 DUF4448: Protein of unknown function (DUF4448) Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-04
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-04
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 5e-04
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 5e-04
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 5e-04
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 6e-04
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 23/109 (21%)
Query: 6   YQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSE 65
           Y++  F D  + H+GIDVN + S+ +V                L +G+  +  I Y  S 
Sbjct: 131 YENTVFLDPPDTHIGIDVNSIKSIKTV-------------KWDLANGEAAKVLITYDSSA 177
Query: 66  KL--------HEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYI 106
           KL               LS  VDL  +L + + +GFSAATG  A+  YI
Sbjct: 178 KLLVAALVYPSSKTSFILSDVVDLKSVLPEWVSIGFSAATG--ASSGYI 224
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 2e-22
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 7e-22
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 3e-21
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 9e-21
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 3e-20
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 4e-20
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 6e-20
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 2e-19
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 1e-18
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 3e-18
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 3e-18
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 3e-18
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 6e-18
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 7e-18
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 1e-17
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 2e-17
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 3e-17
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 9e-17
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 2e-16
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 7e-16
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 8e-16
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 1e-15
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 2e-14
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 3e-13
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 8e-09
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 7e-08
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
 Score = 89.5 bits (221), Expect = 2e-22
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 18/130 (13%)

Query: 6   YQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSE 65
           + +  F + S  H+GI+VN + SV +                 + SG      I Y GS 
Sbjct: 132 WTNPNFPEPSYRHIGINVNSIVSVATKRWEDSD----------IFSGKIATARISYDGSA 181

Query: 66  KL-------HEIQCLSLSTSVDLSQLLLDTMCVGFSAATGSLATE-HYILGCSLNKSGQA 117
           ++        +     LS SVD+ Q L +++ VG SA+TG+      YIL    + + Q+
Sbjct: 182 EILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNLQS 241

Query: 118 GSLNISTLPS 127
            S+  +  P 
Sbjct: 242 TSVKAAMEPE 251
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 99.97
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 99.97
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 99.97
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 99.97
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 99.97
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 99.97
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 99.97
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 99.97
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 99.97
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 99.97
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 99.97
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 99.97
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 99.97
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 99.96
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 99.96
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 99.96
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 99.96
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 99.96
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 99.96
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 99.95
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 99.95
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 99.95
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.72
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.67
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.65
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.57
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.2
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.09
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 96.82
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 90.06
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 88.32
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 84.3
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-36  Score=233.38  Aligned_cols=98  Identities=26%  Similarity=0.333  Sum_probs=91.4

Q ss_pred             eeecCCCCCCCCCeeEEEcCCCccccceecceecCCCCCcccccccCCCcEEEEEEeeCCCceEEEee-------eeeee
Q 038524            5 RYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQC-------LSLST   77 (175)
Q Consensus         5 T~~n~e~~D~~~nHVGIdiNs~~S~~s~~~~~~~~~~~~~~~~~l~sG~~~~vwIdYd~~~~~L~v~l-------Plls~   77 (175)
                      |++|+||+||++||||||+||+.|.++.++             +|.+|+.|+|||+||+.+++|+|.+       |+|+.
T Consensus        10 T~~N~e~~Dp~~nHVGIdvNsi~S~~s~~~-------------~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~~~p~ls~   76 (133)
T 1qmo_E           10 TYLNPDYGDPNYIHIGIDVNSIRSKVTAKW-------------DWQNGKIATAHISYNSVSKRLSVTSYYAGSKPATLSY   76 (133)
T ss_dssp             CSCCGGGTCCSSCEEEEEESSSSCSEEEEC-------------CCCTTSCEEEEEEEETTTTEEEEEEECSSSCCEEEEE
T ss_pred             CCcCccccCCCCCeeEEecccccccceeee-------------EEcCCCEEEEEEEEeCCCcEEEEEEccCCCccceEEE
Confidence            678999999999999999999999988763             3679999999999999999999988       69999


