Query         038528
Match_columns 91
No_of_seqs    102 out of 207
Neff          5.5 
Searched_HMMs 46136
Date          Fri Mar 29 12:00:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038528.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038528hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00212 glutelin; Provisional  99.9 6.1E-26 1.3E-30  183.9   8.0   82    6-90    144-244 (493)
  2 smart00835 Cupin_1 Cupin. This  99.3   1E-11 2.2E-16   85.3   8.2   74    8-90     73-146 (146)
  3 PF00190 Cupin_1:  Cupin;  Inte  99.2   2E-11 4.3E-16   83.7   6.6   58   13-90     87-144 (144)
  4 TIGR03404 bicupin_oxalic bicup  98.4 6.3E-07 1.4E-11   70.7   6.7   72    7-90    286-357 (367)
  5 PLN00212 glutelin; Provisional  98.1 8.6E-06 1.9E-10   66.9   6.4   79    2-90    383-463 (493)
  6 TIGR03404 bicupin_oxalic bicup  98.0 2.4E-05 5.3E-10   61.8   7.0   70   11-90    111-180 (367)
  7 COG0662 {ManC} Mannose-6-phosp  97.8   5E-05 1.1E-09   51.4   5.4   41    9-52     74-114 (127)
  8 PF07883 Cupin_2:  Cupin domain  97.7 0.00014 3.1E-09   42.9   5.1   36    9-47     36-71  (71)
  9 COG1917 Uncharacterized conser  97.3 0.00056 1.2E-08   45.7   4.6   38    9-49     81-118 (131)
 10 PRK04190 glucose-6-phosphate i  97.1  0.0017 3.7E-08   47.5   6.0   40    9-51    119-158 (191)
 11 TIGR03214 ura-cupin putative a  97.1  0.0016 3.5E-08   49.1   5.9   41    8-51    216-256 (260)
 12 PRK13290 ectC L-ectoine syntha  96.6  0.0066 1.4E-07   41.5   5.4   37    9-50     74-110 (125)
 13 COG2140 Thermophilic glucose-6  96.5  0.0066 1.4E-07   45.4   5.4   43    7-52    123-165 (209)
 14 PRK09943 DNA-binding transcrip  96.2   0.014 3.1E-07   41.2   5.4   38    9-49    145-182 (185)
 15 PRK11171 hypothetical protein;  95.9   0.022 4.8E-07   43.0   5.8   43    8-53    221-263 (266)
 16 PRK15460 cpsB mannose-1-phosph  95.9   0.019 4.1E-07   47.1   5.7   39    9-50    423-461 (478)
 17 TIGR01479 GMP_PMI mannose-1-ph  95.8   0.025 5.5E-07   45.7   5.7   39    9-50    414-452 (468)
 18 COG3837 Uncharacterized conser  95.6   0.022 4.8E-07   41.1   4.4   41    9-52     81-123 (161)
 19 PF12852 Cupin_6:  Cupin         95.5    0.03 6.6E-07   39.2   4.8   34    3-36     47-81  (186)
 20 PF02373 JmjC:  JmjC domain, hy  95.5   0.015 3.3E-07   37.1   2.9   25   12-36     83-107 (114)
 21 PF06560 GPI:  Glucose-6-phosph  95.5   0.045 9.8E-07   40.0   5.6   40   10-52    110-149 (182)
 22 PF01050 MannoseP_isomer:  Mann  95.0    0.07 1.5E-06   37.6   5.2   37    9-48    101-137 (151)
 23 PF03079 ARD:  ARD/ARD' family;  94.9    0.11 2.4E-06   37.0   6.2   34   12-48    117-150 (157)
 24 PRK11171 hypothetical protein;  94.5    0.12 2.5E-06   39.1   5.8   37    9-48    100-136 (266)
 25 TIGR03214 ura-cupin putative a  94.0    0.16 3.4E-06   38.3   5.5   36    9-47     97-132 (260)
 26 PF02311 AraC_binding:  AraC-li  93.5    0.32 6.9E-06   30.6   5.6   39    8-49     39-77  (136)
 27 COG1791 Uncharacterized conser  93.1    0.36 7.9E-06   35.4   5.8   40    8-50    116-155 (181)
 28 PF05899 Cupin_3:  Protein of u  93.0   0.087 1.9E-06   32.5   2.3   27    5-31     39-65  (74)
 29 PF02041 Auxin_BP:  Auxin bindi  91.3    0.64 1.4E-05   33.7   5.3   41    6-48     87-127 (167)
 30 PF11699 CENP-C_C:  Mif2/CENP-C  91.2    0.71 1.5E-05   29.8   5.0   30    8-37     49-78  (85)
 31 TIGR03037 anthran_nbaC 3-hydro  90.8    0.54 1.2E-05   33.8   4.5   31    5-35     65-95  (159)
 32 PF13621 Cupin_8:  Cupin-like d  90.6     0.4 8.6E-06   33.9   3.7   24   10-33    209-232 (251)
 33 PRK13264 3-hydroxyanthranilate  90.5    0.53 1.1E-05   34.4   4.3   30    4-33     70-99  (177)
 34 PF06052 3-HAO:  3-hydroxyanthr  90.0    0.21 4.6E-06   35.7   1.9   35    2-36     67-101 (151)
 35 PRK15457 ethanolamine utilizat  89.2    0.95 2.1E-05   34.5   4.9   38    8-51    191-229 (233)
 36 COG3450 Predicted enzyme of th  88.9    0.49 1.1E-05   32.4   3.0   25    4-28     76-100 (116)
 37 TIGR02272 gentisate_1_2 gentis  88.8    0.76 1.7E-05   36.4   4.4   38    9-49    119-156 (335)
 38 PF08007 Cupin_4:  Cupin superf  88.4    0.61 1.3E-05   35.9   3.6   30   10-43    176-205 (319)
 39 TIGR00218 manA mannose-6-phosp  85.7    0.47   1E-05   36.2   1.6   20   10-29    151-170 (302)
 40 PF06249 EutQ:  Ethanolamine ut  84.5     3.3 7.1E-05   29.5   5.3   39    8-51    111-149 (152)
 41 PRK10296 DNA-binding transcrip  81.8     3.3 7.3E-05   30.3   4.7   28    8-35     59-86  (278)
 42 PRK10572 DNA-binding transcrip  81.1     4.1 8.9E-05   30.0   5.0   29    8-36     65-93  (290)
 43 COG4101 Predicted mannose-6-ph  80.5     1.6 3.5E-05   30.7   2.4   31   13-46     91-121 (142)
 44 COG4297 Uncharacterized protei  80.3     1.4   3E-05   31.7   2.1   25    9-33     84-108 (163)
 45 COG1482 ManA Phosphomannose is  79.0     1.5 3.3E-05   34.5   2.2   22    9-30    157-178 (312)
 46 TIGR02451 anti_sig_ChrR anti-s  77.6     2.7 5.9E-05   30.9   3.0   36   12-50    163-198 (215)
 47 PRK13501 transcriptional activ  77.5     4.2 9.2E-05   30.0   4.1   27    8-34     54-80  (290)
 48 PRK15131 mannose-6-phosphate i  76.0     2.2 4.8E-05   34.2   2.3   23    9-31    236-258 (389)
 49 PF06339 Ectoine_synth:  Ectoin  74.7     7.2 0.00016   27.2   4.3   46    6-52     63-112 (126)
 50 COG2850 Uncharacterized conser  74.4     1.2 2.6E-05   36.1   0.4   23   13-35    182-204 (383)
 51 KOG2107 Uncharacterized conser  74.3     2.3 5.1E-05   31.2   1.9   23   13-35    119-141 (179)
 52 PRK13503 transcriptional activ  72.9     3.4 7.4E-05   29.9   2.5   26    8-33     51-76  (278)
 53 PRK13502 transcriptional activ  72.5     7.4 0.00016   28.4   4.2   26    8-33     54-79  (282)
 54 PF05118 Asp_Arg_Hydrox:  Aspar  72.5      10 0.00022   26.5   4.7   28   10-37    124-151 (163)
 55 PRK13500 transcriptional activ  72.5     7.9 0.00017   29.3   4.5   27    8-34     84-110 (312)
 56 TIGR02297 HpaA 4-hydroxyphenyl  71.5       7 0.00015   28.5   3.9   28    9-36     61-88  (287)
 57 PF11142 DUF2917:  Protein of u  63.4      13 0.00027   22.5   3.3   30    3-32     28-58  (63)
 58 PRK15450 signal transduction p  61.7     3.1 6.8E-05   27.1   0.4   35   10-50     36-70  (85)
 59 TIGR02272 gentisate_1_2 gentis  61.4      18 0.00038   28.8   4.6   24   10-33    288-311 (335)
 60 PF13734 Inhibitor_I69:  Spi pr  57.5      12 0.00026   24.6   2.6   21   22-45     37-57  (96)
 61 PF12973 Cupin_7:  ChrR Cupin-l  57.4     8.4 0.00018   24.0   1.8   22   12-33     60-81  (91)
 62 PF04209 HgmA:  homogentisate 1  55.0      17 0.00036   29.9   3.6   31   12-47    166-196 (424)
 63 PF09347 DUF1989:  Domain of un  54.0      20 0.00044   25.5   3.5   32    4-35      4-40  (166)
 64 PF14955 MRP-S24:  Mitochondria  53.8      24 0.00051   25.0   3.7   35   41-86     84-118 (136)
 65 PRK10371 DNA-binding transcrip  53.8      22 0.00048   26.8   3.9   28    8-35     62-89  (302)
 66 cd00433 Peptidase_M17 Cytosol   51.4      19 0.00041   29.7   3.3   35    8-44    296-330 (468)
 67 PRK00913 multifunctional amino  49.4      22 0.00047   29.6   3.4   33   10-44    312-344 (483)
 68 PF11183 PmrD:  Polymyxin resis  48.8      22 0.00048   23.1   2.7   33   11-46     37-69  (82)
 69 PHA02984 hypothetical protein;  47.5      60  0.0013   25.6   5.4   45    5-53    110-154 (286)
 70 PF02787 CPSase_L_D3:  Carbamoy  47.4     9.3  0.0002   25.9   0.9   20   71-90     71-90  (123)
 71 TIGR03424 urea_degr_1 urea car  47.2      31 0.00068   25.4   3.7   33    4-36      8-45  (198)
 72 PRK05341 homogentisate 1,2-dio  47.1      18 0.00039   29.9   2.6   20   12-31    174-193 (438)
 73 TIGR01015 hmgA homogentisate 1  46.3      19 0.00041   29.7   2.6   22   13-34    169-190 (429)
 74 PLN02658 homogentisate 1,2-dio  45.1      20 0.00044   29.6   2.6   21   12-32    167-187 (435)
 75 PRK05015 aminopeptidase B; Pro  43.0      31 0.00066   28.5   3.3   34    9-44    248-281 (424)
 76 PF00122 E1-E2_ATPase:  E1-E2 A  42.3      11 0.00025   26.6   0.7   18   10-27     48-65  (230)
 77 TIGR02988 YaaA_near_RecF S4 do  42.0      16 0.00034   21.1   1.2   15    9-23     45-59  (59)
 78 PHA00144 major head protein     41.4      28  0.0006   28.8   2.8   14   73-86    255-268 (438)
 79 KOG3706 Uncharacterized conser  38.8      19 0.00042   30.7   1.6   21   13-33    384-404 (629)
 80 PLN02288 mannose-6-phosphate i  38.3      23  0.0005   28.7   1.9   20   10-29    251-270 (394)
 81 PRK11507 ribosome-associated p  37.2      21 0.00045   22.4   1.2   18    7-24     46-63  (70)
 82 PRK09685 DNA-binding transcrip  36.7      66  0.0014   23.6   4.1   28    8-35     87-114 (302)
 83 cd00060 FHA Forkhead associate  36.2      41  0.0009   20.1   2.5   23   10-32     79-101 (102)
 84 COG2501 S4-like RNA binding pr  35.5      24 0.00053   22.3   1.3   19    7-25     46-64  (73)
 85 PF15517 TBPIP_N:  TBP-interact  35.3      29 0.00064   23.2   1.7   16   18-33     64-79  (99)
 86 TIGR03028 EpsE polysaccharide   34.1      49  0.0011   24.3   3.0   20   11-30    148-167 (239)
 87 PF07506 RepB:  RepB plasmid pa  33.9      27 0.00058   24.8   1.5   19   71-89     20-38  (185)
 88 PF09700 Cas_Cmr3:  CRISPR-asso  33.9      29 0.00062   26.6   1.8   17   20-36    307-323 (351)
 89 PF07103 DUF1365:  Protein of u  33.4      63  0.0014   24.4   3.5   33   24-61    105-138 (254)
 90 TIGR01888 cas_cmr3 CRISPR-asso  32.8      25 0.00055   27.2   1.3   22   15-36    288-309 (337)
 91 PF13275 S4_2:  S4 domain; PDB:  32.7      41 0.00088   20.6   2.0   17    7-23     42-58  (65)
 92 COG3508 HmgA Homogentisate 1,2  32.5      38 0.00082   27.9   2.3   24   11-34    165-188 (427)
 93 PF07497 Rho_RNA_bind:  Rho ter  32.5      22 0.00048   22.6   0.8   18    4-21     33-50  (78)
 94 TIGR02408 ectoine_ThpD ectoine  32.3   1E+02  0.0022   23.1   4.5   40   10-50    211-250 (277)
 95 PF15572 Imm26:  Immunity prote  32.2 1.4E+02  0.0031   19.8   4.6   33   10-52      7-39  (96)
 96 PF09023 Staphostatin_B:  Staph  32.1      24 0.00052   23.9   0.9   17    2-18     30-46  (107)
 97 PF15428 Imm14:  Immunity prote  31.8      32 0.00069   22.6   1.5   15   15-29      1-15  (129)
 98 cd04459 Rho_CSD Rho_CSD: Rho p  31.2      20 0.00043   22.2   0.4   14    9-22     36-49  (68)
 99 TIGR03425 urea_degr_2 urea car  31.2      76  0.0017   24.0   3.6   33    4-36      7-44  (233)
100 TIGR03876 cas_csaX CRISPR-asso  30.9      21 0.00045   27.6   0.5   16   61-76    202-217 (281)
101 cd02790 MopB_CT_Formate-Dh_H F  30.8      12 0.00027   23.6  -0.6   20    3-22     38-57  (116)
102 COG3273 Uncharacterized conser  30.1      32 0.00069   25.8   1.4   19   18-37    148-166 (204)
103 PF01568 Molydop_binding:  Moly  30.0     8.9 0.00019   24.1  -1.4   20    3-22     33-52  (110)
104 cd02788 MopB_CT_NDH-1_NuoG2-N7  30.0      13 0.00027   23.5  -0.6   20    3-22     32-51  (96)
105 PF00856 SET:  SET domain;  Int  29.3      24 0.00052   22.3   0.6   18   11-28      7-24  (162)
106 PRK06933 type III secretion sy  29.2   1E+02  0.0023   24.2   4.2   15   11-25    173-187 (308)
107 cd02786 MopB_CT_3 The MopB_CT_  29.1      14 0.00029   23.6  -0.6   19    3-21     34-52  (116)
108 KOG1356 Putative transcription  29.0      20 0.00043   32.1   0.2   19   16-34    805-823 (889)
109 PF00498 FHA:  FHA domain;  Int  28.9      26 0.00057   20.1   0.7   12   11-22     56-67  (68)
110 PF08281 Sigma70_r4_2:  Sigma-7  28.7      21 0.00046   19.8   0.2   23   68-90     22-44  (54)
111 cd02782 MopB_CT_1 The MopB_CT_  28.2      15 0.00032   24.0  -0.6   20    3-22     36-55  (129)
112 PRK09919 anti-adapter protein   28.0      83  0.0018   21.5   3.1   35   15-50     33-67  (114)
113 PF06413 Neugrin:  Neugrin;  In  27.8      28  0.0006   26.2   0.8   18   73-90     30-47  (225)
114 PF09926 DUF2158:  Uncharacteri  27.6      43 0.00092   19.7   1.4   16   14-29      1-16  (53)
115 cd02792 MopB_CT_Formate-Dh-Na-  27.5      15 0.00032   23.5  -0.6   20    3-22     38-57  (122)
116 COG4766 EutQ Ethanolamine util  27.3      40 0.00086   24.7   1.5   19   15-33    141-159 (176)
117 cd02791 MopB_CT_Nitrate-R-NapA  27.0      16 0.00034   23.4  -0.6   18    3-20     38-55  (122)
118 cd03699 lepA_II lepA_II: This   26.9      40 0.00087   20.7   1.3   17    9-25     55-71  (86)
119 PF01052 SpoA:  Surface present  26.8      43 0.00092   20.1   1.4   15   11-25     26-40  (77)
120 TIGR00218 manA mannose-6-phosp  26.7      79  0.0017   24.1   3.1   23   10-32    271-293 (302)
121 PF14977 FAM194:  FAM194 protei  26.6 2.1E+02  0.0044   21.4   5.2   26   10-35      7-34  (208)
122 PF05986 ADAM_spacer1:  ADAM-TS  26.3      42 0.00092   22.1   1.4   14   18-31     18-31  (114)
123 KOG0024 Sorbitol dehydrogenase  26.1      39 0.00083   27.4   1.3   28    3-30     72-99  (354)
124 PRK15131 mannose-6-phosphate i  25.8      72  0.0016   25.6   2.8   24    9-32    356-379 (389)
125 cd04761 HTH_MerR-SF Helix-Turn  25.7      33 0.00072   18.3   0.7   18   73-90      1-18  (49)
126 PF11213 DUF3006:  Protein of u  25.5      68  0.0015   19.5   2.1   20   13-33     33-52  (71)
127 PF06056 Terminase_5:  Putative  25.4      42 0.00091   19.9   1.1   22   69-90     10-31  (58)
128 PF01476 LysM:  LysM domain;  I  25.4      46   0.001   17.4   1.2   13   11-23     32-44  (44)
129 KOG1392 Acetyl-CoA acetyltrans  25.3      40 0.00086   27.4   1.3   18   71-88    213-230 (465)
130 cd02781 MopB_CT_Acetylene-hydr  25.2      18 0.00039   23.5  -0.6   19    3-21     36-54  (130)
131 KOG4116 Ubiquinol cytochrome c  25.2      58  0.0013   21.5   1.8   19   18-36     54-73  (90)
132 TIGR02950 SigM_subfam RNA poly  24.4      40 0.00088   22.0   1.0   23   68-90    117-139 (154)
133 TIGR02937 sigma70-ECF RNA poly  24.4      42 0.00091   21.0   1.1   23   68-90    122-144 (158)
134 KOG3995 3-hydroxyanthranilate   24.3      55  0.0012   25.2   1.8   27    3-29     68-94  (279)
135 TIGR03436 acidobact_VWFA VWFA-  24.2 1.2E+02  0.0026   22.4   3.6   48    5-52     18-65  (296)
136 PF04970 LRAT:  Lecithin retino  24.1      31 0.00068   22.6   0.4   28    9-36      2-30  (125)
137 cd02794 MopB_CT_DmsA-EC The Mo  23.8      20 0.00043   23.2  -0.6   20    3-22     33-52  (121)
138 KOG0141 Isovaleryl-CoA dehydro  23.8 1.3E+02  0.0028   24.7   3.8   37   15-54    181-217 (421)
139 PF14623 Vint:  Hint-domain      23.7      36 0.00078   24.6   0.7   18    9-26     18-35  (162)
140 PF12708 Pectate_lyase_3:  Pect  23.7      69  0.0015   21.9   2.1   17   15-33     31-47  (225)
141 PF08220 HTH_DeoR:  DeoR-like h  23.7      40 0.00087   19.5   0.8   17   74-90     16-32  (57)
142 cd06171 Sigma70_r4 Sigma70, re  23.7      53  0.0012   16.8   1.3   21   69-89     23-43  (55)
143 PF08605 Rad9_Rad53_bind:  Fung  23.6 1.1E+02  0.0024   21.2   3.1   34    4-49     50-83  (131)
144 KOG3416 Predicted nucleic acid  23.6      37  0.0008   23.9   0.7   20   13-32     61-80  (134)
145 cd00508 MopB_CT_Fdh-Nap-like T  23.6      20 0.00042   22.7  -0.6   19    3-21     38-56  (120)
146 cd02785 MopB_CT_4 The MopB_CT_  23.5      20 0.00043   23.3  -0.6   20    3-22     35-54  (124)
147 cd02787 MopB_CT_ydeP The MopB_  23.1      19 0.00042   23.0  -0.7   20    3-22     34-53  (112)
148 PTZ00412 leucyl aminopeptidase  22.9      62  0.0013   27.8   2.0   32   11-44    358-389 (569)
149 PF13693 HTH_35:  Winged helix-  22.9      46   0.001   21.2   1.0   15   75-89     44-58  (78)
150 KOG2757 Mannose-6-phosphate is  22.4 1.2E+02  0.0026   25.1   3.4   22    7-28    369-390 (411)
151 PRK09570 rpoH DNA-directed RNA  22.3      52  0.0011   21.1   1.1   12   11-22     49-60  (79)
152 TIGR02276 beta_rpt_yvtn 40-res  22.2 1.2E+02  0.0027   15.2   3.4   14   23-36      1-14  (42)
153 TIGR02196 GlrX_YruB Glutaredox  22.2      79  0.0017   17.4   1.9   16   68-83     59-74  (74)
154 TIGR01570 A_thal_3588 uncharac  22.2 1.1E+02  0.0024   22.2   2.9   29   17-45    120-158 (161)
155 PLN03115 ferredoxin--NADP(+) r  22.1   1E+02  0.0022   24.5   3.0   31   12-45    190-222 (367)
156 PF13550 Phage-tail_3:  Putativ  22.1      48   0.001   21.9   1.0   14   12-25    138-151 (164)
157 PF07653 SH3_2:  Variant SH3 do  22.0      58  0.0013   18.2   1.2   14   10-23     14-27  (55)
158 PF14890 Intein_splicing:  Inte  21.9      53  0.0011   24.9   1.3   19    5-23     74-92  (323)
159 KOG2597 Predicted aminopeptida  21.8 1.1E+02  0.0025   25.9   3.3   31   12-44    335-365 (513)
160 COG2411 Uncharacterized conser  21.7 1.2E+02  0.0026   22.5   3.1   26    8-34     22-47  (188)
161 PF01191 RNA_pol_Rpb5_C:  RNA p  21.7      55  0.0012   20.6   1.2   11   12-22     47-57  (74)
162 TIGR02480 fliN flagellar motor  21.7      55  0.0012   20.0   1.1   13   11-23     26-38  (77)
163 COG3423 Nlp Predicted transcri  21.6      59  0.0013   21.1   1.3   15   75-89     50-64  (82)
164 TIGR03805 beta_helix_1 paralle  21.6      54  0.0012   25.3   1.4   17   12-28      6-22  (314)
165 cd02778 MopB_CT_Thiosulfate-R-  21.5      23  0.0005   22.7  -0.6   20    3-22     33-52  (123)
166 PF10377 ATG11:  Autophagy-rela  21.3      57  0.0012   22.3   1.3   17   15-31    108-124 (129)
167 cd02779 MopB_CT_Arsenite-Ox Th  21.0      24 0.00052   22.7  -0.6   20    3-22     36-55  (115)
168 PF09340 NuA4:  Histone acetylt  20.9      34 0.00074   21.6   0.1   17   59-75     32-48  (80)
169 cd00118 LysM Lysin domain, fou  20.8      62  0.0013   15.6   1.1   13   11-23     34-46  (46)
170 PF10948 DUF2635:  Protein of u  20.7      49  0.0011   19.1   0.7   14   11-24     32-45  (47)
171 PF13384 HTH_23:  Homeodomain-l  20.7      61  0.0013   17.5   1.1   21   70-90     15-35  (50)
172 PF13759 2OG-FeII_Oxy_5:  Putat  20.2 2.3E+02  0.0051   17.6   4.4   28    9-36     65-92  (101)
173 COG0147 TrpE Anthranilate/para  20.2      25 0.00054   28.9  -0.8   60   11-78    204-263 (462)

No 1  
>PLN00212 glutelin; Provisional
Probab=99.93  E-value=6.1e-26  Score=183.90  Aligned_cols=82  Identities=13%  Similarity=0.246  Sum_probs=73.5

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC---C--CCCceeecCCCc--------------c
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED---D--SYFEPVIGAYTS--------------I   66 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~---~--~~~~~flag~~~--------------~   66 (91)
                      +++||+++||+||||+||||++||+||+||+   +|++++++|++|.   +  .+++|||||+++              +
T Consensus       144 d~hqkv~~lr~GDViaiPaG~~hw~yN~Gd~---~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~~~~~~~~~~~~~  220 (493)
T PLN00212        144 DEHQKIHQFRQGDVVALPAGVAHWFYNDGDA---PVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVYGRSIEQHSG  220 (493)
T ss_pred             cccccceEeccCCEEEECCCCeEEEEeCCCC---cEEEEEEEeccccccccCCCcceeeccCCCcccccccccccccccc
Confidence            4588999999999999999999999999986   8999999999984   3  447889999864              3


Q ss_pred             CceecccCHHHHHHHhCCCccccc
Q 038528           67 SDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        67 ~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      +|||+|||+++|++||||+.++++
T Consensus       221 ~nifsGF~~e~La~Afnv~~e~~~  244 (493)
T PLN00212        221 QNIFSGFSTELLSEALGINAQVAK  244 (493)
T ss_pred             CchhhcCCHHHHHHHHCCCHHHHH
Confidence            689999999999999999999886


No 2  
>smart00835 Cupin_1 Cupin. This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant.
Probab=99.32  E-value=1e-11  Score=85.29  Aligned_cols=74  Identities=18%  Similarity=0.319  Sum_probs=60.6

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHHHHhCCCcc
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVL   87 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~~Af~v~~~   87 (91)
                      ++.++.+++||++.||+|+.||+.|.++.   ++++++ +...+.  .+.+|++|.   .++|+||++++|+++||++.+
T Consensus        73 ~~~~~~l~~GD~~~ip~g~~H~~~n~~~~---~~~~l~-~~~~~~--~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  143 (146)
T smart00835       73 KVYDARLREGDVFVVPQGHPHFQVNSGDE---NLEFVA-FNTNDP--NRRFFLAGR---NSVLRGLPPEVLAAAFGVSAE  143 (146)
T ss_pred             eEEEEEecCCCEEEECCCCEEEEEcCCCC---CEEEEE-EecCCC--CceeEeecc---cchhhcCCHHHHHHHhCcChH
Confidence            45588999999999999999999999865   899885 433332  255677774   489999999999999999998


Q ss_pred             ccc
Q 038528           88 LLG   90 (91)
Q Consensus        88 ~i~   90 (91)
                      +++
T Consensus       144 ~~~  146 (146)
T smart00835      144 EVR  146 (146)
T ss_pred             HcC
Confidence            764


No 3  
>PF00190 Cupin_1:  Cupin;  InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. ; GO: 0045735 nutrient reservoir activity; PDB: 2E9Q_A 2EVX_A 1OD5_A 1UCX_A 1UD1_C 1FXZ_C 3KGL_C 3KSC_D 1UIJ_F 1IPK_B ....
Probab=99.25  E-value=2e-11  Score=83.66  Aligned_cols=58  Identities=19%  Similarity=0.318  Sum_probs=45.0

Q ss_pred             eeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHHHHhCCCccccc
Q 038528           13 DIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      ++++|||+.||+|++||++|.+++   +...+.++++.+..              +.   +++++|+++|+++.++.+
T Consensus        87 ~l~~Gdv~~vP~G~~h~~~n~~~~---~~~~~~~f~~~~~~--------------~~---l~~~v~~~~F~~~~~~~~  144 (144)
T PF00190_consen   87 RLKAGDVFVVPAGHPHWIINDGDD---EALVLIIFDTNNPP--------------NQ---LPPEVLAKAFFLSGEEVQ  144 (144)
T ss_dssp             EEETTEEEEE-TT-EEEEEECSSS---SEEEEEEEEESSTT--------------GE---SSHHHHHHHEESSHHHHB
T ss_pred             eeecccceeeccceeEEEEcCCCC---CCEEEEEEECCCCc--------------cc---CCcHHHHHhcCCCcCcCC
Confidence            499999999999999999999865   45666666666552              11   999999999999988754


No 4  
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family. Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins.
Probab=98.43  E-value=6.3e-07  Score=70.75  Aligned_cols=72  Identities=15%  Similarity=0.227  Sum_probs=58.4

Q ss_pred             CCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHHHHhCCCc
Q 038528            7 DDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAV   86 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~~Af~v~~   86 (91)
                      ++.+++.|+.||++.+|+|..||+.|.|++   +|+++++++.....+.         .-.+.++....++|++.|+++.
T Consensus       286 g~~~~~~l~~GD~~~iP~g~~H~i~N~G~e---~l~fL~if~s~~~~~i---------~l~~~l~~~p~~vl~~~~~~~~  353 (367)
T TIGR03404       286 GNARTFDYQAGDVGYVPRNMGHYVENTGDE---TLVFLEVFKADRFADV---------SLNQWLALTPPQLVAAHLNLDD  353 (367)
T ss_pred             CcEEEEEECCCCEEEECCCCeEEEEECCCC---CEEEEEEECCCCCcee---------EHHHHHhhCCHHHHHHHhCcCH
Confidence            345788999999999999999999999976   8999999977433111         1146778899999999999998


Q ss_pred             cccc
Q 038528           87 LLLG   90 (91)
Q Consensus        87 ~~i~   90 (91)
                      +.++
T Consensus       354 ~~~~  357 (367)
T TIGR03404       354 EVID  357 (367)
T ss_pred             HHHH
Confidence            7764


No 5  
>PLN00212 glutelin; Provisional
Probab=98.08  E-value=8.6e-06  Score=66.92  Aligned_cols=79  Identities=9%  Similarity=0.123  Sum_probs=60.7

Q ss_pred             ccccCCCceee--eeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHH
Q 038528            2 SWADEDDIRTL--DIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQ   79 (91)
Q Consensus         2 ~~v~~~~~~~~--~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~   79 (91)
                      .+|.+...+.+  .|++|||+.||+|.++-..-. ++   .+.++++-.+.+.   ...++||-   .|+|++...++|+
T Consensus       383 qvV~~~g~~vf~~~L~~GdvfVVPqg~~v~~~A~-~e---gfe~v~F~tna~~---~~s~laG~---~Sv~~alp~eVla  452 (493)
T PLN00212        383 QVVSNNGKTVFNGVLRPGQLLIIPQHYAVLKKAE-RE---GCQYIAFKTNANA---MVSHIAGK---NSIFRALPVDVIA  452 (493)
T ss_pred             EEEcCCCCEEEEEEEcCCCEEEECCCCeEEEeec-CC---ceEEEEeecCCCc---cccccccH---HHHHHhCCHHHHH
Confidence            45655545555  899999999999998876544 22   6888887766543   34467774   5899999999999


Q ss_pred             HHhCCCccccc
Q 038528           80 SAFKRAVLLLG   90 (91)
Q Consensus        80 ~Af~v~~~~i~   90 (91)
                      .||+++.++++
T Consensus       453 ~Af~is~eea~  463 (493)
T PLN00212        453 NAYRISREEAR  463 (493)
T ss_pred             HHcCCCHHHHH
Confidence            99999998775


No 6  
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family. Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins.
Probab=97.99  E-value=2.4e-05  Score=61.82  Aligned_cols=70  Identities=16%  Similarity=0.204  Sum_probs=51.8

Q ss_pred             eeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHHHHhCCCccccc
Q 038528           11 TLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      ...|++||++.+|+|.+|++.|.++    ..+++.++++..--.+..+.+      .+.|....+++|+.+|+++.++++
T Consensus       111 ~~~L~~GD~~~fP~g~~H~~~n~~~----~~~~l~vf~~~~f~~~~~~~~------~~~l~~~p~~Vla~~f~l~~~~~~  180 (367)
T TIGR03404       111 IDDVGAGDLWYFPPGIPHSLQGLDE----GCEFLLVFDDGNFSEDGTFLV------TDWLAHTPKDVLAKNFGVPESAFD  180 (367)
T ss_pred             EeEECCCCEEEECCCCeEEEEECCC----CeEEEEEeCCcccCCcceeeH------HHHHHhCCHHHHHHHhCCCHHHHH
Confidence            3579999999999999999999953    467777777754211111111      235566999999999999998765


No 7  
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]
Probab=97.82  E-value=5e-05  Score=51.35  Aligned_cols=41  Identities=12%  Similarity=0.154  Sum_probs=37.6

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      -++..|+.||.+.||+|+.|++.|.|..   +|.++.+..+...
T Consensus        74 ~~~~~v~~gd~~~iP~g~~H~~~N~G~~---~L~liei~~p~~~  114 (127)
T COG0662          74 GEEVEVKAGDSVYIPAGTPHRVRNTGKI---PLVLIEVQSPPYL  114 (127)
T ss_pred             CEEEEecCCCEEEECCCCcEEEEcCCCc---ceEEEEEecCCcC
Confidence            5788999999999999999999999985   9999999988876


No 8  
>PF07883 Cupin_2:  Cupin domain;  InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel). ; PDB: 2OPK_C 3BU7_B 2PHD_D 3NVC_A 3NKT_A 3NJZ_A 3NW4_A 3NST_A 3NL1_A 2H0V_A ....
Probab=97.66  E-value=0.00014  Score=42.95  Aligned_cols=36  Identities=14%  Similarity=0.386  Sum_probs=32.0

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEe
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIF   47 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~   47 (91)
                      .+...+++||.+.+|+|+.+.+.|.+++   +++++.++
T Consensus        36 ~~~~~l~~Gd~~~i~~~~~H~~~n~~~~---~~~~l~V~   71 (71)
T PF07883_consen   36 GERVELKPGDAIYIPPGVPHQVRNPGDE---PARFLVVY   71 (71)
T ss_dssp             TEEEEEETTEEEEEETTSEEEEEEESSS---EEEEEEEE
T ss_pred             cEEeEccCCEEEEECCCCeEEEEECCCC---CEEEEEEC
Confidence            4589999999999999999999999886   78888764


No 9  
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=97.26  E-value=0.00056  Score=45.71  Aligned_cols=38  Identities=18%  Similarity=0.370  Sum_probs=31.7

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeec
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSN   49 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~   49 (91)
                      .+.+.+++||++.+|+|+.||+.|.++.   ....+++...
T Consensus        81 g~~~~l~~Gd~i~ip~g~~H~~~a~~~~---~~~~l~v~~~  118 (131)
T COG1917          81 GEKKELKAGDVIIIPPGVVHGLKAVEDE---PMVLLLVFPL  118 (131)
T ss_pred             CCceEecCCCEEEECCCCeeeeccCCCC---ceeEEEEeee
Confidence            6788999999999999999999999876   4555666554


No 10 
>PRK04190 glucose-6-phosphate isomerase; Provisional
Probab=97.09  E-value=0.0017  Score=47.51  Aligned_cols=40  Identities=15%  Similarity=0.183  Sum_probs=35.2

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTE   51 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n   51 (91)
                      .+...++.||++.||+|++|.+.|.++.   +|+.+++....-
T Consensus       119 ~~~~~v~pGd~v~IPpg~~H~~iN~G~e---pl~fl~v~p~~~  158 (191)
T PRK04190        119 ARWIEMEPGTVVYVPPYWAHRSVNTGDE---PLVFLACYPADA  158 (191)
T ss_pred             EEEEEECCCCEEEECCCCcEEeEECCCC---CEEEEEEEcCCc
Confidence            4678999999999999999999999975   899999876553


No 11 
>TIGR03214 ura-cupin putative allantoin catabolism protein. This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis).
Probab=97.07  E-value=0.0016  Score=49.10  Aligned_cols=41  Identities=10%  Similarity=-0.029  Sum_probs=34.3

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTE   51 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n   51 (91)
                      +.+.+.++.||++.||||+++|++|.|++   +|+.+--=|.+-
T Consensus       216 ~g~~~~V~~GD~i~i~~~~~h~~~~~G~~---~~~~l~ykd~nr  256 (260)
T TIGR03214       216 DNNWVPVEAGDYIWMGAYCPQACYAGGRG---EFRYLLYKDMNR  256 (260)
T ss_pred             CCEEEEecCCCEEEECCCCCEEEEecCCC---cEEEEEEccccC
Confidence            46789999999999999999999999985   788765555443


No 12 
>PRK13290 ectC L-ectoine synthase; Reviewed
Probab=96.59  E-value=0.0066  Score=41.47  Aligned_cols=37  Identities=22%  Similarity=0.473  Sum_probs=32.8

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      .+.+.|++||.+.+|+|..|.+.|.  .   ++++++++.+.
T Consensus        74 g~~~~L~aGD~i~~~~~~~H~~~N~--e---~~~~l~v~tP~  110 (125)
T PRK13290         74 GEVHPIRPGTMYALDKHDRHYLRAG--E---DMRLVCVFNPP  110 (125)
T ss_pred             CEEEEeCCCeEEEECCCCcEEEEcC--C---CEEEEEEECCC
Confidence            5679999999999999999999997  2   79999988754


No 13 
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]
Probab=96.52  E-value=0.0066  Score=45.38  Aligned_cols=43  Identities=21%  Similarity=0.431  Sum_probs=37.7

Q ss_pred             CCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528            7 DDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      ++-++..++.||++-||.|-.||+.|+|+.   +|++..++.....
T Consensus       123 G~~~v~~~~~Gd~iyVPp~~gH~t~N~Gd~---pLvf~~v~~~~~~  165 (209)
T COG2140         123 GEARVIAVRAGDVIYVPPGYGHYTINTGDE---PLVFLNVYPADAG  165 (209)
T ss_pred             CcEEEEEecCCcEEEeCCCcceEeecCCCC---CEEEEEEEeCCCC
Confidence            456788999999999999999999999997   9999999866543


No 14 
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional
Probab=96.18  E-value=0.014  Score=41.20  Aligned_cols=38  Identities=13%  Similarity=0.183  Sum_probs=32.7

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeec
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSN   49 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~   49 (91)
                      -+.+.|+.||.+.+|++++|.+.|.++.   +.+++.+..+
T Consensus       145 ~~~~~l~~Gd~~~~~~~~~H~~~n~~~~---~~~~l~~~~p  182 (185)
T PRK09943        145 GQDYHLVAGQSYAINTGIPHSFSNTSAG---ICRIISAHTP  182 (185)
T ss_pred             CEEEEecCCCEEEEcCCCCeeeeCCCCC---CeEEEEEeCC
Confidence            3678999999999999999999998875   7888877654


No 15 
>PRK11171 hypothetical protein; Provisional
Probab=95.95  E-value=0.022  Score=43.00  Aligned_cols=43  Identities=7%  Similarity=-0.020  Sum_probs=35.8

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDD   53 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~   53 (91)
                      +-+.+.|+.||.+.+|+++++|+.|.++.   +++.+..-|.+-+|
T Consensus       221 ~~~~~~l~~GD~i~~~~~~~h~~~N~g~~---~~~yl~~k~~nr~~  263 (266)
T PRK11171        221 NNDWVEVEAGDFIWMRAYCPQACYAGGPG---PFRYLLYKDVNRHP  263 (266)
T ss_pred             CCEEEEeCCCCEEEECCCCCEEEECCCCC---cEEEEEEcccccCc
Confidence            45788999999999999999999999885   78877666655443


No 16 
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional
Probab=95.93  E-value=0.019  Score=47.10  Aligned_cols=39  Identities=10%  Similarity=0.072  Sum_probs=34.9

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      -+.+.|.+||.+.+|+|++|.+.|.++.   +|+++.+....
T Consensus       423 g~~~~L~~GDSi~ip~g~~H~~~N~g~~---~l~iI~V~~g~  461 (478)
T PRK15460        423 GDIKLLGENESIYIPLGATHCLENPGKI---PLDLIEVRSGS  461 (478)
T ss_pred             CEEEEecCCCEEEECCCCcEEEEcCCCC---CEEEEEEEcCC
Confidence            4689999999999999999999999986   89999997554


No 17 
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (EC 5.3.1.8) (PMI) and mannose-1-phosphate guanylyltransferase (EC 2.7.7.22) in Pseudomonas aeruginosa, Xanthomonas campestris, and Gluconacetobacter xylinus. The literature on the enzyme from E. coli attributes mannose-6-phosphate isomerase activity to an adjacent gene, but the present sequence has not been shown to lack the activity. The PMI domain is C-terminal.
Probab=95.76  E-value=0.025  Score=45.73  Aligned_cols=39  Identities=15%  Similarity=0.168  Sum_probs=34.3

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      -+.+.|++||.+.+|+|+.|.+.|.++.   +++++.+..+.
T Consensus       414 g~~~~l~~GDsi~ip~~~~H~~~N~g~~---~~~~i~v~~~~  452 (468)
T TIGR01479       414 DETLLLTENESTYIPLGVIHRLENPGKI---PLELIEVQSGS  452 (468)
T ss_pred             CEEEEecCCCEEEECCCCcEEEEcCCCC---CEEEEEEEcCC
Confidence            4678999999999999999999999986   89999987533


No 18 
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=95.64  E-value=0.022  Score=41.11  Aligned_cols=41  Identities=17%  Similarity=0.197  Sum_probs=34.0

Q ss_pred             ceeeeeccCcEEEeCCC--CeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528            9 IRTLDIRRGDVYRLQPG--SVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG--~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      -..+.||.||++..|||  ++|-++|+++.   .|+..++=+..+.
T Consensus        81 ~~e~~lrpGD~~gFpAG~~~aHhliN~s~~---~~~yL~vG~r~~~  123 (161)
T COG3837          81 GGETRLRPGDSAGFPAGVGNAHHLINRSDV---ILRYLEVGTREPD  123 (161)
T ss_pred             CeeEEecCCceeeccCCCcceeEEeecCCc---eEEEEEecccccc
Confidence            45789999999999999  99999999875   7887777655543


No 19 
>PF12852 Cupin_6:  Cupin
Probab=95.55  E-value=0.03  Score=39.19  Aligned_cols=34  Identities=18%  Similarity=0.418  Sum_probs=28.3

Q ss_pred             ccc-CCCceeeeeccCcEEEeCCCCeEEEeeCCCC
Q 038528            3 WAD-EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus         3 ~v~-~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      |+. ++.+....|+.||++.+|.|+.|++....+.
T Consensus        47 ~l~~~~~~~~~~L~~GDivllp~g~~H~l~~~~~~   81 (186)
T PF12852_consen   47 WLRVPGGGEPIRLEAGDIVLLPRGTAHVLSSDPDS   81 (186)
T ss_pred             EEEEcCCCCeEEecCCCEEEEcCCCCeEeCCCCCC
Confidence            555 4447889999999999999999999877654


No 20 
>PF02373 JmjC:  JmjC domain, hydroxylase;  InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [].There is evidence of domain swapping within the jumonji family of transcription factors []. This domain is often associated with jmjN (see IPR003349 from INTERPRO) and belongs to the Cupin superfamily [].; PDB: 2YU2_A 2YU1_A 3AVR_A 3AVS_A 2OX0_B 2OQ6_B 2WWJ_A 2Q8D_A 3PDQ_A 2YBK_A ....
Probab=95.49  E-value=0.015  Score=37.09  Aligned_cols=25  Identities=12%  Similarity=0.204  Sum_probs=19.1

Q ss_pred             eeeccCcEEEeCCCCeEEEeeCCCC
Q 038528           12 LDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      ..-++||.+.+|+|+.|+.+|.|++
T Consensus        83 ~~Q~~Ge~V~i~pg~~H~v~n~g~~  107 (114)
T PF02373_consen   83 FVQKPGEFVFIPPGAYHQVFNLGDN  107 (114)
T ss_dssp             EEEETT-EEEE-TT-EEEEEESSSE
T ss_pred             ceECCCCEEEECCCceEEEEeCCce
Confidence            3448899999999999999999875


No 21 
>PF06560 GPI:  Glucose-6-phosphate isomerase (GPI);  InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5.3.1.9 from EC), which are involved in glycolysis and in gluconeogenesis and catalyse the conversion of D-glucose 6-phosphate to D-fructose 6-phosphate. The deduced amino acid sequence of the first archaeal PGI isolated from Pyrococcus furiosus revealed that it is not related to its eukaryotic and many of its bacterial counterparts. In contrast, this archaeal PGI shares similarity with the cupin superfamily that consists of a variety of proteins that are generally involved in sugar metabolism in both prokaryotes and eukaryotes [].; GO: 0004347 glucose-6-phosphate isomerase activity, 0006094 gluconeogenesis, 0006096 glycolysis, 0005737 cytoplasm; PDB: 1J3Q_B 1J3R_B 1J3P_A 2GC0_A 1X8E_A 1X82_A 1QY4_B 2GC2_B 1QXJ_A 1QXR_B ....
Probab=95.47  E-value=0.045  Score=39.97  Aligned_cols=40  Identities=18%  Similarity=0.238  Sum_probs=28.7

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      ...+.++||++.||+|.+|-++|++++   +|+..++....-.
T Consensus       110 ~~v~~~~G~~v~IPp~yaH~tIN~g~~---~L~~~~~~~~~~g  149 (182)
T PF06560_consen  110 IAVEAKPGDVVYIPPGYAHRTINTGDE---PLVFAAWVPRDAG  149 (182)
T ss_dssp             EEEEE-TTEEEEE-TT-EEEEEE-SSS----EEEEEEEETT--
T ss_pred             EEEEeCCCCEEEECCCceEEEEECCCC---cEEEEEEEecCCC
Confidence            456789999999999999999999975   8999998865543


No 22 
>PF01050 MannoseP_isomer:  Mannose-6-phosphate isomerase;  InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5.3.1.8 from EC) (PMI) is the enzyme that catalyses the interconversion of mannose-6-phosphate and fructose-6-phosphate. In eukaryotes PMI is involved in the synthesis of GDP-mannose, a constituent of N- and O-linked glycans and GPI anchors and in prokaryotes it participates in a variety of pathways, including capsular polysaccharide biosynthesis and D-mannose metabolism. PMI's belong to the cupin superfamily whose functions range from isomerase and epimerase activities involved in the modification of cell wall carbohydrates in bacteria and plants, to non-enzymatic storage proteins in plant seeds, and transcription factors linked to congenital baldness in mammals []. Three classes of PMI have been defined []. The type II phosphomannose isomerases are bifunctional enzymes 5.3.1.8 from EC. This entry covers the isomerase region of the protein []. The guanosine diphospho-D-mannose pyrophosphorylase region is described in another InterPro entry (see IPR005836 from INTERPRO).; GO: 0016779 nucleotidyltransferase activity, 0005976 polysaccharide metabolic process
Probab=94.98  E-value=0.07  Score=37.64  Aligned_cols=37  Identities=19%  Similarity=0.282  Sum_probs=32.7

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEee
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFS   48 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d   48 (91)
                      -+.+.+.+||.+.||+|+.|=+.|.++.   +|.++-+-.
T Consensus       101 ~~~~~~~~g~sv~Ip~g~~H~i~n~g~~---~L~~IEVq~  137 (151)
T PF01050_consen  101 DEEFTLKEGDSVYIPRGAKHRIENPGKT---PLEIIEVQT  137 (151)
T ss_pred             CEEEEEcCCCEEEECCCCEEEEECCCCc---CcEEEEEec
Confidence            4678899999999999999999999875   899987764


No 23 
>PF03079 ARD:  ARD/ARD' family;  InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ []. ARD and ARD' can be experimentally interconverted by removal of the bound metal ion and reconstitution with the appropriate metal ion. The two enzymes share the same substrate, 1,2-dihydroxy-3-keto-5-(methylthio)pentene, but yield different products. ARD' yields the alpha-keto precursor of methionine (and formate), thus forming part of the ubiquitous methionine salvage pathway that converts 5'-methylthioadenosine (MTA) to methionine. This pathway is responsible for the tight control of the concentration of MTA, which is a powerful inhibitor of polyamine biosynthesis and transmethylation reactions []. ARD yields methylthiopropanoate, carbon monoxide and formate, and thus prevents the conversion of MTA to methionine. The role of the ARD catalysed reaction is unclear: methylthiopropanoate is cytotoxic, and carbon monoxide can activate guanylyl cyclase, leading to increased intracellular cGMP levels [, ].  This family also contains other proteins, whose functions are not well characterised.; GO: 0010309 acireductone dioxygenase [iron(II)-requiring] activity, 0055114 oxidation-reduction process; PDB: 1VR3_A 1ZRR_A 2HJI_A.
Probab=94.95  E-value=0.11  Score=36.97  Aligned_cols=34  Identities=12%  Similarity=0.255  Sum_probs=24.9

Q ss_pred             eeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEee
Q 038528           12 LDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFS   48 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d   48 (91)
                      -.++.||.|.||||+.||..-..++   .+.++=++.
T Consensus       117 i~~e~GDli~vP~g~~HrF~~~~~~---~i~aiRlF~  150 (157)
T PF03079_consen  117 ILCEKGDLIVVPAGTYHRFTLGESP---YIKAIRLFK  150 (157)
T ss_dssp             EEEETTCEEEE-TT--EEEEESTTS---SEEEEEEES
T ss_pred             EEEcCCCEEecCCCCceeEEcCCCC---cEEEEEeec
Confidence            6789999999999999999977554   677766664


No 24 
>PRK11171 hypothetical protein; Provisional
Probab=94.55  E-value=0.12  Score=39.09  Aligned_cols=37  Identities=22%  Similarity=0.212  Sum_probs=31.9

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEee
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFS   48 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d   48 (91)
                      .+.+.|++||.+.+|+|+.|.+.|.++.   +.+++.+..
T Consensus       100 g~~~~L~~GDsi~~p~~~~H~~~N~g~~---~a~~l~v~~  136 (266)
T PRK11171        100 GKTHALSEGGYAYLPPGSDWTLRNAGAE---DARFHWIRK  136 (266)
T ss_pred             CEEEEECCCCEEEECCCCCEEEEECCCC---CEEEEEEEc
Confidence            4689999999999999999999999876   677777653


No 25 
>TIGR03214 ura-cupin putative allantoin catabolism protein. This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis).
Probab=94.02  E-value=0.16  Score=38.34  Aligned_cols=36  Identities=22%  Similarity=0.347  Sum_probs=29.5

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEe
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIF   47 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~   47 (91)
                      .+.+.|++||-+.+|+|+.+.+.|.++.   +.+++.+-
T Consensus        97 g~~~~L~~Gd~~y~pa~~~H~~~N~~~~---~a~~l~v~  132 (260)
T TIGR03214        97 GETHELREGGYAYLPPGSKWTLANAQAE---DARFFLYK  132 (260)
T ss_pred             CEEEEECCCCEEEECCCCCEEEEECCCC---CEEEEEEE
Confidence            4678999999999999999999999875   55555433


No 26 
>PF02311 AraC_binding:  AraC-like ligand binding domain;  InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC. The crystal structure of the arabinose-binding and dimerization domain of the Escherichia coli gene regulatory protein AraC was determined in the presence and absence of L-arabinose. The arabinose-bound molecule shows that the protein adopts an unusual fold, binding sugar within a beta barrel and completely burying the arabinose with the amino-terminal arm of the protein. Dimer contacts in the presence of arabinose are mediated by an antiparallel coiled-coil. In the uncomplexed protein, the amino-terminal arm is disordered, uncovering the sugar-binding pocket and allowing it to serve as an oligomerization interface [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 1XJA_B 2ARA_A 2AAC_B 2ARC_A.
Probab=93.51  E-value=0.32  Score=30.60  Aligned_cols=39  Identities=18%  Similarity=0.379  Sum_probs=26.4

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeec
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSN   49 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~   49 (91)
                      +.+.+.+++||++.+|+|..+-+.-..+.   ++..+.+.-.
T Consensus        39 ~~~~~~l~~g~~~li~p~~~H~~~~~~~~---~~~~~~i~~~   77 (136)
T PF02311_consen   39 DGQEYPLKPGDLFLIPPGQPHSYYPDSNE---PWEYYWIYFS   77 (136)
T ss_dssp             TTEEEEE-TT-EEEE-TTS-EEEEE-TTS---EEEEEEEEE-
T ss_pred             CCEEEEEECCEEEEecCCccEEEecCCCC---CEEEEEEEEC
Confidence            46789999999999999999999988754   5666665543


No 27 
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=93.05  E-value=0.36  Score=35.43  Aligned_cols=40  Identities=13%  Similarity=0.394  Sum_probs=30.9

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      +.-.-.+..||.|.||+|+-||+--.-+.   ..+.+-++...
T Consensus       116 ~~~~i~c~~gDLI~vP~gi~HwFtlt~~~---~f~AvRlF~~~  155 (181)
T COG1791         116 KVYQIRCEKGDLISVPPGIYHWFTLTESP---NFKAVRLFTEP  155 (181)
T ss_pred             cEEEEEEccCCEEecCCCceEEEEccCCC---cEEEEEEeeCC
Confidence            44455568899999999999999998655   67777777544


No 28 
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=93.01  E-value=0.087  Score=32.53  Aligned_cols=27  Identities=26%  Similarity=0.346  Sum_probs=20.5

Q ss_pred             cCCCceeeeeccCcEEEeCCCCeEEEe
Q 038528            5 DEDDIRTLDIRRGDVYRLQPGSVFYIE   31 (91)
Q Consensus         5 ~~~~~~~~~lr~GDv~~ipaG~~~y~~   31 (91)
                      ..++-..+.++.||++.+|+|+..-+.
T Consensus        39 t~~~G~~~~~~aGD~~~~p~G~~~~w~   65 (74)
T PF05899_consen   39 TDEDGETVTFKAGDAFFLPKGWTGTWE   65 (74)
T ss_dssp             EETTTEEEEEETTEEEEE-TTEEEEEE
T ss_pred             EECCCCEEEEcCCcEEEECCCCEEEEE
Confidence            344667799999999999999976443


No 29 
>PF02041 Auxin_BP:  Auxin binding protein;  InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER). The primary structure contains an N-terminal hydrophobic leader sequence of 30-40 amino acids, which could represent a signal for translocation of the protein to the ER [, ]. The mature protein comprises around 165 residues, and contains a number of potential N-glycosylation sites. In vitro transport studies have demonstrated co-translational glycosylation []. Retention within the lumen of the ER correlates with an additional signal located at the C terminus, represented by the sequence Lys-Asp-Glu-Leu, known to be responsible for preventing secretion of proteins from the lumen of the ER in eukaryotic cells [, ].; GO: 0004872 receptor activity, 0005788 endoplasmic reticulum lumen; PDB: 1LR5_D 1LRH_D.
Probab=91.26  E-value=0.64  Score=33.67  Aligned_cols=41  Identities=15%  Similarity=0.235  Sum_probs=25.9

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEee
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFS   48 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d   48 (91)
                      +++-+++.+-.++.+.||.+.+|=+.|+++.|  +|+++.++.
T Consensus        87 pG~pqef~~~pnSTf~IPvn~~HQv~NT~e~e--DlqvlViiS  127 (167)
T PF02041_consen   87 PGKPQEFPIFPNSTFHIPVNDAHQVWNTNEHE--DLQVLVIIS  127 (167)
T ss_dssp             --S-EEEEE-TTEEEEE-TT--EEEE---SSS---EEEEEEEE
T ss_pred             CCCceEEEecCCCeEEeCCCCcceeecCCCCc--ceEEEEEec
Confidence            45678889999999999999999999998664  898887764


No 30 
>PF11699 CENP-C_C:  Mif2/CENP-C like; PDB: 2VPV_B.
Probab=91.21  E-value=0.71  Score=29.76  Aligned_cols=30  Identities=13%  Similarity=0.350  Sum_probs=22.1

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQE   37 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e   37 (91)
                      +..++.+.+||.+-||+|-.+-+-|.++++
T Consensus        49 ~~~~f~v~~G~~F~VP~gN~Y~i~N~~~~~   78 (85)
T PF11699_consen   49 HETSFVVTKGGSFQVPRGNYYSIKNIGNEE   78 (85)
T ss_dssp             TTEEEEEETT-EEEE-TT-EEEEEE-SSS-
T ss_pred             cCcEEEEeCCCEEEECCCCEEEEEECCCCc
Confidence            346788999999999999999999998763


No 31 
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase. Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase. This enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.
Probab=90.78  E-value=0.54  Score=33.78  Aligned_cols=31  Identities=23%  Similarity=0.363  Sum_probs=24.8

Q ss_pred             cCCCceeeeeccCcEEEeCCCCeEEEeeCCC
Q 038528            5 DEDDIRTLDIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus         5 ~~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      .+++.+...|++||++.||+|+.|=-.-..+
T Consensus        65 d~g~~~~v~L~eGd~flvP~gvpHsP~r~~~   95 (159)
T TIGR03037        65 EEGKREDVPIREGDIFLLPPHVPHSPQRPAG   95 (159)
T ss_pred             cCCcEEEEEECCCCEEEeCCCCCcccccCCC
Confidence            3344578999999999999999997776544


No 32 
>PF13621 Cupin_8:  Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A ....
Probab=90.58  E-value=0.4  Score=33.94  Aligned_cols=24  Identities=25%  Similarity=0.341  Sum_probs=19.1

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      ....|+.||++-||+|--|++.|.
T Consensus       209 ~~~~l~pGD~LfiP~gWwH~V~~~  232 (251)
T PF13621_consen  209 YEVVLEPGDVLFIPPGWWHQVENL  232 (251)
T ss_dssp             EEEEEETT-EEEE-TT-EEEEEES
T ss_pred             eEEEECCCeEEEECCCCeEEEEEc
Confidence            456789999999999999999999


No 33 
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional
Probab=90.53  E-value=0.53  Score=34.41  Aligned_cols=30  Identities=20%  Similarity=0.413  Sum_probs=24.3

Q ss_pred             ccCCCceeeeeccCcEEEeCCCCeEEEeeC
Q 038528            4 ADEDDIRTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      +++++.+...|++||++.||+|+.|=..-.
T Consensus        70 ~d~g~~~~v~L~eGd~fllP~gvpHsP~r~   99 (177)
T PRK13264         70 QEDGKRRDVPIREGEMFLLPPHVPHSPQRE   99 (177)
T ss_pred             EcCCceeeEEECCCCEEEeCCCCCcCCccC
Confidence            344444788999999999999999988765


No 34 
>PF06052 3-HAO:  3-hydroxyanthranilic acid dioxygenase;  InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1.13.11.6 from EC). It is part of the kynurenine pathway for the degradation of tryptophan and the biosynthesis of nicotinic acid [].The prokaryotic homologue is involved in the 2-nitrobenzoate degradation pathway []. The enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.; GO: 0000334 3-hydroxyanthranilate 3,4-dioxygenase activity, 0005506 iron ion binding, 0008152 metabolic process, 0055114 oxidation-reduction process; PDB: 1ZVF_A 1YFX_A 1YFW_A 1YFY_A 1YFU_A 2QNK_A 3FE5_A.
Probab=90.01  E-value=0.21  Score=35.74  Aligned_cols=35  Identities=11%  Similarity=0.302  Sum_probs=23.6

Q ss_pred             ccccCCCceeeeeccCcEEEeCCCCeEEEeeCCCC
Q 038528            2 SWADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus         2 ~~v~~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      ..+++++.|...+++||++-+|++++|-=.=..++
T Consensus        67 kv~e~g~~kdi~I~EGe~fLLP~~vpHsP~R~~~t  101 (151)
T PF06052_consen   67 KVVEDGKFKDIPIREGEMFLLPANVPHSPQRPADT  101 (151)
T ss_dssp             EEEETTEEEEEEE-TTEEEEE-TT--EEEEE-TT-
T ss_pred             EEEeCCceEEEEeCCCcEEecCCCCCCCCcCCCCc
Confidence            35667788899999999999999999976666543


No 35 
>PRK15457 ethanolamine utilization protein EutQ; Provisional
Probab=89.18  E-value=0.95  Score=34.45  Aligned_cols=38  Identities=18%  Similarity=0.220  Sum_probs=27.2

Q ss_pred             CceeeeeccCcEEEeCCCCe-EEEeeCCCCCcccEEEEEEeecCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSV-FYIESNLEQEREKLRIYAIFSNTE   51 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~-~y~~N~~~~e~~~L~i~~l~d~~n   51 (91)
                      +.+.+.++.||++.||+|+. +| .+.+     ..+...+.-+.|
T Consensus       191 dG~t~~l~pGDvlfIPkGs~~hf-~tp~-----~aRflyV~~Pa~  229 (233)
T PRK15457        191 EGETMIAKAGDVMFIPKGSSIEF-GTPS-----SVRFLYVAWPAN  229 (233)
T ss_pred             CCEEEEeCCCcEEEECCCCeEEe-cCCC-----CeeEEEEEecCc
Confidence            36789999999999999999 88 3332     345555554444


No 36 
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]
Probab=88.88  E-value=0.49  Score=32.37  Aligned_cols=25  Identities=20%  Similarity=0.328  Sum_probs=21.7

Q ss_pred             ccCCCceeeeeccCcEEEeCCCCeE
Q 038528            4 ADEDDIRTLDIRRGDVYRLQPGSVF   28 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~ipaG~~~   28 (91)
                      +.+|+.+...+|.||++.+|||+.-
T Consensus        76 ~T~d~Ge~v~~~aGD~~~~~~G~~g  100 (116)
T COG3450          76 VTPDGGEPVEVRAGDSFVFPAGFKG  100 (116)
T ss_pred             EECCCCeEEEEcCCCEEEECCCCeE
Confidence            4567789999999999999999864


No 37 
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase. This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.
Probab=88.79  E-value=0.76  Score=36.41  Aligned_cols=38  Identities=5%  Similarity=-0.123  Sum_probs=31.4

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeec
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSN   49 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~   49 (91)
                      -+....++||++.+|+++-|--.|.+|.   +++.+..+|.
T Consensus       119 g~~~~~~~gD~~~tP~w~wH~H~n~~d~---~~~wld~lD~  156 (335)
T TIGR02272       119 GERTTMHPGDFIITPSWTWHDHGNPGDE---PMIWLDGLDI  156 (335)
T ss_pred             CEEEeeeCCCEEEeCCCeeEecccCCCC---cEEEEecCCH
Confidence            3578899999999999999999999875   7777666653


No 38 
>PF08007 Cupin_4:  Cupin superfamily protein;  InterPro: IPR022777  This signature represents primarily the cupin fold found in JmjC transcription factors. The fold is also found in lysine-specific demethylase NO66.; PDB: 2XDV_A 1VRB_B 4DIQ_B.
Probab=88.45  E-value=0.61  Score=35.94  Aligned_cols=30  Identities=20%  Similarity=0.207  Sum_probs=21.4

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEE
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRI   43 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i   43 (91)
                      ...-|+.||++.||+|++|+....+.    -+.+
T Consensus       176 ~~~~L~pGD~LYlPrG~~H~~~~~~~----S~hl  205 (319)
T PF08007_consen  176 EEVVLEPGDVLYLPRGWWHQAVTTDP----SLHL  205 (319)
T ss_dssp             EEEEE-TT-EEEE-TT-EEEEEESS-----EEEE
T ss_pred             EEEEECCCCEEEECCCccCCCCCCCC----ceEE
Confidence            46779999999999999999999973    4665


No 39 
>TIGR00218 manA mannose-6-phosphate isomerase, class I. The names phosphomannose isomerase and mannose-6-phosphate isomerase are synonomous. This family contains two rather deeply branched groups. One group contains an experimentally determined phosphomannose isomerase of Streptococcus mutans as well as three uncharacterized paralogous proteins of Bacillus subtilis, all at more than 50 % identity to each other, plus a more distant homolog from Archaeoglobus fulgidus. The other group contains members from E. coli, budding yeast, Borrelia burgdorferi, etc.
Probab=85.72  E-value=0.47  Score=36.23  Aligned_cols=20  Identities=15%  Similarity=0.479  Sum_probs=17.9

Q ss_pred             eeeeeccCcEEEeCCCCeEE
Q 038528           10 RTLDIRRGDVYRLQPGSVFY   29 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y   29 (91)
                      ....+++||++.||||++|=
T Consensus       151 n~v~v~~Gd~i~ipaGt~HA  170 (302)
T TIGR00218       151 NRIKLKPGDFFYVPSGTPHA  170 (302)
T ss_pred             cccccCCCCEEEeCCCCccc
Confidence            45778999999999999995


No 40 
>PF06249 EutQ:  Ethanolamine utilisation protein EutQ;  InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear [].; PDB: 2PYT_B 3LWC_A.
Probab=84.53  E-value=3.3  Score=29.53  Aligned_cols=39  Identities=21%  Similarity=0.319  Sum_probs=26.2

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTE   51 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n   51 (91)
                      +-+.+.-+.|||+.||.|+..=.--. +    ..+++.+..|.|
T Consensus       111 ~G~~~~A~~GDvi~iPkGs~I~fst~-~----~a~~~Yv~yPa~  149 (152)
T PF06249_consen  111 DGQTVTAKPGDVIFIPKGSTITFSTP-D----YARFFYVTYPAN  149 (152)
T ss_dssp             TTEEEEEETT-EEEE-TT-EEEEEEE-E----EEEEEEEEESTT
T ss_pred             CCEEEEEcCCcEEEECCCCEEEEecC-C----CEEEEEEECCCc
Confidence            35778889999999999998766433 2    567777776665


No 41 
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional
Probab=81.82  E-value=3.3  Score=30.26  Aligned_cols=28  Identities=18%  Similarity=0.154  Sum_probs=23.1

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      +.+.+.+.+||++.||+|..|..+...+
T Consensus        59 ~~~~~~l~~g~l~~i~p~~~H~~~~~~~   86 (278)
T PRK10296         59 NGKRVLLERGDFVFIPLGSHHQSFYEFG   86 (278)
T ss_pred             CCEEEEECCCcEEEeCCCCccceeeeCC
Confidence            3678899999999999999997765533


No 42 
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional
Probab=81.13  E-value=4.1  Score=29.96  Aligned_cols=29  Identities=21%  Similarity=0.354  Sum_probs=24.3

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      +.+.+.++.||++.+|+|+++.+....+.
T Consensus        65 ~~~~~~~~~g~~i~i~p~~~h~~~~~~~~   93 (290)
T PRK10572         65 GGRAFVCRPGDLLLFPPGEIHHYGRHPDS   93 (290)
T ss_pred             CCeeEecCCCCEEEECCCCceeeccCCCC
Confidence            45689999999999999999987776554


No 43 
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]
Probab=80.52  E-value=1.6  Score=30.71  Aligned_cols=31  Identities=16%  Similarity=0.274  Sum_probs=25.1

Q ss_pred             eeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEE
Q 038528           13 DIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAI   46 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l   46 (91)
                      ..+.||.+.||+|+++-=+|.-+.   ++..+..
T Consensus        91 ~~~pGDf~YiPpgVPHqp~N~S~e---p~s~vIa  121 (142)
T COG4101          91 EVGPGDFFYIPPGVPHQPANLSTE---PLSAVIA  121 (142)
T ss_pred             EecCCCeEEcCCCCCCcccccCCC---CeEEEEE
Confidence            348899999999999999999754   7765543


No 44 
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown]
Probab=80.27  E-value=1.4  Score=31.69  Aligned_cols=25  Identities=20%  Similarity=0.251  Sum_probs=19.1

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      -....+.+||++.||||+-|--...
T Consensus        84 G~el~v~~GDvlliPAGvGH~rl~s  108 (163)
T COG4297          84 GQELEVGEGDVLLIPAGVGHCRLHS  108 (163)
T ss_pred             CceeeecCCCEEEEecCcccccccC
Confidence            3456789999999999998754433


No 45 
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism]
Probab=78.99  E-value=1.5  Score=34.52  Aligned_cols=22  Identities=14%  Similarity=0.433  Sum_probs=19.1

Q ss_pred             ceeeeeccCcEEEeCCCCeEEE
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYI   30 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~   30 (91)
                      .+...|+.||.|.+|||++|=+
T Consensus       157 Ln~v~lkpGe~~fl~Agt~HA~  178 (312)
T COG1482         157 LNRVKLKPGEAFFLPAGTPHAY  178 (312)
T ss_pred             hcEEecCCCCEEEecCCCceee
Confidence            4677899999999999999854


No 46 
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family. The member of this family from Rhodobacter sphaeroides has been shown both to form a complex with sigma(E) and to negatively regulate tetrapyrrole biosynthesis. This protein likely contains (at least) two distinct functional domains; several smaller homologs (excluded by the model) show homology only to the C-terminal, including a motif PxHxHxGxE.
Probab=77.57  E-value=2.7  Score=30.86  Aligned_cols=36  Identities=8%  Similarity=-0.099  Sum_probs=30.2

Q ss_pred             eeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528           12 LDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      ..+.+||++++|+|+.|-..+..+.   +.+.++++|-.
T Consensus       163 g~y~~Gd~i~~p~~~~H~p~a~~~~---~Cicl~v~dap  198 (215)
T TIGR02451       163 GVYGVGDFEEADGSVQHQPRTVSGG---DCLCLAVLDAP  198 (215)
T ss_pred             CccCCCeEEECCCCCCcCcccCCCC---CeEEEEEecCC
Confidence            4679999999999999999999754   68888877644


No 47 
>PRK13501 transcriptional activator RhaR; Provisional
Probab=77.46  E-value=4.2  Score=30.03  Aligned_cols=27  Identities=26%  Similarity=0.276  Sum_probs=23.5

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~   34 (91)
                      +.+.+.+.+||++.||+|..|.+...+
T Consensus        54 ~~~~~~l~~g~~~~I~p~~~H~~~~~~   80 (290)
T PRK13501         54 NDHPYRITCGDVFYIQAADHHSYESVH   80 (290)
T ss_pred             CCeeeeecCCeEEEEcCCCcccccccC
Confidence            457899999999999999999987653


No 48 
>PRK15131 mannose-6-phosphate isomerase; Provisional
Probab=76.01  E-value=2.2  Score=34.20  Aligned_cols=23  Identities=9%  Similarity=0.124  Sum_probs=19.5

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEe
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIE   31 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~   31 (91)
                      .....|++||++.||||++|=..
T Consensus       236 LN~v~l~pGeaifipAg~~HAyl  258 (389)
T PRK15131        236 LNVVKLNPGEAMFLFAETPHAYL  258 (389)
T ss_pred             eeEEEeCCCCEEEeCCCCCeEEc
Confidence            35678999999999999999654


No 49 
>PF06339 Ectoine_synth:  Ectoine synthase;  InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins. The ectABC genes encode the diaminobutyric acid acetyltransferase (EctA), the diaminobutyric acid aminotransferase (EctB), and the ectoine synthase (EctC). Together these proteins constitute the ectoine biosynthetic pathway [].; GO: 0016836 hydro-lyase activity, 0006596 polyamine biosynthetic process
Probab=74.67  E-value=7.2  Score=27.18  Aligned_cols=46  Identities=20%  Similarity=0.480  Sum_probs=29.7

Q ss_pred             CCCceeeeeccCcEEEeCCCCeEEEeeCCCCC----cccEEEEEEeecCCC
Q 038528            6 EDDIRTLDIRRGDVYRLQPGSVFYIESNLEQE----REKLRIYAIFSNTED   52 (91)
Q Consensus         6 ~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e----~~~L~i~~l~d~~n~   52 (91)
                      +++-++..+..|.++.|-+|+. |+.|..|.-    .++|+++|+++|.=.
T Consensus        63 ~G~Gev~~~~~G~~~~i~pGt~-YaLd~hD~H~lra~~dm~~vCVFnPplt  112 (126)
T PF06339_consen   63 EGEGEVEDLDTGEVHPIKPGTM-YALDKHDRHYLRAKTDMRLVCVFNPPLT  112 (126)
T ss_pred             eceEEEEEccCCcEEEcCCCeE-EecCCCccEEEEecCCEEEEEEcCCCCc
Confidence            4455666677777777777754 555554321    237999999987643


No 50 
>COG2850 Uncharacterized conserved protein [Function unknown]
Probab=74.39  E-value=1.2  Score=36.13  Aligned_cols=23  Identities=22%  Similarity=0.381  Sum_probs=19.6

Q ss_pred             eeccCcEEEeCCCCeEEEeeCCC
Q 038528           13 DIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      -++.||++.||+|.+||=+--+|
T Consensus       182 vlepGDiLYiPp~~~H~gvae~d  204 (383)
T COG2850         182 VLEPGDILYIPPGFPHYGVAEDD  204 (383)
T ss_pred             hcCCCceeecCCCCCcCCccccc
Confidence            46899999999999999877644


No 51 
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=74.31  E-value=2.3  Score=31.16  Aligned_cols=23  Identities=17%  Similarity=0.274  Sum_probs=17.9

Q ss_pred             eeccCcEEEeCCCCeEEEeeCCC
Q 038528           13 DIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      -+++||.|.||||+-|=..=+.+
T Consensus       119 ~vekGDlivlPaGiyHRFTtt~~  141 (179)
T KOG2107|consen  119 FVEKGDLIVLPAGIYHRFTTTPS  141 (179)
T ss_pred             EEecCCEEEecCcceeeeecCch
Confidence            35999999999999886655543


No 52 
>PRK13503 transcriptional activator RhaS; Provisional
Probab=72.89  E-value=3.4  Score=29.95  Aligned_cols=26  Identities=12%  Similarity=0.130  Sum_probs=22.3

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      +.+.+.++.||++.||+|..+.....
T Consensus        51 ~~~~~~l~~g~~~~i~~~~~h~~~~~   76 (278)
T PRK13503         51 NGQPYTLSGGTVCFVRDHDRHLYEHT   76 (278)
T ss_pred             cCCcccccCCcEEEECCCccchhhhc
Confidence            45688999999999999999977665


No 53 
>PRK13502 transcriptional activator RhaR; Provisional
Probab=72.54  E-value=7.4  Score=28.43  Aligned_cols=26  Identities=23%  Similarity=0.369  Sum_probs=22.4

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      +.+++.+++||++.||+|.+|.+...
T Consensus        54 ~~~~~~l~~g~l~li~~~~~H~~~~~   79 (282)
T PRK13502         54 NERPYRITRGDLFYIRAEDKHSYTSV   79 (282)
T ss_pred             CCEEEeecCCcEEEECCCCccccccc
Confidence            46789999999999999999987654


No 54 
>PF05118 Asp_Arg_Hydrox:  Aspartyl/Asparaginyl beta-hydroxylase;  InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1.14.11.16 from EC) specifically hydroxylates one aspartic or asparagine residue in certain epidermal growth factor-like domains of a number of proteins. Its action may be due to histidine-675, which, when mutated to an alanine residue, causes the loss of enzymatic activity in the protein [].  An invertebrate alpha-ketoglutarate-dependent aspartyl/asparaginyl beta-hydroxylase, which posttranslationally hydroxylates specific aspartyl or asparaginyl residues within epidermal growth factor-like modules [], activity was found to be similar to that of the purified mammalian aspartyl/asparaginyl beta-hydroxylase with respect to cofactor requirements, stereochemistry and substrate sequence specificity []. This enzyme requires Fe2+ as a cofactor. Some vitamin K-dependent coagulation factors, as well as synthetic peptides based on the structure of the first epidermal growth factor domain of human coagulation factor IX or X, can act as acceptors.; GO: 0018193 peptidyl-amino acid modification, 0030176 integral to endoplasmic reticulum membrane; PDB: 3RCQ_A 1E5S_A 1E5R_B.
Probab=72.52  E-value=10  Score=26.52  Aligned_cols=28  Identities=14%  Similarity=0.206  Sum_probs=21.3

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQE   37 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e   37 (91)
                      +.+..++|.++.+-....|+..|.++..
T Consensus       124 ~~~~w~~G~~~~fD~s~~H~~~N~~~~~  151 (163)
T PF05118_consen  124 ETRHWREGECWVFDDSFEHEVWNNGDED  151 (163)
T ss_dssp             EEEB--CTEEEEE-TTS-EEEEESSSS-
T ss_pred             eEEEeccCcEEEEeCCEEEEEEeCCCCC
Confidence            5788899999999999999999998863


No 55 
>PRK13500 transcriptional activator RhaR; Provisional
Probab=72.46  E-value=7.9  Score=29.26  Aligned_cols=27  Identities=22%  Similarity=0.314  Sum_probs=23.1

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~   34 (91)
                      +.+.+.+++||++.||+|..|......
T Consensus        84 ~~~~~~l~~Gdl~~I~~~~~H~~~~~~  110 (312)
T PRK13500         84 NDRPYRITRGDLFYIHADDKHSYASVN  110 (312)
T ss_pred             CCEEEeecCCeEEEECCCCeecccccC
Confidence            357899999999999999999877653


No 56 
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA. This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.
Probab=71.52  E-value=7  Score=28.50  Aligned_cols=28  Identities=7%  Similarity=0.006  Sum_probs=23.7

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      .+.+.++.||++.+|+|.+|-+....+.
T Consensus        61 ~~~~~l~~g~~~ii~~~~~H~~~~~~~~   88 (287)
T TIGR02297        61 EHEYSEYAPCFFLTPPSVPHGFVTDLDA   88 (287)
T ss_pred             CEEEEecCCeEEEeCCCCccccccCCCc
Confidence            4688999999999999999998766544


No 57 
>PF11142 DUF2917:  Protein of unknown function (DUF2917);  InterPro: IPR021317  This bacterial family of proteins appears to be restricted to Proteobacteria. 
Probab=63.40  E-value=13  Score=22.45  Aligned_cols=30  Identities=23%  Similarity=0.491  Sum_probs=21.0

Q ss_pred             cccCC-CceeeeeccCcEEEeCCCCeEEEee
Q 038528            3 WADED-DIRTLDIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus         3 ~v~~~-~~~~~~lr~GDv~~ipaG~~~y~~N   32 (91)
                      |+..+ +..-+=|+.||.+.+|+|.-.|+-=
T Consensus        28 WlT~~g~~~D~~L~~G~~l~l~~g~~vvl~a   58 (63)
T PF11142_consen   28 WLTREGDPDDYWLQAGDSLRLRRGGRVVLSA   58 (63)
T ss_pred             EEECCCCCCCEEECCCCEEEeCCCCEEEEEe
Confidence            55433 4456667888888888888877753


No 58 
>PRK15450 signal transduction protein PmrD; Provisional
Probab=61.66  E-value=3.1  Score=27.12  Aligned_cols=35  Identities=20%  Similarity=0.377  Sum_probs=25.6

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      ....+++||.+ -|=--+.|++|+  +   +.+.+++++.+
T Consensus        36 s~~~l~~gDlL-sPL~dA~YciNr--~---~~~t~Kii~As   70 (85)
T PRK15450         36 SDFALKVGDLL-SPLQNALYCINR--E---KLQTLKILSAS   70 (85)
T ss_pred             hccccCccccc-ccchhhhhhhcC--C---CCceEEEEecc
Confidence            37789999987 577788999999  4   45555555544


No 59 
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase. This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.
Probab=61.37  E-value=18  Score=28.77  Aligned_cols=24  Identities=13%  Similarity=0.169  Sum_probs=19.9

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      +.++.++||++++|+-..+-..|.
T Consensus       288 ~~~~W~~gD~f~vPsW~~~~h~a~  311 (335)
T TIGR02272       288 AVFRFSPKDVFVVPSWHPVRFEAS  311 (335)
T ss_pred             EEEEecCCCEEEECCCCcEecccC
Confidence            468899999999999988666664


No 60 
>PF13734 Inhibitor_I69:  Spi protease inhibitor; PDB: 1PVJ_A 1DKI_D 2UZJ_A 2JTC_A 4D8E_A 4D8I_A 4D8B_A.
Probab=57.50  E-value=12  Score=24.64  Aligned_cols=21  Identities=14%  Similarity=0.327  Sum_probs=14.4

Q ss_pred             eCCCCeEEEeeCCCCCcccEEEEE
Q 038528           22 LQPGSVFYIESNLEQEREKLRIYA   45 (91)
Q Consensus        22 ipaG~~~y~~N~~~~e~~~L~i~~   45 (91)
                      .|..+++|++|. +++  -.+||+
T Consensus        37 ~~~~~~~YI~N~-~~~--GFVIVS   57 (96)
T PF13734_consen   37 TPSDTPYYIFND-NNK--GFVIVS   57 (96)
T ss_dssp             TT-SSSEEEEEE-TTS---EEEEE
T ss_pred             CCCCCcEEEEEc-CCC--EEEEEE
Confidence            788889999999 442  566655


No 61 
>PF12973 Cupin_7:  ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A.
Probab=57.42  E-value=8.4  Score=24.02  Aligned_cols=22  Identities=36%  Similarity=0.392  Sum_probs=17.8

Q ss_pred             eeeccCcEEEeCCCCeEEEeeC
Q 038528           12 LDIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      ..+.+||.++.|+|+.+=..-.
T Consensus        60 ~~~~~G~~~~~p~g~~h~~~s~   81 (91)
T PF12973_consen   60 GRYGAGDWLRLPPGSSHTPRSD   81 (91)
T ss_dssp             CEEETTEEEEE-TTEEEEEEES
T ss_pred             ccCCCCeEEEeCCCCccccCcC
Confidence            3569999999999999988853


No 62 
>PF04209 HgmA:  homogentisate 1,2-dioxygenase;  InterPro: IPR005708  Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism. The deficiency causes homogentisic aciduria, ochronosis, and arthritis. AKU patients are deficient for homogentisate 1,2 dioxygenase (1.13.11.5 from EC), the enzyme that mediates the conversion of homogentisate to maleylacetoacetate; a step in the catabolism of both tyrosine and phenylalanine.  Homogentisate + O(2) = 4-maleylacetoacetate.   ; GO: 0004411 homogentisate 1,2-dioxygenase activity, 0006559 L-phenylalanine catabolic process, 0006570 tyrosine metabolic process, 0055114 oxidation-reduction process; PDB: 1EY2_A 1EYB_A.
Probab=55.02  E-value=17  Score=29.94  Aligned_cols=31  Identities=35%  Similarity=0.436  Sum_probs=18.9

Q ss_pred             eeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEe
Q 038528           12 LDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIF   47 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~   47 (91)
                      -.++.||++.||.|+++-+.=.+     +.|.+.+=
T Consensus       166 L~v~pGd~~VIPRG~~~rv~l~~-----p~rgyi~E  196 (424)
T PF04209_consen  166 LDVRPGDYVVIPRGTRFRVELPG-----PARGYIIE  196 (424)
T ss_dssp             EEE-TTEEEEE-TT--EEEE-SS-----SEEEEEEE
T ss_pred             EEEcCCeEEEECCeeEEEEEeCC-----CceEEEEE
Confidence            46899999999999988876652     45555544


No 63 
>PF09347 DUF1989:  Domain of unknown function (DUF1989);  InterPro: IPR018959  This entry represents proteins that are functionally uncharacterised. ; PDB: 3ORU_A 3SIY_C 3DI4_A.
Probab=54.04  E-value=20  Score=25.53  Aligned_cols=32  Identities=13%  Similarity=0.161  Sum_probs=21.6

Q ss_pred             ccCCCceeeeeccCcEEEe-----CCCCeEEEeeCCC
Q 038528            4 ADEDDIRTLDIRRGDVYRL-----QPGSVFYIESNLE   35 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~i-----paG~~~y~~N~~~   35 (91)
                      |....-.+..|++|++++|     .+.+-+|+||.+|
T Consensus         4 Ip~g~~~a~~v~rG~~lri~d~~G~q~~d~~~~~a~d   40 (166)
T PF09347_consen    4 IPAGSGWAFRVKRGQVLRITDPEGNQVVDLLAYNADD   40 (166)
T ss_dssp             E-CT-EEEEEE-TT-EEEEEESSSS--EEEEEEETTE
T ss_pred             eCCCCceEEEECCCCEEEEEeCCCCceeEEEEEecCC
Confidence            4556778999999999998     4567789999976


No 64 
>PF14955 MRP-S24:  Mitochondrial ribosome subunit S24
Probab=53.79  E-value=24  Score=24.96  Aligned_cols=35  Identities=20%  Similarity=0.286  Sum_probs=23.7

Q ss_pred             EEEEEEeecCCCCCCCceeecCCCccCceecccCHHHHHHHhCCCc
Q 038528           41 LRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVLQSAFKRAV   86 (91)
Q Consensus        41 L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL~~Af~v~~   86 (91)
                      ++|..++  .+.++.++.|         +|-||++++|+.-++.+.
T Consensus        84 I~Ia~~~--~~~l~~~k~Y---------FL~GYtEelLS~~lkcpV  118 (136)
T PF14955_consen   84 IRIAGIV--LRRLQPRKIY---------FLIGYTEELLSHWLKCPV  118 (136)
T ss_pred             EEEeEee--eccCCceeEE---------EehhhhHHHHHHHHCCCe
Confidence            3444443  3334566664         678999999999998764


No 65 
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional
Probab=53.75  E-value=22  Score=26.83  Aligned_cols=28  Identities=7%  Similarity=0.106  Sum_probs=23.3

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      +.+++.+.+||++.|++|.+|-+...++
T Consensus        62 ~g~~~~l~~Gd~ili~s~~~H~~~~~~~   89 (302)
T PRK10371         62 NNEKVQINQGHITLFWACTPHQLTDPGN   89 (302)
T ss_pred             CCEEEEEcCCcEEEEecCCcccccccCC
Confidence            4578889999999999999997766544


No 66 
>cd00433 Peptidase_M17 Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and play a key role in protein degradation and in the metabolism of biologically active peptides. They do not contain HEXXH motif (which is used as one of the signature patterns to group the peptidase families) in the metal-binding site. The two associated zinc ions and the active site are entirely enclosed within the C-terminal catalytic domain in leucine aminopeptidase. The enzyme is a hexamer, with the catalytic domains clustered around the three-fold axis, and the two trimers related to one another by a two-fold rotation. The N-terminal domain is structurally similar to the ADP-ribose binding Macro domain. This family includes proteins from bacteria, archaea, animals and plants.
Probab=51.43  E-value=19  Score=29.72  Aligned_cols=35  Identities=23%  Similarity=0.211  Sum_probs=29.1

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEE
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIY   44 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~   44 (91)
                      --...-.|+|||+.--.|.+.=+.|+|-+.  ||++.
T Consensus       296 ~is~~A~rPgDVi~s~~GkTVEI~NTDAEG--RLVLa  330 (468)
T cd00433         296 MISGNAYRPGDVITSRSGKTVEILNTDAEG--RLVLA  330 (468)
T ss_pred             CCCCCCCCCCCEeEeCCCcEEEEecCCccc--ceeeh
Confidence            344556799999999999999999998765  88874


No 67 
>PRK00913 multifunctional aminopeptidase A; Provisional
Probab=49.39  E-value=22  Score=29.63  Aligned_cols=33  Identities=18%  Similarity=0.196  Sum_probs=28.0

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEE
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIY   44 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~   44 (91)
                      -..-+|+|||+..-.|.+.=+.|+|-+.  +|++.
T Consensus       312 ~~~A~rPgDVi~~~~GkTVEV~NTDAEG--RLvLA  344 (483)
T PRK00913        312 SGNAYRPGDVLTSMSGKTIEVLNTDAEG--RLVLA  344 (483)
T ss_pred             CCCCCCCCCEEEECCCcEEEeecCCccc--ceeeh
Confidence            3456799999999999999999998664  88875


No 68 
>PF11183 PmrD:  Polymyxin resistance protein PmrD;  InterPro: IPR020146 The Salmonella PmrA/PmrB two-component system is required for resistance to the cationic peptide antibiotic olymyxin B, resistance to Fe(3+)-mediated killing, growth in soil, virulence in mice, and infection of chicken macrophages. PmrA-activated genes encode periplasmic and integral membrane proteins as well as cytoplasmic products mediating the modification of the lipopolysaccharide, suggesting a role for the PmrA/PmrB system in remodeling of the Gram-negative envelope. The PmrA/PmrB two-component system of Salmonella enterica is activated by Fe(3+), which is sensed by the PmrB protein, and by low Mg(2+), which is sensed by the PhoQ protein. The low Mg(2+) activation requires pmrD, a PhoPPhoQ-activated gene that activates the response regulator PmrA at a posttranscriptional level. However, under conditions that activate the PmrA protein independently of pmrD, such as exposure to Fe3, lower levels of pmrD transcription occur. It has been demonstrated that PmrA binds to the pmrD promoter, suppressing transcription. Negative regulation of the PhoP/PhoQ-activated pmrD gene by the PmrA/ PmrB system closes a regulatory circuit designed to maintain proper cellular levels of activated PmrA protein, and constitutes a singular example of a multicomponent feedback loop []. ; PDB: 2RQX_A 2JSO_A.
Probab=48.78  E-value=22  Score=23.07  Aligned_cols=33  Identities=12%  Similarity=0.284  Sum_probs=19.9

Q ss_pred             eeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEE
Q 038528           11 TLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAI   46 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l   46 (91)
                      .+.|++||.+- |=--+.|++|++..  +.|.|+.-
T Consensus        37 ~~~l~~GD~Lt-Pl~dA~YciNr~~~--~tvKii~A   69 (82)
T PF11183_consen   37 DFRLQEGDKLT-PLQDALYCINRNKA--QTVKIISA   69 (82)
T ss_dssp             SS---TT-EEE-ESSSSEEEECTECC--CEEEEEEE
T ss_pred             CcccCCCCCcc-ccccceEEeecCCC--ceEEEEec
Confidence            57889999985 33345799999544  57777654


No 69 
>PHA02984 hypothetical protein; Provisional
Probab=47.51  E-value=60  Score=25.55  Aligned_cols=45  Identities=13%  Similarity=0.236  Sum_probs=36.9

Q ss_pred             cCCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCC
Q 038528            5 DEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDD   53 (91)
Q Consensus         5 ~~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~   53 (91)
                      ..+.+-+.++.+|+.+.+--++-|=++-.+-    .|+++.+.-+++-|
T Consensus       110 ~~~~~is~~I~kGeaf~md~~t~h~i~T~~k----nl~L~Vi~y~v~~p  154 (286)
T PHA02984        110 NKGSKITNTIKKGEAFTLNLKTKYVTTTKDK----NLHLAVITYTSNCP  154 (286)
T ss_pred             cCCceeeeEEecCceEEEEccceEEEEeCCC----ceEEEEEEEEecce
Confidence            4567779999999999999999999998854    58877777777653


No 70 
>PF02787 CPSase_L_D3:  Carbamoyl-phosphate synthetase large chain, oligomerisation domain;  InterPro: IPR005480 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the oligomerisation domain found in the large subunit of carbamoyl phosphate synthases as well as in certain other carboxy phsophate domain-containing enzymes.; GO: 0006807 nitrogen compound metabolic process; PDB: 1M6V_C 1CS0_C 1C30_E 1C3O_G 1BXR_A 1T36_E 1A9X_A 1KEE_G 1CE8_A 1JDB_H ....
Probab=47.43  E-value=9.3  Score=25.94  Aligned_cols=20  Identities=15%  Similarity=0.253  Sum_probs=15.0

Q ss_pred             cccCHHHHHHHhCCCccccc
Q 038528           71 LGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        71 ~GF~~~iL~~Af~v~~~~i~   90 (91)
                      .|||...||...|++++.|+
T Consensus        71 ~GFsD~~IA~l~~~~e~~vr   90 (123)
T PF02787_consen   71 LGFSDRQIARLWGVSEEEVR   90 (123)
T ss_dssp             TT--HHHHHHHHTS-HHHHH
T ss_pred             cCCCHHHHHhccCCCHHHHH
Confidence            59999999999999988775


No 71 
>TIGR03424 urea_degr_1 urea carboxylase-associated protein 1. A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes.
Probab=47.16  E-value=31  Score=25.36  Aligned_cols=33  Identities=6%  Similarity=0.105  Sum_probs=26.1

Q ss_pred             ccCCCceeeeeccCcEEEe-----CCCCeEEEeeCCCC
Q 038528            4 ADEDDIRTLDIRRGDVYRL-----QPGSVFYIESNLEQ   36 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~i-----paG~~~y~~N~~~~   36 (91)
                      |....-.++.|++|++++|     .+.+-+|++|.+|.
T Consensus         8 Ip~g~~~a~~v~~Gq~lri~d~~G~q~~d~~~~na~d~   45 (198)
T TIGR03424         8 VPAGEPWSAVVKAGQTLRIVDLEGNQAVDTLFYNAHDT   45 (198)
T ss_pred             ECCCCceEEEECCCCEEEEEeCCCCeEEEEEEecCCCC
Confidence            4455678999999999998     45667899998763


No 72 
>PRK05341 homogentisate 1,2-dioxygenase; Provisional
Probab=47.09  E-value=18  Score=29.93  Aligned_cols=20  Identities=30%  Similarity=0.617  Sum_probs=17.6

Q ss_pred             eeeccCcEEEeCCCCeEEEe
Q 038528           12 LDIRRGDVYRLQPGSVFYIE   31 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~   31 (91)
                      -.++.||++.||.|+.|-+.
T Consensus       174 L~v~pgei~VIPRG~~frv~  193 (438)
T PRK05341        174 LDVEPGEIAVIPRGVKFRVE  193 (438)
T ss_pred             eEecCCCEEEEcCccEEEEe
Confidence            46799999999999998776


No 73 
>TIGR01015 hmgA homogentisate 1,2-dioxygenase. Missing in human disease alkaptonuria.
Probab=46.34  E-value=19  Score=29.74  Aligned_cols=22  Identities=9%  Similarity=0.138  Sum_probs=18.5

Q ss_pred             eeccCcEEEeCCCCeEEEeeCC
Q 038528           13 DIRRGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~~   34 (91)
                      .++.||++.||.|+.|-+.=.+
T Consensus       169 ~v~pgei~VIPRG~~frv~l~g  190 (429)
T TIGR01015       169 LVEPNEICVIPRGVRFRVTVLE  190 (429)
T ss_pred             EecCCCEEEecCccEEEEeeCC
Confidence            6899999999999998776543


No 74 
>PLN02658 homogentisate 1,2-dioxygenase
Probab=45.06  E-value=20  Score=29.61  Aligned_cols=21  Identities=19%  Similarity=0.449  Sum_probs=17.6

Q ss_pred             eeeccCcEEEeCCCCeEEEee
Q 038528           12 LDIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N   32 (91)
                      -.++.||++.||.|+.|-+.=
T Consensus       167 L~v~pgei~VIPRG~~frv~l  187 (435)
T PLN02658        167 LQVSPGEIVVIPRGFRFAVDL  187 (435)
T ss_pred             eEecCCCEEEecCccEEEEec
Confidence            467999999999999977663


No 75 
>PRK05015 aminopeptidase B; Provisional
Probab=42.96  E-value=31  Score=28.48  Aligned_cols=34  Identities=15%  Similarity=0.235  Sum_probs=28.6

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEE
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIY   44 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~   44 (91)
                      -...-+|.||||.-..|.+.=+.|+|-+.  +|++.
T Consensus       248 isg~A~kpgDVIt~~nGkTVEI~NTDAEG--RLVLA  281 (424)
T PRK05015        248 ISGNAFKLGDIITYRNGKTVEVMNTDAEG--RLVLA  281 (424)
T ss_pred             CCCCCCCCCCEEEecCCcEEeeeccCccc--eeeeh
Confidence            33456799999999999999999998764  88875


No 76 
>PF00122 E1-E2_ATPase:  E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature;  InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the actuator (A) domain, and some transmembrane helices found in P-type ATPases []. It contains the TGES-loop which is essential for the metal ion binding which results in tight association between the A and P (phosphorylation) domains []. It does not contain the phosphorylation site. It is thought that the large movement of the actuator domain, which is transmitted to the transmembrane helices, is essential to the long distance coupling between formation/decomposition of the acyl phosphate in the cytoplasmic P-domain and the changes in the ion-binding sites buried deep in the membranous region []. This domain has a modulatory effect on the phosphoenzyme processing steps through its nucleotide binding [],[].  P-type (or E1-E2-type) ATPases that form an aspartyl phosphate intermediate in the course of ATP hydrolysis, can be divided into 4 major groups []: (1) Ca2+-transporting ATPases; (2) Na+/K+- and gastric H+/K+-transporting ATPases; (3) plasma membrane H+-transporting ATPases (proton pumps) of plants, fungi and lower eukaryotes; and (4) all bacterial P-type ATPases, except the g2+-ATPase of Salmonella typhimurium, which is more similar to the eukaryotic sequences. However, great variety of sequence analysis methods results in diversity of classification. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0000166 nucleotide binding, 0046872 metal ion binding; PDB: 2XZB_A 1MHS_B 3TLM_A 3A3Y_A 2ZXE_A 3NAL_A 3NAM_A 3NAN_A 2YJ6_B 2IYE_A ....
Probab=42.28  E-value=11  Score=26.58  Aligned_cols=18  Identities=22%  Similarity=0.527  Sum_probs=13.9

Q ss_pred             eeeeeccCcEEEeCCCCe
Q 038528           10 RTLDIRRGDVYRLQPGSV   27 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~   27 (91)
                      ...+|+.||++.|.+|-.
T Consensus        48 ~~~~L~~GDiI~l~~g~~   65 (230)
T PF00122_consen   48 PSSELVPGDIIILKAGDI   65 (230)
T ss_dssp             EGGGT-TTSEEEEETTEB
T ss_pred             hHhhccceeeeecccccc
Confidence            456789999999988864


No 77 
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=41.98  E-value=16  Score=21.13  Aligned_cols=15  Identities=27%  Similarity=0.372  Sum_probs=12.3

Q ss_pred             ceeeeeccCcEEEeC
Q 038528            9 IRTLDIRRGDVYRLQ   23 (91)
Q Consensus         9 ~~~~~lr~GDv~~ip   23 (91)
                      +.++.|+.||++.||
T Consensus        45 ~~~~~l~~Gd~v~i~   59 (59)
T TIGR02988        45 RRGKKLYPGDVIEIP   59 (59)
T ss_pred             CCCCCCCCCCEEEeC
Confidence            447889999999875


No 78 
>PHA00144 major head protein
Probab=41.37  E-value=28  Score=28.80  Aligned_cols=14  Identities=36%  Similarity=0.453  Sum_probs=11.3

Q ss_pred             cCHHHHHHHhCCCc
Q 038528           73 FDRKVLQSAFKRAV   86 (91)
Q Consensus        73 F~~~iL~~Af~v~~   86 (91)
                      ||-+.|++|||.+.
T Consensus       255 lDVd~LA~AFNmd~  268 (438)
T PHA00144        255 LDVDVLAKAFNMDK  268 (438)
T ss_pred             ecHHHHHHHhCcch
Confidence            67778999998875


No 79 
>KOG3706 consensus Uncharacterized conserved protein [Function unknown]
Probab=38.82  E-value=19  Score=30.71  Aligned_cols=21  Identities=14%  Similarity=0.374  Sum_probs=17.1

Q ss_pred             eeccCcEEEeCCCCeEEEeeC
Q 038528           13 DIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      =|+.||++.+|.|++|=..-.
T Consensus       384 vle~GDllYfPRG~IHQA~t~  404 (629)
T KOG3706|consen  384 VLEPGDLLYFPRGTIHQADTP  404 (629)
T ss_pred             hcCCCcEEEecCcceeecccc
Confidence            468999999999999865443


No 80 
>PLN02288 mannose-6-phosphate isomerase
Probab=38.27  E-value=23  Score=28.67  Aligned_cols=20  Identities=10%  Similarity=0.174  Sum_probs=17.4

Q ss_pred             eeeeeccCcEEEeCCCCeEE
Q 038528           10 RTLDIRRGDVYRLQPGSVFY   29 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y   29 (91)
                      ....|++|+.|.+|||++|=
T Consensus       251 N~v~L~PGeaifl~ag~~HA  270 (394)
T PLN02288        251 NYVKLNPGEALYLGANEPHA  270 (394)
T ss_pred             ceEecCCCCEEEecCCCCce
Confidence            35689999999999999984


No 81 
>PRK11507 ribosome-associated protein; Provisional
Probab=37.19  E-value=21  Score=22.41  Aligned_cols=18  Identities=11%  Similarity=0.180  Sum_probs=15.1

Q ss_pred             CCceeeeeccCcEEEeCC
Q 038528            7 DDIRTLDIRRGDVYRLQP   24 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ipa   24 (91)
                      +.++-..|+.||++-++-
T Consensus        46 e~rRgkKl~~GD~V~~~g   63 (70)
T PRK11507         46 ETRKRCKIVAGQTVSFAG   63 (70)
T ss_pred             ecccCCCCCCCCEEEECC
Confidence            467889999999998864


No 82 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=36.73  E-value=66  Score=23.56  Aligned_cols=28  Identities=18%  Similarity=0.182  Sum_probs=22.4

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNLE   35 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~~   35 (91)
                      +.+...++.||++.+|++.++-+.-.++
T Consensus        87 ~g~~~~l~~G~~~l~~~~~p~~~~~~~~  114 (302)
T PRK09685         87 DDRQVQLAAGDITLIDASRPCSIYPQGL  114 (302)
T ss_pred             CCeEEEEcCCCEEEEECCCCcEeecCCC
Confidence            3467889999999999999987765543


No 83 
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53,  Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation).
Probab=36.18  E-value=41  Score=20.12  Aligned_cols=23  Identities=30%  Similarity=0.442  Sum_probs=15.2

Q ss_pred             eeeeeccCcEEEeCCCCeEEEee
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N   32 (91)
                      +...|..||++.+..|...+.++
T Consensus        79 ~~~~l~~gd~i~ig~~~~~~~~~  101 (102)
T cd00060          79 EPVRLRDGDVIRLGNTSISFRFE  101 (102)
T ss_pred             CcEECCCCCEEEECCeEEEEEEe
Confidence            35667778888887755555543


No 84 
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair]
Probab=35.48  E-value=24  Score=22.34  Aligned_cols=19  Identities=26%  Similarity=0.413  Sum_probs=15.8

Q ss_pred             CCceeeeeccCcEEEeCCC
Q 038528            7 DDIRTLDIRRGDVYRLQPG   25 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ipaG   25 (91)
                      +.+|-..||.||++-+|-.
T Consensus        46 EtRRgkKlr~gd~V~i~~~   64 (73)
T COG2501          46 ETRRGKKLRDGDVVEIPGQ   64 (73)
T ss_pred             eeccCCEeecCCEEEECCE
Confidence            4678889999999999853


No 85 
>PF15517 TBPIP_N:  TBP-interacting protein N-terminus; PDB: 2CZR_A.
Probab=35.26  E-value=29  Score=23.16  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=12.4

Q ss_pred             cEEEeCCCCeEEEeeC
Q 038528           18 DVYRLQPGSVFYIESN   33 (91)
Q Consensus        18 Dv~~ipaG~~~y~~N~   33 (91)
                      |+++||---+||+-|-
T Consensus        64 ~iivvP~kgtFYi~NG   79 (99)
T PF15517_consen   64 DIIVVPGKGTFYINNG   79 (99)
T ss_dssp             EEEEES-TT-EEEETT
T ss_pred             EEEEECCCCeEEEeCc
Confidence            8999999999999774


No 86 
>TIGR03028 EpsE polysaccharide export protein EpsE. Sequences in this family of proteins are members of a polysaccharide export protein family (pfam02563) which includes the wza protein from E.coli. This family of proteins are homologous to the EpsE protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Probab=34.07  E-value=49  Score=24.33  Aligned_cols=20  Identities=30%  Similarity=0.627  Sum_probs=15.9

Q ss_pred             eeeeccCcEEEeCCCCeEEE
Q 038528           11 TLDIRRGDVYRLQPGSVFYI   30 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~   30 (91)
                      -..|+.||+|.+|..-.+|+
T Consensus       148 ni~L~~GD~I~V~~~~~v~v  167 (239)
T TIGR03028       148 NILVAGGDIIYVDRAPVFYI  167 (239)
T ss_pred             CcEEcCCCEEEEcCCccEEE
Confidence            46789999999998766555


No 87 
>PF07506 RepB:  RepB plasmid partitioning protein;  InterPro: IPR011111 This family includes proteins with sequence similarity to the RepB partitioning protein of the large Ti (tumour-inducing) plasmids of Agrobacterium tumefaciens [, ].
Probab=33.89  E-value=27  Score=24.77  Aligned_cols=19  Identities=26%  Similarity=0.359  Sum_probs=17.1

Q ss_pred             cccCHHHHHHHhCCCcccc
Q 038528           71 LGFDRKVLQSAFKRAVLLL   89 (91)
Q Consensus        71 ~GF~~~iL~~Af~v~~~~i   89 (91)
                      +||+.+.+++|++++...+
T Consensus        20 ~G~~~~~I~~aL~id~~~l   38 (185)
T PF07506_consen   20 RGFSREEIAAALGIDKSYL   38 (185)
T ss_pred             cCCCHHHHHHHHCCCHHHH
Confidence            6999999999999998765


No 88 
>PF09700 Cas_Cmr3:  CRISPR-associated protein (Cas_Cmr3);  InterPro: IPR019117 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a highly divergent family of Cas proteins, found in at least ten different archaeal and bacterial species, including TM1793 from Thermotoga maritima. 
Probab=33.86  E-value=29  Score=26.55  Aligned_cols=17  Identities=24%  Similarity=0.522  Sum_probs=14.6

Q ss_pred             EEeCCCCeEEEeeCCCC
Q 038528           20 YRLQPGSVFYIESNLEQ   36 (91)
Q Consensus        20 ~~ipaG~~~y~~N~~~~   36 (91)
                      .++||||++|+-...+.
T Consensus       307 ~avpaGSVy~~~~~~~~  323 (351)
T PF09700_consen  307 RAVPAGSVYFFEAEEGE  323 (351)
T ss_pred             cccCCceEEEEEcCCcc
Confidence            68999999999888655


No 89 
>PF07103 DUF1365:  Protein of unknown function (DUF1365);  InterPro: IPR010775 This family consists of several bacterial and plant proteins of around 250 residues in length. The function of this family is unknown.
Probab=33.42  E-value=63  Score=24.40  Aligned_cols=33  Identities=15%  Similarity=0.084  Sum_probs=23.1

Q ss_pred             CCCeEEEeeCCCCCcccEEEEEEeecCCCC-CCCceeec
Q 038528           24 PGSVFYIESNLEQEREKLRIYAIFSNTEDD-SYFEPVIG   61 (91)
Q Consensus        24 aG~~~y~~N~~~~e~~~L~i~~l~d~~n~~-~~~~~fla   61 (91)
                      +=+.+|||..++    +|+ +.|+.++|.| +++..|+-
T Consensus       105 PvSfyyc~d~~~----~l~-~vvaEV~NTPfgErH~Yvl  138 (254)
T PF07103_consen  105 PVSFYYCYDADG----QLR-AVVAEVNNTPFGERHCYVL  138 (254)
T ss_pred             CeEEEEEEcCCC----CEE-EEEEEEeCCCCCcEEEEEe
Confidence            336788998754    455 5677888885 78887654


No 90 
>TIGR01888 cas_cmr3 CRISPR-associated protein, Cmr3 family. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. This highly divergent family is found in at least ten different archaeal and bacterial species as part of the CRISPR RAMP modulue but is not a member of the RAMP superfamily itself. A typical example is TM1793 from Thermotoga maritima.
Probab=32.80  E-value=25  Score=27.23  Aligned_cols=22  Identities=23%  Similarity=0.533  Sum_probs=16.2

Q ss_pred             ccCcEEEeCCCCeEEEeeCCCC
Q 038528           15 RRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      .+--.=++||||++|+-...++
T Consensus       288 pkp~~~avpaGSVy~~~~~~~~  309 (337)
T TIGR01888       288 PKPTLRAVPPGSVYFFKAKEEG  309 (337)
T ss_pred             CCCCccccCCCcEEEEEeccCC
Confidence            3344568999999999876443


No 91 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=32.73  E-value=41  Score=20.64  Aligned_cols=17  Identities=29%  Similarity=0.522  Sum_probs=8.7

Q ss_pred             CCceeeeeccCcEEEeC
Q 038528            7 DDIRTLDIRRGDVYRLQ   23 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ip   23 (91)
                      +.++...|+.||++.++
T Consensus        42 e~rrg~Kl~~GD~V~~~   58 (65)
T PF13275_consen   42 ETRRGKKLRPGDVVEID   58 (65)
T ss_dssp             ---SS----SSEEEEET
T ss_pred             ccccCCcCCCCCEEEEC
Confidence            46788999999999883


No 92 
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=32.53  E-value=38  Score=27.87  Aligned_cols=24  Identities=21%  Similarity=0.472  Sum_probs=19.6

Q ss_pred             eeeeccCcEEEeCCCCeEEEeeCC
Q 038528           11 TLDIRRGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~~N~~   34 (91)
                      ...+++||+..||.|+.|=+-=-+
T Consensus       165 ~l~v~pgeiavIPRG~~frve~~~  188 (427)
T COG3508         165 VLEVEPGEIAVIPRGTTFRVELKD  188 (427)
T ss_pred             eEEecCCcEEEeeCCceEEEEecC
Confidence            457899999999999998776553


No 93 
>PF07497 Rho_RNA_bind:  Rho termination factor, RNA-binding domain;  InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers [].; GO: 0003723 RNA binding, 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=32.52  E-value=22  Score=22.62  Aligned_cols=18  Identities=28%  Similarity=0.589  Sum_probs=11.2

Q ss_pred             ccCCCceeeeeccCcEEE
Q 038528            4 ADEDDIRTLDIRRGDVYR   21 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~   21 (91)
                      |.+.--+.++||+||++.
T Consensus        33 Vs~~qIrrf~LR~GD~V~   50 (78)
T PF07497_consen   33 VSPSQIRRFGLRTGDLVE   50 (78)
T ss_dssp             E-CCCCCCTT--TTEEEE
T ss_pred             ECHHHHHHcCCCCCCEEE
Confidence            444445788999999985


No 94 
>TIGR02408 ectoine_ThpD ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Probab=32.30  E-value=1e+02  Score=23.10  Aligned_cols=40  Identities=13%  Similarity=0.227  Sum_probs=24.6

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      +...++.|||+..-.=+.|.---|-.+. .+..++..+..+
T Consensus       211 v~~~~~aGDvl~f~~~~~H~S~~N~s~~-~R~~l~l~y~~~  250 (277)
T TIGR02408       211 STFTGKAGSAVWFDCNTMHGSGSNITPW-PRSNVFMVFNSV  250 (277)
T ss_pred             eeeccCCceEEEEccccccCCCCCCCCC-cceeEEEEEecC
Confidence            3456788888888888888776443332 355555545433


No 95 
>PF15572 Imm26:  Immunity protein 26
Probab=32.18  E-value=1.4e+02  Score=19.81  Aligned_cols=33  Identities=15%  Similarity=0.349  Sum_probs=22.1

Q ss_pred             eeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      +...|++|+|+++|+=   |=  .  +   +.+=.++++..+.
T Consensus         7 ~~~~l~rG~i~R~~~~---yp--y--e---~~VDFmV~e~~~~   39 (96)
T PF15572_consen    7 KEKYLWRGTIFRCPGV---YP--Y--E---EVVDFMVFEDPDF   39 (96)
T ss_pred             CCccEecceEEEeccc---CC--C--c---ccEEEEEEeccCC
Confidence            3457999999999987   21  1  2   4555666666654


No 96 
>PF09023 Staphostatin_B:  Staphostatin B;  InterPro: IPR015113 Staphostatin B inhibits the cysteine protease Staphopain B, produced by Staphylococcus aureus, by blocking the active site of the enzyme. The domain adopts an eight-stranded mixed beta-barrel structure, with a deviation from the up-down topology of canonical beta-barrels in the amino-terminal part of the molecule []. ; PDB: 1QWX_B 1NYC_B 1Y4H_D 1PXV_D.
Probab=32.10  E-value=24  Score=23.86  Aligned_cols=17  Identities=29%  Similarity=0.712  Sum_probs=14.6

Q ss_pred             ccccCCCceeeeeccCc
Q 038528            2 SWADEDDIRTLDIRRGD   18 (91)
Q Consensus         2 ~~v~~~~~~~~~lr~GD   18 (91)
                      .|++++.|++-++|.||
T Consensus        30 nWin~~~qkSi~Ir~g~   46 (107)
T PF09023_consen   30 NWINHQLQKSICIRHGD   46 (107)
T ss_dssp             EEEETTTTEEEEEEEE-
T ss_pred             ccCCcchhccEEEEecC
Confidence            59999999999999876


No 97 
>PF15428 Imm14:  Immunity protein 14
Probab=31.81  E-value=32  Score=22.63  Aligned_cols=15  Identities=20%  Similarity=0.472  Sum_probs=10.7

Q ss_pred             ccCcEEEeCCCCeEE
Q 038528           15 RRGDVYRLQPGSVFY   29 (91)
Q Consensus        15 r~GDv~~ipaG~~~y   29 (91)
                      ++|||+++|-.--.|
T Consensus         1 K~GDIF~ipL~~~~y   15 (129)
T PF15428_consen    1 KPGDIFCIPLDDGKY   15 (129)
T ss_pred             CCceEEEEEcCCCCE
Confidence            579999999544444


No 98 
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=31.21  E-value=20  Score=22.16  Aligned_cols=14  Identities=36%  Similarity=0.567  Sum_probs=11.2

Q ss_pred             ceeeeeccCcEEEe
Q 038528            9 IRTLDIRRGDVYRL   22 (91)
Q Consensus         9 ~~~~~lr~GDv~~i   22 (91)
                      -+.++||+||+|.=
T Consensus        36 Irr~~LR~GD~V~G   49 (68)
T cd04459          36 IRRFNLRTGDTVVG   49 (68)
T ss_pred             HHHhCCCCCCEEEE
Confidence            36789999999954


No 99 
>TIGR03425 urea_degr_2 urea carboxylase-associated protein 2. A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes.
Probab=31.17  E-value=76  Score=24.00  Aligned_cols=33  Identities=15%  Similarity=0.151  Sum_probs=25.2

Q ss_pred             ccCCCceeeeeccCcEEEe-----CCCCeEEEeeCCCC
Q 038528            4 ADEDDIRTLDIRRGDVYRL-----QPGSVFYIESNLEQ   36 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~i-----paG~~~y~~N~~~~   36 (91)
                      |....-.+..|++|++++|     .+.+-+|++|.+|.
T Consensus         7 Ip~g~~~s~~v~rGq~lri~d~~G~q~~d~~~~na~d~   44 (233)
T TIGR03425         7 VPGGGYWSKVLRRGTRLRLTDLEGGANVSLLLYNADAP   44 (233)
T ss_pred             ECCCCcEEEEECCCCEEEEEeCCCCeEeeeEEecCCCc
Confidence            3455678999999999998     34566799998763


No 100
>TIGR03876 cas_csaX CRISPR-associated protein, CsaX family. This family comprises a minor CRISPR-associated protein family. It occurs only in the context of the (strictly archaeal) Apern subtype of CRISPR/Cas system, and is further restricted to the Sulfolobales, including Metallosphaera sedula DSM 5348 and multiple species of the genus Sulfolobus.
Probab=30.93  E-value=21  Score=27.56  Aligned_cols=16  Identities=13%  Similarity=0.221  Sum_probs=13.8

Q ss_pred             cCCCccCceecccCHH
Q 038528           61 GAYTSISDLILGFDRK   76 (91)
Q Consensus        61 ag~~~~~ni~~GF~~~   76 (91)
                      |||++|..|..|||.+
T Consensus       202 AgGQnPTti~GGFsid  217 (281)
T TIGR03876       202 AGGQNPTTIVGGFSID  217 (281)
T ss_pred             cCCCCCceEecceeee
Confidence            5778999999999964


No 101
>cd02790 MopB_CT_Formate-Dh_H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is a monomer composed of a single polypeptide chain with a  Mo active site region and a [4Fe-4S] center. This CD (MopB_CT_Formate-Dh_H) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=30.84  E-value=12  Score=23.62  Aligned_cols=20  Identities=25%  Similarity=0.450  Sum_probs=14.9

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      |+++++-+...|+.||.+.|
T Consensus        38 ~in~~dA~~lgi~~Gd~V~v   57 (116)
T cd02790          38 EINPEDAKRLGIEDGEKVRV   57 (116)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56677777888888887744


No 102
>COG3273 Uncharacterized conserved protein [Function unknown]
Probab=30.10  E-value=32  Score=25.80  Aligned_cols=19  Identities=21%  Similarity=0.249  Sum_probs=15.9

Q ss_pred             cEEEeCCCCeEEEeeCCCCC
Q 038528           18 DVYRLQPGSVFYIESNLEQE   37 (91)
Q Consensus        18 Dv~~ipaG~~~y~~N~~~~e   37 (91)
                      +||+|..|- -|+||++.+.
T Consensus       148 rVIAIRRG~-~wi~~Pd~~~  166 (204)
T COG3273         148 RVIAIRRGE-RWIYGPDEDT  166 (204)
T ss_pred             EEEEEecCC-ccccCCCccc
Confidence            688888888 8999998764


No 103
>PF01568 Molydop_binding:  Molydopterin dinucleotide binding domain;  InterPro: IPR006657 A domain in this entry corresponds to the C-terminal domain IV in dimethyl sulphoxide (DMSO)reductase which interacts with the 2-amino pyrimidone ring of both molybdopterin guanine dinucleotide molecules [].; GO: 0016491 oxidoreductase activity, 0030151 molybdenum ion binding, 0055114 oxidation-reduction process; PDB: 2IVF_A 1OGY_G 3ML1_A 3O5A_A 1TI2_G 1VLE_M 1VLD_U 1VLF_O 1TI4_I 1TI6_E ....
Probab=30.02  E-value=8.9  Score=24.11  Aligned_cols=20  Identities=30%  Similarity=0.456  Sum_probs=13.3

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      +|++++-+...|+.||.+.|
T Consensus        33 ~inp~dA~~~Gi~~Gd~V~v   52 (110)
T PF01568_consen   33 EINPEDAAKLGIKDGDWVRV   52 (110)
T ss_dssp             EEEHHHHHHCT--TTCEEEE
T ss_pred             EEcHHHHHHhcCcCCCEEEE
Confidence            56677777888888888744


No 104
>cd02788 MopB_CT_NDH-1_NuoG2-N7 MopB_CT_NDH-1_NuoG2-N7: C-terminal region of the NuoG-like subunit (of the variant with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria. The NDH-1 is the first energy-transducting complex in the respiratory chain and functions as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. In Escherichia coli NDH-1, the largest subunit is encoded by the nuoG gene, and is part of the 14 distinct subunits constituting the functional enzyme. The NuoG subunit is made of two domains: the first contains three binding sites for FeS clusters (the fer2 domain), the second domain, is of unknown function or, as postulated, has lost an ancestral formate dehydrogenase activity that became redundant during the evolution of the complex I enzyme. Unique to this group, compared to the other prokaryotic and eukaryotic groups
Probab=30.01  E-value=13  Score=23.49  Aligned_cols=20  Identities=20%  Similarity=0.341  Sum_probs=15.0

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      |+++++-+...|+.||.+.|
T Consensus        32 ~inp~dA~~lGi~~Gd~V~v   51 (96)
T cd02788          32 RLSPADAARLGLADGDLVEF   51 (96)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777777888889997743


No 105
>PF00856 SET:  SET domain;  InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco. The SET domain itself turned out to be an uncommon structure. Although in all three studies, electron density maps revealed the location of the AdoMet or AdoHcy cofactor, the SET domain bears no similarity at all to the canonical/AdoMet-dependent methyltransferase fold. Strictly conserved in the C-terminal motif of the SET domain tyrosine could be involved in abstracting a proton from the protonated amino group of the substrate lysine, promoting its nucleophilic attack on the sulphonium methyl group of the AdoMet cofactor. In contrast to the AdoMet-dependent protein methyltranferases of the classical type, which tend to bind their polypeptide substrates on top of the cofactor, it is noted from the Rubisco LSMT structure that the AdoMet seems to bind in a separate cleft, suggesting how a polypeptide substrate could be subjected to multiple rounds of methylation without having to be released from the enzyme. In contrast, SET7/9 is able to add only a single methyl group to its substrate. It has been demonstrated that association of SET domain and myotubularin-related proteins modulates growth control []. The SET domain-containing Drosophila melanogaster (Fruit fly) protein, enhancer of zeste, has a function in segment determination and the mammalian homologue may be involved in the regulation of gene transcription and chromatin structure. Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various acceptor lysines as well as in their product specificity for the number of methyl groups (one, two, or three) they transfer. With just one exception [], the HMTases belong to SET family that can be classified according to the sequences surrounding the SET domain [, ]. Structural studies on the human SET7/9, a mono-methylase, have revealed the molecular basis for the specificity of the enzyme for the histone-target and the roles of the invariant residues in the SET domain in determining the methylation specificities [].  The pre-SET domain, as found in the SUV39 SET family, contains nine invariant cysteine residues that are grouped into two segments separated by a region of variable length. These 9 cysteines coordinate 3 zinc ions to form to form a triangular cluster, where each of the zinc ions is coordinated by 4 four cysteines to give a tetrahedral configuration. The function of this domain is structural, holding together 2 long segments of random coils. The C-terminal region including the post-SET domain is disordered when not interacting with a histone tail and in the absence of zinc. The three conserved cysteines in the post-SET domain form a zinc-binding site when coupled to a fourth conserved cysteine in the knot-like structure close to the SET domain active site []. The structured post-SET region brings in the C-terminal residues that participate in S-adenosylmethine-binding and histone tail interactions. The three conserved cysteine residues are essential for HMTase activity, as replacement with serine abolishes HMTase activity [], []. ; GO: 0005515 protein binding; PDB: 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3H6L_A 3SMT_A 3K5K_A ....
Probab=29.34  E-value=24  Score=22.27  Aligned_cols=18  Identities=28%  Similarity=0.504  Sum_probs=11.6

Q ss_pred             eeeeccCcEEEeCCCCeE
Q 038528           11 TLDIRRGDVYRLQPGSVF   28 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~   28 (91)
                      ++++++|++|.+|...+.
T Consensus         7 t~dI~~Ge~I~~p~~~~~   24 (162)
T PF00856_consen    7 TRDIKAGEVILIPRPAIL   24 (162)
T ss_dssp             SS-B-TTEEEEEESEEEE
T ss_pred             CccCCCCCEEEEECcceE
Confidence            467888998878776653


No 106
>PRK06933 type III secretion system protein; Validated
Probab=29.17  E-value=1e+02  Score=24.16  Aligned_cols=15  Identities=27%  Similarity=0.279  Sum_probs=12.1

Q ss_pred             eeeeccCcEEEeCCC
Q 038528           11 TLDIRRGDVYRLQPG   25 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG   25 (91)
                      -+.++.|||+.+|++
T Consensus       173 L~~L~~GDvLli~~~  187 (308)
T PRK06933        173 FDSLELGDVLLAPEG  187 (308)
T ss_pred             HhccCCCCEEEeccc
Confidence            457899999999854


No 107
>cd02786 MopB_CT_3 The MopB_CT_3 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=29.10  E-value=14  Score=23.60  Aligned_cols=19  Identities=21%  Similarity=0.230  Sum_probs=14.3

Q ss_pred             cccCCCceeeeeccCcEEE
Q 038528            3 WADEDDIRTLDIRRGDVYR   21 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~   21 (91)
                      ||++++-+...|+.||.+.
T Consensus        34 ~i~p~dA~~lgi~~Gd~V~   52 (116)
T cd02786          34 LIHPADAAARGIADGDLVV   52 (116)
T ss_pred             EECHHHHHHcCCCCCCEEE
Confidence            5667777778888888774


No 108
>KOG1356 consensus Putative transcription factor 5qNCA, contains JmjC domain [Transcription]
Probab=29.03  E-value=20  Score=32.11  Aligned_cols=19  Identities=16%  Similarity=0.198  Sum_probs=16.7

Q ss_pred             cCcEEEeCCCCeEEEeeCC
Q 038528           16 RGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus        16 ~GDv~~ipaG~~~y~~N~~   34 (91)
                      -||++.||||.+|=+.|--
T Consensus       805 LGdAVfIPAGaPHQVrNLk  823 (889)
T KOG1356|consen  805 LGDAVFIPAGAPHQVRNLK  823 (889)
T ss_pred             ccceEEecCCCcHHhhhhh
Confidence            4999999999999888863


No 109
>PF00498 FHA:  FHA domain;  InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins. It displays specificity for phosphothreonine-containing epitopes but will also recognise phosphotyrosine with relatively high affinity. It spans approximately 80-100 amino acid residues folded into an 11-stranded beta sandwich, which sometimes contain small helical insertions between the loops connecting the strands [].  To date, genes encoding FHA-containing proteins have been identified in eubacterial and eukaryotic but not archaeal genomes. The domain is present in a diverse range of proteins, such as kinases, phosphatases, kinesins, transcription factors, RNA-binding proteins and metabolic enzymes which partake in many different cellular processes - DNA repair, signal transduction, vesicular transport and protein degradation are just a few examples.; GO: 0005515 protein binding; PDB: 1LGQ_B 1LGP_A 2CSW_A 2PIE_A 3FM8_A 3MDB_B 3GQS_B 1UHT_A 1WLN_A 3POA_A ....
Probab=28.90  E-value=26  Score=20.07  Aligned_cols=12  Identities=25%  Similarity=0.744  Sum_probs=7.1

Q ss_pred             eeeeccCcEEEe
Q 038528           11 TLDIRRGDVYRL   22 (91)
Q Consensus        11 ~~~lr~GDv~~i   22 (91)
                      ...|+.||++.+
T Consensus        56 ~~~L~~gd~i~~   67 (68)
T PF00498_consen   56 PVPLKDGDIIRF   67 (68)
T ss_dssp             EEEE-TTEEEEE
T ss_pred             EEECCCCCEEEc
Confidence            466777777654


No 110
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=28.73  E-value=21  Score=19.77  Aligned_cols=23  Identities=4%  Similarity=0.013  Sum_probs=15.9

Q ss_pred             ceecccCHHHHHHHhCCCccccc
Q 038528           68 DLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        68 ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      -++.|++..-+++.+|++...++
T Consensus        22 ~~~~g~s~~eIa~~l~~s~~~v~   44 (54)
T PF08281_consen   22 RYFQGMSYAEIAEILGISESTVK   44 (54)
T ss_dssp             HHTS---HHHHHHHCTS-HHHHH
T ss_pred             HHHHCcCHHHHHHHHCcCHHHHH
Confidence            46789999999999999987764


No 111
>cd02782 MopB_CT_1 The MopB_CT_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=28.22  E-value=15  Score=24.02  Aligned_cols=20  Identities=30%  Similarity=0.453  Sum_probs=15.8

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      |+++++-+...|+.||.+.|
T Consensus        36 ~i~p~dA~~~gi~~Gd~V~v   55 (129)
T cd02782          36 RIHPDDAAALGLADGDKVRV   55 (129)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            66777778888899998854


No 112
>PRK09919 anti-adapter protein IraM; Provisional
Probab=28.02  E-value=83  Score=21.55  Aligned_cols=35  Identities=23%  Similarity=0.291  Sum_probs=21.2

Q ss_pred             ccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecC
Q 038528           15 RRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNT   50 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~   50 (91)
                      =+||++ +|+|.++.+.|.|---+.+++=+.|+++.
T Consensus        33 Y~~d~~-L~pG~~i~~~~~gvliNdk~~pItIYnvt   67 (114)
T PRK09919         33 YQADIF-LPPGSIITPVKSGVLLNDKPYPITIYNIT   67 (114)
T ss_pred             EeeeEE-eCCCCEEEEcCCeEEECCcEeEEEEEEec
Confidence            357765 78888888777652111256666666544


No 113
>PF06413 Neugrin:  Neugrin;  InterPro: IPR010487 This family contains mouse and human neugrin proteins. Neugrin and m-neugrin are mainly expressed in neurons in the nervous system, and are thought to play an important role in the process of neuronal differentiation []. Homologues of neugrin are found in fungi suggesting they have a alternative role or more than one function.
Probab=27.85  E-value=28  Score=26.18  Aligned_cols=18  Identities=17%  Similarity=0.209  Sum_probs=16.2

Q ss_pred             cCHHHHHHHhCCCccccc
Q 038528           73 FDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        73 F~~~iL~~Af~v~~~~i~   90 (91)
                      |+.+.||+.|+|++|.|+
T Consensus        30 ~t~~~Lae~F~vspe~ir   47 (225)
T PF06413_consen   30 WTVERLAESFKVSPEAIR   47 (225)
T ss_pred             cCHHHHHhhCCCCHHHHH
Confidence            678899999999999886


No 114
>PF09926 DUF2158:  Uncharacterized small protein (DUF2158);  InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function. 
Probab=27.59  E-value=43  Score=19.74  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=12.1

Q ss_pred             eccCcEEEeCCCCeEE
Q 038528           14 IRRGDVYRLQPGSVFY   29 (91)
Q Consensus        14 lr~GDv~~ipaG~~~y   29 (91)
                      ++.|||+.+-.|-+--
T Consensus         1 f~~GDvV~LKSGGp~M   16 (53)
T PF09926_consen    1 FKIGDVVQLKSGGPRM   16 (53)
T ss_pred             CCCCCEEEEccCCCCe
Confidence            4689999998885433


No 115
>cd02792 MopB_CT_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a  functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. This CD (MopB_CT_Formate-Dh-Na-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=27.51  E-value=15  Score=23.49  Aligned_cols=20  Identities=15%  Similarity=0.152  Sum_probs=15.2

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      |+++++-+...|+.||.+.|
T Consensus        38 ~i~p~dA~~lgi~~Gd~V~v   57 (122)
T cd02792          38 EISPELAAERGIKNGDMVWV   57 (122)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777777888899998743


No 116
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=27.26  E-value=40  Score=24.66  Aligned_cols=19  Identities=26%  Similarity=0.361  Sum_probs=14.9

Q ss_pred             ccCcEEEeCCCCeEEEeeC
Q 038528           15 RRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~N~   33 (91)
                      ..||||.||.|+-.=+--.
T Consensus       141 ~aGDvifiPKgssIefst~  159 (176)
T COG4766         141 GAGDVIFIPKGSSIEFSTT  159 (176)
T ss_pred             CCCcEEEecCCCeEEEecc
Confidence            6799999999986655444


No 117
>cd02791 MopB_CT_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. This CD (MopB_CT_Nitrate-R-Nap) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs
Probab=26.96  E-value=16  Score=23.42  Aligned_cols=18  Identities=22%  Similarity=0.420  Sum_probs=13.3

Q ss_pred             cccCCCceeeeeccCcEE
Q 038528            3 WADEDDIRTLDIRRGDVY   20 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~   20 (91)
                      |+++++-+...++.||.+
T Consensus        38 ~in~~dA~~lgi~~Gd~V   55 (122)
T cd02791          38 EIHPEDAARLGLKEGDLV   55 (122)
T ss_pred             EECHHHHHHcCCCCCCEE
Confidence            566666777788888876


No 118
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well.  LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=26.90  E-value=40  Score=20.68  Aligned_cols=17  Identities=24%  Similarity=0.288  Sum_probs=9.9

Q ss_pred             ceeeeeccCcEEEeCCC
Q 038528            9 IRTLDIRRGDVYRLQPG   25 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG   25 (91)
                      ..+..+..||+.++..|
T Consensus        55 ~~~~~~~aGdI~~v~~g   71 (86)
T cd03699          55 TPTDELSAGQVGYIIAG   71 (86)
T ss_pred             cCCceECCCCEEEEEcc
Confidence            34455566777666544


No 119
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=26.83  E-value=43  Score=20.07  Aligned_cols=15  Identities=33%  Similarity=0.538  Sum_probs=9.2

Q ss_pred             eeeeccCcEEEeCCC
Q 038528           11 TLDIRRGDVYRLQPG   25 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG   25 (91)
                      ..+|+.|||+.++.-
T Consensus        26 l~~L~~Gdvi~l~~~   40 (77)
T PF01052_consen   26 LLNLKVGDVIPLDKP   40 (77)
T ss_dssp             HHC--TT-EEEECCE
T ss_pred             HhcCCCCCEEEeCCC
Confidence            356889999988865


No 120
>TIGR00218 manA mannose-6-phosphate isomerase, class I. The names phosphomannose isomerase and mannose-6-phosphate isomerase are synonomous. This family contains two rather deeply branched groups. One group contains an experimentally determined phosphomannose isomerase of Streptococcus mutans as well as three uncharacterized paralogous proteins of Bacillus subtilis, all at more than 50 % identity to each other, plus a more distant homolog from Archaeoglobus fulgidus. The other group contains members from E. coli, budding yeast, Borrelia burgdorferi, etc.
Probab=26.75  E-value=79  Score=24.05  Aligned_cols=23  Identities=13%  Similarity=0.309  Sum_probs=19.3

Q ss_pred             eeeeeccCcEEEeCCCCeEEEee
Q 038528           10 RTLDIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus        10 ~~~~lr~GDv~~ipaG~~~y~~N   32 (91)
                      ....|++|+++.|||++--+.+.
T Consensus       271 ~~~~l~~G~~~~ipa~~~~~~i~  293 (302)
T TIGR00218       271 KTLPLKKGESFFIPAHLGPFTIE  293 (302)
T ss_pred             EEEEEecccEEEEccCCccEEEE
Confidence            45779999999999999777764


No 121
>PF14977 FAM194:  FAM194 protein
Probab=26.64  E-value=2.1e+02  Score=21.36  Aligned_cols=26  Identities=12%  Similarity=0.097  Sum_probs=13.5

Q ss_pred             eeeeeccCcEE--EeCCCCeEEEeeCCC
Q 038528           10 RTLDIRRGDVY--RLQPGSVFYIESNLE   35 (91)
Q Consensus        10 ~~~~lr~GDv~--~ipaG~~~y~~N~~~   35 (91)
                      +....+.|-++  ..|-||.++.|-.|+
T Consensus         7 ~~~~Y~~g~~f~~~f~DGsg~i~YPSGn   34 (208)
T PF14977_consen    7 KEKYYKNGRKFHYMFPDGSGQIFYPSGN   34 (208)
T ss_pred             hheeCCCCcEEEEEcCCCCEEEEeCCCC
Confidence            33344444443  456666666666654


No 122
>PF05986 ADAM_spacer1:  ADAM-TS Spacer 1;  InterPro: IPR010294 This domain represents the Spacer-1 domain from the ADAM-TS family of metalloproteinases []. A cellular disintegrin and metalloproteinase (ADAM) is a family of genes with structural homology to the snake venom metalloproteinases and disintegrins []. There is variation amongst members of the family, however, all have a similar domain organisation comprising a preproregion, a reprolysin-type catalytic domain, a disintegrin-like domain, a thrombospondin type-1 (TS) module, a cysteine-rich domain, a spacer domain without cysteine residues, and a COOH-terminal TS module [, ]. They are involved in embryogenesis and have been implicated in some cancers and inflammatory diseases [].; GO: 0004222 metalloendopeptidase activity, 0031012 extracellular matrix
Probab=26.29  E-value=42  Score=22.07  Aligned_cols=14  Identities=14%  Similarity=0.057  Sum_probs=11.3

Q ss_pred             cEEEeCCCCeEEEe
Q 038528           18 DVYRLQPGSVFYIE   31 (91)
Q Consensus        18 Dv~~ipaG~~~y~~   31 (91)
                      +|+.||+|+..=-+
T Consensus        18 ~v~~IP~GA~nI~I   31 (114)
T PF05986_consen   18 KVVTIPAGARNIRI   31 (114)
T ss_pred             EEEECCCCceEEEE
Confidence            69999999986544


No 123
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]
Probab=26.10  E-value=39  Score=27.36  Aligned_cols=28  Identities=18%  Similarity=0.195  Sum_probs=23.4

Q ss_pred             cccCCCceeeeeccCcEEEeCCCCeEEE
Q 038528            3 WADEDDIRTLDIRRGDVYRLQPGSVFYI   30 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~ipaG~~~y~   30 (91)
                      .|.+=..++.+|+.||-++|-+|.+-+.
T Consensus        72 iV~evG~~Vk~LkVGDrVaiEpg~~c~~   99 (354)
T KOG0024|consen   72 IVEEVGDEVKHLKVGDRVAIEPGLPCRD   99 (354)
T ss_pred             chhhhcccccccccCCeEEecCCCcccc
Confidence            3455567899999999999999999876


No 124
>PRK15131 mannose-6-phosphate isomerase; Provisional
Probab=25.82  E-value=72  Score=25.64  Aligned_cols=24  Identities=13%  Similarity=0.108  Sum_probs=19.7

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEee
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N   32 (91)
                      ..+..|++|+++.|||+...+.+.
T Consensus       356 ~~~~~l~~G~~~fipa~~~~~~~~  379 (389)
T PRK15131        356 EQQLTLKPGESAFIAANESPVTVS  379 (389)
T ss_pred             CeEEEECCCCEEEEeCCCccEEEe
Confidence            345789999999999998877773


No 125
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. Helix-turn-helix (HTH) transcription regulator MerR superfamily, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=25.74  E-value=33  Score=18.26  Aligned_cols=18  Identities=11%  Similarity=-0.071  Sum_probs=13.7

Q ss_pred             cCHHHHHHHhCCCccccc
Q 038528           73 FDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        73 F~~~iL~~Af~v~~~~i~   90 (91)
                      |+..-+++.++|++.+++
T Consensus         1 ~~~~e~a~~~gv~~~tlr   18 (49)
T cd04761           1 YTIGELAKLTGVSPSTLR   18 (49)
T ss_pred             CcHHHHHHHHCcCHHHHH
Confidence            455667888999888775


No 126
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=25.48  E-value=68  Score=19.45  Aligned_cols=20  Identities=15%  Similarity=0.099  Sum_probs=13.7

Q ss_pred             eeccCcEEEeCCCCeEEEeeC
Q 038528           13 DIRRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N~   33 (91)
                      ..++|||+.+ .+...|.++.
T Consensus        33 ~~keGDvl~i-~~~~~~~~d~   52 (71)
T PF11213_consen   33 GAKEGDVLEI-GEDGSIEIDP   52 (71)
T ss_pred             CCCcccEEEE-CCCceEEECH
Confidence            5688999988 4555555554


No 127
>PF06056 Terminase_5:  Putative ATPase subunit of terminase (gpP-like);  InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after []. Terminases are viral proteins that are involved in packaging viral DNA into the capsid.; GO: 0005524 ATP binding, 0019069 viral capsid assembly
Probab=25.44  E-value=42  Score=19.86  Aligned_cols=22  Identities=9%  Similarity=0.081  Sum_probs=19.1

Q ss_pred             eecccCHHHHHHHhCCCccccc
Q 038528           69 LILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        69 i~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      +++|++..-+|+-+|++..+|.
T Consensus        10 Y~~G~~~~eIA~~Lg~~~~TV~   31 (58)
T PF06056_consen   10 YLQGWSIKEIAEELGVPRSTVY   31 (58)
T ss_pred             HHcCCCHHHHHHHHCCChHHHH
Confidence            6789999999999999987663


No 128
>PF01476 LysM:  LysM domain;  InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation []. This domain may have a general peptidoglycan binding function.; GO: 0016998 cell wall macromolecule catabolic process; PDB: 2DJP_A 3ZQD_A 1Y7M_B 4A52_A 2L9Y_A 1E0G_A.
Probab=25.39  E-value=46  Score=17.39  Aligned_cols=13  Identities=8%  Similarity=0.240  Sum_probs=10.4

Q ss_pred             eeeeccCcEEEeC
Q 038528           11 TLDIRRGDVYRLQ   23 (91)
Q Consensus        11 ~~~lr~GDv~~ip   23 (91)
                      ..+|..|+.+.||
T Consensus        32 ~~~l~~G~~l~iP   44 (44)
T PF01476_consen   32 SDNLQPGQKLCIP   44 (44)
T ss_dssp             GGCGGTTEEEEEC
T ss_pred             cccCCCCCEEEeC
Confidence            3348999999998


No 129
>KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism]
Probab=25.33  E-value=40  Score=27.41  Aligned_cols=18  Identities=22%  Similarity=0.277  Sum_probs=15.3

Q ss_pred             cccCHHHHHHHhCCCccc
Q 038528           71 LGFDRKVLQSAFKRAVLL   88 (91)
Q Consensus        71 ~GF~~~iL~~Af~v~~~~   88 (91)
                      -|-|.+-|++||||++.+
T Consensus       213 mghsadrlaaafnvsr~e  230 (465)
T KOG1392|consen  213 MGHSADRLAAAFNVSRRE  230 (465)
T ss_pred             ccccHHHHHHHhccchhh
Confidence            478899999999998754


No 130
>cd02781 MopB_CT_Acetylene-hydratase The MopB_CT_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins. The acetylene hydratase of Pelobacter acetylenicus is a tungsten iron-sulfur protein involved in the fermentation of acetylene to ethanol and acetate. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=25.20  E-value=18  Score=23.50  Aligned_cols=19  Identities=21%  Similarity=0.199  Sum_probs=14.5

Q ss_pred             cccCCCceeeeeccCcEEE
Q 038528            3 WADEDDIRTLDIRRGDVYR   21 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~   21 (91)
                      ||++++-+...|+.||.+.
T Consensus        36 ~inp~dA~~~gi~~Gd~V~   54 (130)
T cd02781          36 EINPETAAKLGIADGDWVW   54 (130)
T ss_pred             EECHHHHHHcCCCCCCEEE
Confidence            5677777778888888774


No 131
>KOG4116 consensus Ubiquinol cytochrome c reductase, subunit QCR8 [Energy production and conversion]
Probab=25.19  E-value=58  Score=21.47  Aligned_cols=19  Identities=16%  Similarity=-0.123  Sum_probs=12.4

Q ss_pred             cEEEeCCCCeEE-EeeCCCC
Q 038528           18 DVYRLQPGSVFY-IESNLEQ   36 (91)
Q Consensus        18 Dv~~ipaG~~~y-~~N~~~~   36 (91)
                      =-++||+|.++| ||-.+++
T Consensus        54 ~y~~iP~~Iv~yliy~wg~e   73 (90)
T KOG4116|consen   54 LYVVIPQFIVAYLIYDWGKE   73 (90)
T ss_pred             EEEEeccceEEEEEEecchh
Confidence            357899999555 4544544


No 132
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family. This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937) and is restricted to certain lineages of the order Bacillales. This family encompasses at least two distinct sigma factors as two proteins are found in each of B. anthracis, B. subtilis subsp. subtilis str. 168, and B. lichiniformis (although these are not apparently the same two in each). One of these is designated as SigM in B. subtilis (Swiss_Prot:  SIGM_BACSU) and is activated by various stressors.
Probab=24.44  E-value=40  Score=21.98  Aligned_cols=23  Identities=9%  Similarity=0.067  Sum_probs=20.1

Q ss_pred             ceecccCHHHHHHHhCCCccccc
Q 038528           68 DLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        68 ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      .++.|++-+-+|+.+|+++..++
T Consensus       117 ~~~~g~s~~eIA~~lgis~~tv~  139 (154)
T TIGR02950       117 REFKEFSYKEIAELLNLSLAKVK  139 (154)
T ss_pred             hhhccCcHHHHHHHHCCCHHHHH
Confidence            46799999999999999987764


No 133
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family. Several PFAM models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.
Probab=24.44  E-value=42  Score=20.96  Aligned_cols=23  Identities=13%  Similarity=0.122  Sum_probs=19.8

Q ss_pred             ceecccCHHHHHHHhCCCccccc
Q 038528           68 DLILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        68 ni~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      .++.|.+.+-+|+.+|+++..|+
T Consensus       122 ~~~~g~s~~eIA~~l~~s~~~v~  144 (158)
T TIGR02937       122 RYLEGLSYKEIAEILGISVGTVK  144 (158)
T ss_pred             HHhcCCCHHHHHHHHCCCHHHHH
Confidence            45789999999999999988764


No 134
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism]
Probab=24.29  E-value=55  Score=25.25  Aligned_cols=27  Identities=19%  Similarity=0.327  Sum_probs=19.5

Q ss_pred             cccCCCceeeeeccCcEEEeCCCCeEE
Q 038528            3 WADEDDIRTLDIRRGDVYRLQPGSVFY   29 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~ipaG~~~y   29 (91)
                      .|++.+-+---+++||.+-+||-+.|-
T Consensus        68 Vie~g~~rDivI~qGe~flLParVpHS   94 (279)
T KOG3995|consen   68 VLEQGKHRDVVIRQGEIFLLPARVPHS   94 (279)
T ss_pred             eeccCcceeeEEecCcEEEeccCCCCC
Confidence            345555555556999999999988764


No 135
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain. Members of this family are bacterial domains that include a region related to the von Willebrand factor type A (VWFA) domain (pfam00092). These domains are restricted to, and have undergone a large paralogous family expansion in, the Acidobacteria, including Solibacter usitatus and Acidobacterium capsulatum ATCC 51196.
Probab=24.18  E-value=1.2e+02  Score=22.40  Aligned_cols=48  Identities=15%  Similarity=0.147  Sum_probs=36.7

Q ss_pred             cCCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCC
Q 038528            5 DEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTED   52 (91)
Q Consensus         5 ~~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~   52 (91)
                      +..++-+..|++-|.-..--|....+..-..+++.++.++-++|.+++
T Consensus        18 d~~g~~v~~L~~~df~v~e~g~~q~i~~f~~~~~~p~~vvlvlD~SgS   65 (296)
T TIGR03436        18 DKKGRPVTGLTKDDFTVLEDGKPQTIASFRRETDLPLTVGLVIDTSGS   65 (296)
T ss_pred             CCCCCCCCCCChHHeEEEECCeEEEEEEEecCCCCCceEEEEEECCCC
Confidence            344556678888888888888888887765443458999999999986


No 136
>PF04970 LRAT:  Lecithin retinol acyltransferase;  InterPro: IPR007053 This entry represents a conserved sequence region found in proteins from viruses, bacteria and eukaryotes. It contains a well-conserved NCEHF motif, though its function in these proteins is unknown.; PDB: 2KYT_A 4DOT_A 4FA0_A.
Probab=24.08  E-value=31  Score=22.61  Aligned_cols=28  Identities=11%  Similarity=0.031  Sum_probs=14.1

Q ss_pred             ceeeeeccCcEEEeCCC-CeEEEeeCCCC
Q 038528            9 IRTLDIRRGDVYRLQPG-SVFYIESNLEQ   36 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG-~~~y~~N~~~~   36 (91)
                      |...+++.||+|.++.+ ..||-+=-|+.
T Consensus         2 ~~~~~~~~GD~I~~~r~~y~H~gIYvG~~   30 (125)
T PF04970_consen    2 KDKKRLKPGDHIEVPRGLYEHWGIYVGDG   30 (125)
T ss_dssp             ----S--TT-EEEEEETTEEEEEEEEETT
T ss_pred             CcccCCCCCCEEEEecCCccEEEEEecCC
Confidence            45678999999998766 34555545554


No 137
>cd02794 MopB_CT_DmsA-EC The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted N-terminal iron-sulfur [4Fe-4S] cluster binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.83  E-value=20  Score=23.21  Aligned_cols=20  Identities=25%  Similarity=0.453  Sum_probs=15.4

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      ||++++-+...|+.||.+.|
T Consensus        33 ~i~p~~A~~~gi~~Gd~V~v   52 (121)
T cd02794          33 WINPLDAAARGIKDGDRVLV   52 (121)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777778888889998853


No 138
>KOG0141 consensus Isovaleryl-CoA dehydrogenase [Amino acid transport and metabolism; Lipid transport and metabolism]
Probab=23.75  E-value=1.3e+02  Score=24.68  Aligned_cols=37  Identities=27%  Similarity=0.515  Sum_probs=29.1

Q ss_pred             ccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCC
Q 038528           15 RRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDS   54 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~   54 (91)
                      +.||-+ |--|+-|||.|-.+..  -|++++..|++-.++
T Consensus       181 k~g~~y-iLNGsK~witNG~~ad--vliVyAkTd~~a~~~  217 (421)
T KOG0141|consen  181 KKGDDY-ILNGSKFWITNGPDAD--VLIVYAKTDHSAVPP  217 (421)
T ss_pred             ecCCcE-EecCcEEEEecCCCCc--EEEEEEecCCCCCCC
Confidence            557765 5579999999998875  888999988886543


No 139
>PF14623 Vint:  Hint-domain
Probab=23.75  E-value=36  Score=24.57  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=15.5

Q ss_pred             ceeeeeccCcEEEeCCCC
Q 038528            9 IRTLDIRRGDVYRLQPGS   26 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~   26 (91)
                      .++.+||+||.+.-|.|.
T Consensus        18 v~i~~lR~G~~V~tp~G~   35 (162)
T PF14623_consen   18 VRIDDLRAGDKVWTPRGP   35 (162)
T ss_pred             EEHHHccCCCEEECCCCC
Confidence            578899999999999874


No 140
>PF12708 Pectate_lyase_3:  Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A ....
Probab=23.69  E-value=69  Score=21.91  Aligned_cols=17  Identities=35%  Similarity=0.557  Sum_probs=12.7

Q ss_pred             ccCcEEEeCCCCeEEEeeC
Q 038528           15 RRGDVYRLQPGSVFYIESN   33 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~N~   33 (91)
                      ..|.++.+|+|+  |.+..
T Consensus        31 ~~g~~v~~P~G~--Y~i~~   47 (225)
T PF12708_consen   31 AGGGVVYFPPGT--YRISG   47 (225)
T ss_dssp             TTSEEEEE-SEE--EEESS
T ss_pred             CCCeEEEEcCcE--EEEeC
Confidence            578899999996  66666


No 141
>PF08220 HTH_DeoR:  DeoR-like helix-turn-helix domain;  InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism. This family of prokaryotic regulators is named after the Escherichia coli protein DeoR, a repressor of the deo operon, which encodes nucleotide and deoxyribonucleotide catabolic enzymes. DeoR also negatively regulates the expression of nupG and tsx, a nucleoside-specific transport protein and a channel-forming protein, respectively. DeoR-like transcription repressors occur in diverse bacteria as regulators of sugar and nucleoside metabolic systems. The effector molecules for deoR-like regulators are generally phosphorylated intermediates of the relevant metabolic pathway. The DNA-binding deoR-type HTH domain occurs usually in the N-terminal part. The C-terminal part can contain an effector-binding domain and/or an oligomerisation domain. DeoR occurs as an octamer, whilst glpR and agaR are tetramers. Several operators may be bound simultaneously, which could facilitate DNA looping [, ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular
Probab=23.67  E-value=40  Score=19.45  Aligned_cols=17  Identities=18%  Similarity=0.202  Sum_probs=14.3

Q ss_pred             CHHHHHHHhCCCccccc
Q 038528           74 DRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        74 ~~~iL~~Af~v~~~~i~   90 (91)
                      +.+-|++.|+|++.+|+
T Consensus        16 s~~ela~~~~VS~~TiR   32 (57)
T PF08220_consen   16 SVKELAEEFGVSEMTIR   32 (57)
T ss_pred             EHHHHHHHHCcCHHHHH
Confidence            56778999999998876


No 142
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or plastid core RNA polymerase to specific promoter elements located upstream of transcription initiation points. The SR4 of Ec sigma70 and other essential primary SFs contact promoter sequences located 35 base-pairs upstream of the initiation point, recognizing a 6-base-pair -35 consensus TTGACA.  Sigma70 related SFs also include SFs which are dispensable for bacterial cell growth for example Ec sigmaS, SFs which activate regulons in response to a specific signal for example heat-shock Ec sigmaH, and a group of SFs which includes the extracytoplasmic function (ECF) SFs and is typified by Ec sigmaE which contains SR2 and -4 only. ECF SFs direct the transcription of genes that regulate various responses including periplas
Probab=23.66  E-value=53  Score=16.84  Aligned_cols=21  Identities=5%  Similarity=-0.009  Sum_probs=17.4

Q ss_pred             eecccCHHHHHHHhCCCcccc
Q 038528           69 LILGFDRKVLQSAFKRAVLLL   89 (91)
Q Consensus        69 i~~GF~~~iL~~Af~v~~~~i   89 (91)
                      ++.|.+..-+++.+|++...+
T Consensus        23 ~~~~~~~~~ia~~~~~s~~~i   43 (55)
T cd06171          23 FGEGLSYEEIAEILGISRSTV   43 (55)
T ss_pred             HhcCCCHHHHHHHHCcCHHHH
Confidence            458899999999999988765


No 143
>PF08605 Rad9_Rad53_bind:  Fungal Rad9-like Rad53-binding;  InterPro: IPR013914  In Saccharomyces cerevisiae (Baker s yeast), the Rad9 is a key adaptor protein in DNA damage checkpoint pathways. DNA damage induces Rad9 phosphorylation, and Rad53 specifically associates with this region of Rad9, when phosphorylated, via the Rad53 IPR000253 from INTERPRO domain []. There is no clear higher eukaryotic ortholog to Rad9. 
Probab=23.61  E-value=1.1e+02  Score=21.17  Aligned_cols=34  Identities=18%  Similarity=0.384  Sum_probs=22.7

Q ss_pred             ccCCCceeeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeec
Q 038528            4 ADEDDIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSN   49 (91)
Q Consensus         4 v~~~~~~~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~   49 (91)
                      |..++-+..+||.||.+.+-.       +.     -+-+|++|-+.
T Consensus        50 i~~~dv~~LDlRIGD~Vkv~~-------~k-----~~yiV~Gl~~~   83 (131)
T PF08605_consen   50 IKNEDVKYLDLRIGDTVKVDG-------PK-----VTYIVVGLECK   83 (131)
T ss_pred             eCcccEeeeeeecCCEEEECC-------CC-----ccEEEEEeeec
Confidence            344566788899999998876       11     14566666655


No 144
>KOG3416 consensus Predicted nucleic acid binding protein [General function prediction only]
Probab=23.56  E-value=37  Score=23.92  Aligned_cols=20  Identities=30%  Similarity=0.431  Sum_probs=16.7

Q ss_pred             eeccCcEEEeCCCCeEEEee
Q 038528           13 DIRRGDVYRLQPGSVFYIES   32 (91)
Q Consensus        13 ~lr~GDv~~ipaG~~~y~~N   32 (91)
                      -++.|||+++--|-+.+..+
T Consensus        61 ~~~PGDIirLt~Gy~Si~qg   80 (134)
T KOG3416|consen   61 LIQPGDIIRLTGGYASIFQG   80 (134)
T ss_pred             ccCCccEEEecccchhhhcC
Confidence            36899999999998877765


No 145
>cd00508 MopB_CT_Fdh-Nap-like This CD includes formate dehydrogenases (Fdh) H and N; nitrate reductases, Nap and Nas; and other related proteins. Formate dehydrogenase H is a component of the anaerobic formate hydrogen lyase complex  and catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. Formate dehydrogenase N (alpha subunit) is the major electron donor to the bacterial nitrate respiratory chain and nitrate reductases, Nap and Nas, catalyze the reduction of nitrate to nitrite. This CD (MopB_CT_Fdh-Nap-like) is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.56  E-value=20  Score=22.68  Aligned_cols=19  Identities=32%  Similarity=0.489  Sum_probs=12.4

Q ss_pred             cccCCCceeeeeccCcEEE
Q 038528            3 WADEDDIRTLDIRRGDVYR   21 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~   21 (91)
                      ||++++-+...|+.||.+.
T Consensus        38 ~inp~dA~~lgi~~Gd~V~   56 (120)
T cd00508          38 EIHPEDAARLGIKDGDLVR   56 (120)
T ss_pred             EECHHHHHHcCCCCCCEEE
Confidence            4556666667777777664


No 146
>cd02785 MopB_CT_4 The MopB_CT_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.50  E-value=20  Score=23.31  Aligned_cols=20  Identities=20%  Similarity=0.229  Sum_probs=14.7

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      ||++++-+...|+.||.+.|
T Consensus        35 ~i~p~dA~~~gi~~Gd~V~v   54 (124)
T cd02785          35 KINPIDAAARGIAHGDLVEV   54 (124)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777777788888887743


No 147
>cd02787 MopB_CT_ydeP The MopB_CT_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=23.14  E-value=19  Score=22.96  Aligned_cols=20  Identities=35%  Similarity=0.635  Sum_probs=12.7

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      ++++++-+...|+.||.+.|
T Consensus        34 ~i~p~dA~~lgI~dGd~V~v   53 (112)
T cd02787          34 FMNPDDIARLGLKAGDRVDL   53 (112)
T ss_pred             EECHHHHHHhCCCCCCEEEE
Confidence            45566666677777776643


No 148
>PTZ00412 leucyl aminopeptidase; Provisional
Probab=22.89  E-value=62  Score=27.78  Aligned_cols=32  Identities=6%  Similarity=0.049  Sum_probs=27.0

Q ss_pred             eeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEE
Q 038528           11 TLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIY   44 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~   44 (91)
                      ..-.|.|||+.--.|.+.=+.|+|-+.  +|++.
T Consensus       358 g~A~rPGDVits~nGkTVEV~NTDAEG--RLVLA  389 (569)
T PTZ00412        358 PESYHPSSIITSRKGLTVEVLNTDAEG--RLVLA  389 (569)
T ss_pred             CCCCCCCCEeEecCCCEEeecccCchh--hhhhH
Confidence            345789999999999999999998664  77765


No 149
>PF13693 HTH_35:  Winged helix-turn-helix DNA-binding; PDB: 1NEQ_A 1NER_A.
Probab=22.89  E-value=46  Score=21.15  Aligned_cols=15  Identities=7%  Similarity=0.142  Sum_probs=12.2

Q ss_pred             HHHHHHHhCCCcccc
Q 038528           75 RKVLQSAFKRAVLLL   89 (91)
Q Consensus        75 ~~iL~~Af~v~~~~i   89 (91)
                      ++++|+|+||++++|
T Consensus        44 E~~IA~aLgv~P~eI   58 (78)
T PF13693_consen   44 ERIIADALGVPPEEI   58 (78)
T ss_dssp             HHHHHHHTTS-HHHH
T ss_pred             HHHHHHHHCcCHHHh
Confidence            789999999998875


No 150
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]
Probab=22.39  E-value=1.2e+02  Score=25.05  Aligned_cols=22  Identities=23%  Similarity=0.327  Sum_probs=16.6

Q ss_pred             CCceeeeeccCcEEEeCCCCeE
Q 038528            7 DDIRTLDIRRGDVYRLQPGSVF   28 (91)
Q Consensus         7 ~~~~~~~lr~GDv~~ipaG~~~   28 (91)
                      +.....-+.+|||+.|||-...
T Consensus       369 ~t~~~~~v~rG~V~fI~a~~~i  390 (411)
T KOG2757|consen  369 DTDSKILVNRGDVLFIPANHPI  390 (411)
T ss_pred             CCCCceeeccCcEEEEcCCCCc
Confidence            3356677889999999987665


No 151
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=22.31  E-value=52  Score=21.06  Aligned_cols=12  Identities=25%  Similarity=0.667  Sum_probs=10.1

Q ss_pred             eeeeccCcEEEe
Q 038528           11 TLDIRRGDVYRL   22 (91)
Q Consensus        11 ~~~lr~GDv~~i   22 (91)
                      -+.+++|||++|
T Consensus        49 ~~g~k~GdVvkI   60 (79)
T PRK09570         49 AIGAKPGDVIKI   60 (79)
T ss_pred             hcCCCCCCEEEE
Confidence            457899999998


No 152
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat. This repeat of about 40 amino acids is found in up to 14 copies per protein. Archaea Methanosarcina mazei and Methanosarcina acetivorans each have over 10 genes that encode tandem copies of this repeat, which is also found in other species. PSIPRED predicts with high confidence that each 40-residue repeats contains four beta strands. This model overlaps somewhat with the NHL repeat (Pfam pfam01436) and also shows sequence similarity to the WD domain, G-beta repeat (Pfam pfam00400).
Probab=22.22  E-value=1.2e+02  Score=15.19  Aligned_cols=14  Identities=14%  Similarity=0.396  Sum_probs=11.0

Q ss_pred             CCCCeEEEeeCCCC
Q 038528           23 QPGSVFYIESNLEQ   36 (91)
Q Consensus        23 paG~~~y~~N~~~~   36 (91)
                      |.|-..|+.|.+.+
T Consensus         1 pd~~~lyv~~~~~~   14 (42)
T TIGR02276         1 PDGTKLYVTNSGSN   14 (42)
T ss_pred             CCCCEEEEEeCCCC
Confidence            56778899998766


No 153
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon. Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.
Probab=22.20  E-value=79  Score=17.35  Aligned_cols=16  Identities=31%  Similarity=0.690  Sum_probs=13.5

Q ss_pred             ceecccCHHHHHHHhC
Q 038528           68 DLILGFDRKVLQSAFK   83 (91)
Q Consensus        68 ni~~GF~~~iL~~Af~   83 (91)
                      .++.||+++.|.+.+|
T Consensus        59 ~~~~g~~~~~i~~~i~   74 (74)
T TIGR02196        59 KIIVGFDPEKLDQLLE   74 (74)
T ss_pred             EEEeeCCHHHHHHHhC
Confidence            4699999999998875


No 154
>TIGR01570 A_thal_3588 uncharacterized plant-specific domain TIGR01570. This model represents a region of about 170 amino acids found at the C-terminus of a family of plant proteins. These proteins typically have additional highly divergent N-terminal regions rich in low complexity sequence. PSI-BLAST reveals no clear similarity to any characterized protein. At least 12 distinct members are found in Arabidopsis thaliana.
Probab=22.16  E-value=1.1e+02  Score=22.19  Aligned_cols=29  Identities=14%  Similarity=0.292  Sum_probs=21.8

Q ss_pred             CcEEEeCCCC----------eEEEeeCCCCCcccEEEEE
Q 038528           17 GDVYRLQPGS----------VFYIESNLEQEREKLRIYA   45 (91)
Q Consensus        17 GDv~~ipaG~----------~~y~~N~~~~e~~~L~i~~   45 (91)
                      |+++.+.|-.          +||++|++.+.++.|-|.=
T Consensus       120 gel~YMRA~FERVVGS~DSEsfyminPdg~~gpELSIF~  158 (161)
T TIGR01570       120 DELMYMRASFERVVGSKDSESFYMINPEGNIGQELSIFF  158 (161)
T ss_pred             ceEEEEeeeeeEeccccCceeEEeECCCCCCCceEEEEE
Confidence            7777777743          7999998777777887753


No 155
>PLN03115 ferredoxin--NADP(+) reductase; Provisional
Probab=22.11  E-value=1e+02  Score=24.54  Aligned_cols=31  Identities=13%  Similarity=0.314  Sum_probs=19.7

Q ss_pred             eeeccCcEEEe--CCCCeEEEeeCCCCCcccEEEEE
Q 038528           12 LDIRRGDVYRL--QPGSVFYIESNLEQEREKLRIYA   45 (91)
Q Consensus        12 ~~lr~GDv~~i--paG~~~y~~N~~~~e~~~L~i~~   45 (91)
                      .+++.||.+.|  |.|..+.+-+.. +  .++.+|+
T Consensus       190 ~~Lk~Gd~V~v~GP~G~~fllp~~~-~--~~iImIA  222 (367)
T PLN03115        190 CDLKPGAEVKITGPVGKEMLMPKDP-N--ATIIMLA  222 (367)
T ss_pred             hhCCCcCEEEEEeecCCceeCCcCC-C--CCEEEEe
Confidence            45789999876  889765442222 2  3677664


No 156
>PF13550 Phage-tail_3:  Putative phage tail protein
Probab=22.09  E-value=48  Score=21.93  Aligned_cols=14  Identities=36%  Similarity=0.548  Sum_probs=11.0

Q ss_pred             eeeccCcEEEeCCC
Q 038528           12 LDIRRGDVYRLQPG   25 (91)
Q Consensus        12 ~~lr~GDv~~ipaG   25 (91)
                      ..|+.||+|.|+--
T Consensus       138 ~~l~pGDvi~l~~~  151 (164)
T PF13550_consen  138 LALEPGDVIALSDD  151 (164)
T ss_pred             ccCCCCCEEEEEeC
Confidence            45789999998754


No 157
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=21.97  E-value=58  Score=18.24  Aligned_cols=14  Identities=29%  Similarity=0.598  Sum_probs=9.0

Q ss_pred             eeeeeccCcEEEeC
Q 038528           10 RTLDIRRGDVYRLQ   23 (91)
Q Consensus        10 ~~~~lr~GDv~~ip   23 (91)
                      ....|++||++.|-
T Consensus        14 ~~Ls~~~Gd~i~v~   27 (55)
T PF07653_consen   14 DELSFKKGDVIEVL   27 (55)
T ss_dssp             TB-EB-TTEEEEEE
T ss_pred             CceEEecCCEEEEE
Confidence            44778999988774


No 158
>PF14890 Intein_splicing:  Intein splicing domain; PDB: 1MI8_A 2CW7_A 2CW8_A.
Probab=21.93  E-value=53  Score=24.88  Aligned_cols=19  Identities=16%  Similarity=0.218  Sum_probs=12.3

Q ss_pred             cCCCceeeeeccCcEEEeC
Q 038528            5 DEDDIRTLDIRRGDVYRLQ   23 (91)
Q Consensus         5 ~~~~~~~~~lr~GDv~~ip   23 (91)
                      .++.+....|+.||.|++|
T Consensus        74 ~~~wk~~~~Lk~GD~I~v~   92 (323)
T PF14890_consen   74 PDGWKRLEELKPGDRIAVP   92 (323)
T ss_dssp             CCCCCECCC--TT-EEEEE
T ss_pred             ccCCEEhHHhhcccccccc
Confidence            3445667779999999999


No 159
>KOG2597 consensus Predicted aminopeptidase of the M17 family [General function prediction only]
Probab=21.83  E-value=1.1e+02  Score=25.90  Aligned_cols=31  Identities=23%  Similarity=0.312  Sum_probs=25.6

Q ss_pred             eeeccCcEEEeCCCCeEEEeeCCCCCcccEEEE
Q 038528           12 LDIRRGDVYRLQPGSVFYIESNLEQEREKLRIY   44 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~   44 (91)
                      .-.|.|||+....|-+.=|.|+|-+.  +|++.
T Consensus       335 ~A~kpgDVit~~nGKtveI~NTDAEG--RLiLA  365 (513)
T KOG2597|consen  335 NATKPGDVITLRNGKTVEINNTDAEG--RLVLA  365 (513)
T ss_pred             cCCCCCcEEEecCCcEEEecccCccc--eEEec
Confidence            44689999999999999999997654  66654


No 160
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=21.72  E-value=1.2e+02  Score=22.52  Aligned_cols=26  Identities=38%  Similarity=0.493  Sum_probs=23.7

Q ss_pred             CceeeeeccCcEEEeCCCCeEEEeeCC
Q 038528            8 DIRTLDIRRGDVYRLQPGSVFYIESNL   34 (91)
Q Consensus         8 ~~~~~~lr~GDv~~ipaG~~~y~~N~~   34 (91)
                      .+|.-.+|.| ++..|+|...|++..|
T Consensus        22 GkKr~TIR~G-~~~~k~g~eVyIh~~g   47 (188)
T COG2411          22 GKKRTTIRLG-KIVLKPGSEVYIHSGG   47 (188)
T ss_pred             CceeEEEecC-cccCCCCCEEEEEECC
Confidence            5678889999 9999999999999996


No 161
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=21.71  E-value=55  Score=20.61  Aligned_cols=11  Identities=36%  Similarity=0.733  Sum_probs=7.6

Q ss_pred             eeeccCcEEEe
Q 038528           12 LDIRRGDVYRL   22 (91)
Q Consensus        12 ~~lr~GDv~~i   22 (91)
                      +.+++|||++|
T Consensus        47 ~g~k~GdVvkI   57 (74)
T PF01191_consen   47 LGAKPGDVVKI   57 (74)
T ss_dssp             TT--TTSEEEE
T ss_pred             cCCCCCCEEEE
Confidence            46799999988


No 162
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=21.66  E-value=55  Score=20.05  Aligned_cols=13  Identities=31%  Similarity=0.526  Sum_probs=10.1

Q ss_pred             eeeeccCcEEEeC
Q 038528           11 TLDIRRGDVYRLQ   23 (91)
Q Consensus        11 ~~~lr~GDv~~ip   23 (91)
                      ..+++.|||+.+.
T Consensus        26 ll~L~~Gdvi~L~   38 (77)
T TIGR02480        26 LLKLGEGSVIELD   38 (77)
T ss_pred             HhcCCCCCEEEcC
Confidence            3567889999875


No 163
>COG3423 Nlp Predicted transcriptional regulator [Transcription]
Probab=21.60  E-value=59  Score=21.07  Aligned_cols=15  Identities=7%  Similarity=0.142  Sum_probs=11.1

Q ss_pred             HHHHHHHhCCCcccc
Q 038528           75 RKVLQSAFKRAVLLL   89 (91)
Q Consensus        75 ~~iL~~Af~v~~~~i   89 (91)
                      ..+++.|++|++++|
T Consensus        50 EriIA~algv~P~eI   64 (82)
T COG3423          50 ERIIADALGVPPEEI   64 (82)
T ss_pred             HHHHHHHhCCCHHHh
Confidence            467778888887765


No 164
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein. Members of this protein family contain a tandem pair of beta-helix repeats (see TIGR03804). Each repeat is expected to consist of three beta strands that form a single turn as they form a right-handed helix of stacked beta-structure. Member proteinsa occur regularly in two-gene pairs along with another uncharacterized protein family; both protein families exhibit either lipoprotein or regular signal peptides, suggesting transit through the plasma membrane, and the two may be fused. The function of the pair is unknown.
Probab=21.56  E-value=54  Score=25.29  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=14.3

Q ss_pred             eeeccCcEEEeCCCCeE
Q 038528           12 LDIRRGDVYRLQPGSVF   28 (91)
Q Consensus        12 ~~lr~GDv~~ipaG~~~   28 (91)
                      ...+.||++.||+|+-.
T Consensus         6 ~~A~~GDtI~l~~G~Y~   22 (314)
T TIGR03805         6 IAAQPGDTIVLPEGVFQ   22 (314)
T ss_pred             hhCCCCCEEEECCCEEE
Confidence            34588999999999876


No 165
>cd02778 MopB_CT_Thiosulfate-R-like The MopB_CT_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme that catalyzes the reduction of polysulfide using either hydrogen or formate as the electron donor. Also included in this CD is the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), which has been characterized as a membrane-bound molybdenum-iron-sulfur enzyme involved in anaerobic metabolism of phenylalanine in the denitrifying bacterium Thauera aromatica. The MopB_CT_Thiosulfate-R-like CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region present in many, but not all, MopB homologs.
Probab=21.47  E-value=23  Score=22.69  Aligned_cols=20  Identities=25%  Similarity=0.619  Sum_probs=15.1

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      ++++++-+...|+.||.+.|
T Consensus        33 ~i~p~dA~~~gi~~Gd~V~v   52 (123)
T cd02778          33 WINPETAARLGIKDGDRVEV   52 (123)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777777888888988743


No 166
>PF10377 ATG11:  Autophagy-related protein 11;  InterPro: IPR019460  This family consists of proteins involved in telomere maintenance. In Schizosaccharomyces pombe (fission yeast) this protein is called Taf1 (taz1 interacting factor) and is part of the telomere cap complex. In Saccharomyces cerevisiae (baker's yeast) this protein is called ATG11 and is known to be involved in vacuolar targeting and peroxisome degradation [, ]. 
Probab=21.29  E-value=57  Score=22.26  Aligned_cols=17  Identities=29%  Similarity=0.593  Sum_probs=13.9

Q ss_pred             ccCcEEEeCCCCeEEEe
Q 038528           15 RRGDVYRLQPGSVFYIE   31 (91)
Q Consensus        15 r~GDv~~ipaG~~~y~~   31 (91)
                      +..-=+.+|.|+.+|.+
T Consensus       108 ~~~Npy~Lp~Gt~~y~V  124 (129)
T PF10377_consen  108 KDSNPYNLPVGTKFYRV  124 (129)
T ss_pred             CCCCCCcCCCCCEEEEE
Confidence            45566899999999986


No 167
>cd02779 MopB_CT_Arsenite-Ox This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of Arsenite oxidase (Arsenite-Ox) and related proteins. Arsenite oxidase oxidizes arsenite to the less toxic arsenate; it transfers the electrons obtained from the oxidation of arsenite towards the soluble periplasmic electron carriers cytochrome c and/or amicyanin.
Probab=21.01  E-value=24  Score=22.73  Aligned_cols=20  Identities=15%  Similarity=0.400  Sum_probs=15.2

Q ss_pred             cccCCCceeeeeccCcEEEe
Q 038528            3 WADEDDIRTLDIRRGDVYRL   22 (91)
Q Consensus         3 ~v~~~~~~~~~lr~GDv~~i   22 (91)
                      ++++++-+...|+.||.+.|
T Consensus        36 ~in~~dA~~lgi~~Gd~V~v   55 (115)
T cd02779          36 EVNPEDAKREGLKNGDLVEV   55 (115)
T ss_pred             EECHHHHHHcCCCCCCEEEE
Confidence            56777778888889998743


No 168
>PF09340 NuA4:  Histone acetyltransferase subunit NuA4;  InterPro: IPR015418 The NuA4 histone acetyltransferase (HAT) multisubunit complex is responsible for acetylation of histone H4 and H2A N-terminal tails in yeast []. NuA4 complexes are highly conserved in eukaryotes and play primary roles in transcription, cellular response to DNA damage, and cell cycle control []. 
Probab=20.87  E-value=34  Score=21.60  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=12.9

Q ss_pred             eecCCCccCceecccCH
Q 038528           59 VIGAYTSISDLILGFDR   75 (91)
Q Consensus        59 flag~~~~~ni~~GF~~   75 (91)
                      ||-.....+||+.|||-
T Consensus        32 YL~~~~~~GNiikGfd~   48 (80)
T PF09340_consen   32 YLEDTSPYGNIIKGFDG   48 (80)
T ss_pred             HHHccCcCCCCeeChhh
Confidence            66655667899999974


No 169
>cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function.
Probab=20.82  E-value=62  Score=15.59  Aligned_cols=13  Identities=8%  Similarity=0.302  Sum_probs=9.7

Q ss_pred             eeeeccCcEEEeC
Q 038528           11 TLDIRRGDVYRLQ   23 (91)
Q Consensus        11 ~~~lr~GDv~~ip   23 (91)
                      ...++.|+.+.||
T Consensus        34 ~~~~~~g~~l~ip   46 (46)
T cd00118          34 PDNLQVGQKLKIP   46 (46)
T ss_pred             ccccCCCCEEecC
Confidence            4567888888876


No 170
>PF10948 DUF2635:  Protein of unknown function (DUF2635);  InterPro: IPR024400 This family consists of uncharacterised proteins found in bacteria and bacteriophages. It includes protein Gp38 from Enterobacteria phage Mu.
Probab=20.69  E-value=49  Score=19.12  Aligned_cols=14  Identities=29%  Similarity=0.513  Sum_probs=10.5

Q ss_pred             eeeeccCcEEEeCC
Q 038528           11 TLDIRRGDVYRLQP   24 (91)
Q Consensus        11 ~~~lr~GDv~~ipa   24 (91)
                      .++|+.|||+.+.+
T Consensus        32 ~RRl~dGDV~~v~~   45 (47)
T PF10948_consen   32 LRRLADGDVVEVTP   45 (47)
T ss_pred             HHhhhcCCEEEecC
Confidence            35788899997754


No 171
>PF13384 HTH_23:  Homeodomain-like domain; PDB: 2X48_C.
Probab=20.69  E-value=61  Score=17.50  Aligned_cols=21  Identities=5%  Similarity=-0.023  Sum_probs=14.7

Q ss_pred             ecccCHHHHHHHhCCCccccc
Q 038528           70 ILGFDRKVLQSAFKRAVLLLG   90 (91)
Q Consensus        70 ~~GF~~~iL~~Af~v~~~~i~   90 (91)
                      ..|.+..-+++.||+++.++.
T Consensus        15 ~~G~s~~~ia~~lgvs~~Tv~   35 (50)
T PF13384_consen   15 REGWSIREIAKRLGVSRSTVY   35 (50)
T ss_dssp             HHT--HHHHHHHHTS-HHHHH
T ss_pred             HCCCCHHHHHHHHCcCHHHHH
Confidence            348999999999999987763


No 172
>PF13759 2OG-FeII_Oxy_5:  Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A.
Probab=20.20  E-value=2.3e+02  Score=17.60  Aligned_cols=28  Identities=11%  Similarity=0.046  Sum_probs=17.5

Q ss_pred             ceeeeeccCcEEEeCCCCeEEEeeCCCC
Q 038528            9 IRTLDIRRGDVYRLQPGSVFYIESNLEQ   36 (91)
Q Consensus         9 ~~~~~lr~GDv~~ipaG~~~y~~N~~~~   36 (91)
                      ......++||++..|+=..|++.=+..+
T Consensus        65 ~~~~~p~~G~lvlFPs~l~H~v~p~~~~   92 (101)
T PF13759_consen   65 YYIVEPEEGDLVLFPSWLWHGVPPNNSD   92 (101)
T ss_dssp             EEEE---TTEEEEEETTSEEEE----SS
T ss_pred             eEEeCCCCCEEEEeCCCCEEeccCcCCC
Confidence            3456779999999999999998766443


No 173
>COG0147 TrpE Anthranilate/para-aminobenzoate synthases component I [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=20.16  E-value=25  Score=28.91  Aligned_cols=60  Identities=17%  Similarity=0.237  Sum_probs=34.3

Q ss_pred             eeeeccCcEEEeCCCCeEEEeeCCCCCcccEEEEEEeecCCCCCCCceeecCCCccCceecccCHHHH
Q 038528           11 TLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEDDSYFEPVIGAYTSISDLILGFDRKVL   78 (91)
Q Consensus        11 ~~~lr~GDv~~ipaG~~~y~~N~~~~e~~~L~i~~l~d~~n~~~~~~~flag~~~~~ni~~GF~~~iL   78 (91)
                      ...+++||++-+=-.-.+.+-.+++    