Q ss_pred             eecCCccCCCceEEEEEeecCCceeeeEEeeeEEeeCC
Q 038524           78 SVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSG  115 (175)
Q Consensus        78 ~idLs~~l~~~~yVGFSAsTG~~~~~h~IlsWsF~~~~  115 (175)
                      ++||+++|+|+||||||||||...|.|+||+|+|+++.
T Consensus        77 ~vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l  114 (133)
T 1qmo_E           77 DIELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSL  114 (133)
T ss_dssp             ECCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEE
T ss_pred             eechHHhccccEEEEEEeccCCCcceeEEEEEEEEeeC
Confidence            99999999999999999999999999999999999864
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 2e-23
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 3e-20
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 7e-20
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 8e-20
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 1e-18
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 1e-18
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 4e-18
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 1e-17
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 3e-17
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 6e-17
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 1e-16
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 1e-16
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-16
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 2e-15
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-15
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 4e-15
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 8e-15
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 1e-14
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 4e-13
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 2e-12
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-12
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 5e-09
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Concanavalin A
species: Jack bean (Canavalia ensiformis) [TaxId: 3823]

 Score = 90.4 bits (224), Expect = 2e-23
 Identities = 28/134 (20%), Positives = 47/134 (35%), Gaps = 20/134 (14%)

Query: 6   YQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSE 65
           Y +    D S  H+GID+  + S  +                 + +G      I Y   +
Sbjct: 12  YPNTDIGDPSYPHIGIDIKSVRSKKTAK-------------WNMQNGKVGTAHIIYNSVD 58

Query: 66  KLHEI-------QCLSLSTSVDLSQLLLDTMCVGFSAATGSLATEHYILGCSLNKSGQAG 118
           K              ++S  VDL  +L + + VG SA+TG     + IL  S     ++ 
Sbjct: 59  KRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSN 118

Query: 119 SLNISTLPSFHLPT 132
           S + +    F    
Sbjct: 119 STHETNALHFMFNQ 132
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 99.96
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.96
d1leda_243 Legume lectin {West-central african legume (Griffo 99.96
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 99.95
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 99.95
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 99.95
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 99.95
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 99.94
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 99.94
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 99.94
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 99.94
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 99.94
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.93
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 99.93
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 99.92
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 99.92
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.92
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.9
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.89
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.87
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.87
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.09
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 98.09
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 97.66
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]

Probab=99.96  E-value=1.8e-30  Score=213.16  Aligned_cols=100  Identities=31%  Similarity=0.443  Sum_probs=90.9

Q ss_pred             eeecCCCCCCCCCeeEEEcCCCccccceecceecCCCCCcccccccCCCcEEEEEEeeCCCceEEEee-------eeeee
Q 038524            5 RYQSIQFNDTSNNHVGIDVNRLTSVGSVPATYFSDEKGTNKSLKLISGDPMQTWIDYMGSEKLHEIQC-------LSLST   77 (175)
Q Consensus         5 T~~n~e~~D~~~nHVGIdiNs~~S~~s~~~~~~~~~~~~~~~~~l~sG~~~~vwIdYd~~~~~L~v~l-------Plls~   77 (175)
                      |++|.+++||++||||||+|++.|..+.++.          ..+|.+|+.++|||+||+.+|+|+|++       |+|++
T Consensus       128 T~~n~~~~D~~~nHIgIdvns~~s~~~~~~~----------~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~~~~~ls~  197 (236)
T d1hqla_         128 TWTNPNFPEPSYRHIGINVNSIVSVATKRWE----------DSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSH  197 (236)
T ss_dssp             CSCCSSSCCCSSCEEEEEESSSSCSEEEECC----------HHHHTSCSCEEEEEEEETTTTEEEEEEEETTTEEEEEEE
T ss_pred             CccCCCCCCCCCCEEEEEcCCcccccccccc----------cccccCCCEEEEEEEEeCCCcEEEEEEecCCCCCeeEEE
Confidence            6788899999999999999999988776532          567899999999999999999999988       79999


Q ss_pred             eecCCccCCCceEEEEEeecCCc-eeeeEEeeeEEeeC
Q 038524           78 SVDLSQLLLDTMCVGFSAATGSL-ATEHYILGCSLNKS  114 (175)
Q Consensus        78 ~idLs~~l~~~~yVGFSAsTG~~-~~~h~IlsWsF~~~  114 (175)
                      .+||+++|+++||||||||||.. .+.|+|++|+|+++
T Consensus       198 ~vdL~~~l~~~v~vGFSasTG~~~~~~h~I~sWsF~s~  235 (236)
T d1hqla_         198 SVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSN  235 (236)
T ss_dssp             ECCGGGTSCSEEEEEEEEECCSCCCEEEEEEEEEEEEE
T ss_pred             EeCHHHhCCCcEEEEEEeECCCCCceEEEEEEeEeEec
Confidence            99999999999999999999975 57899999999874
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure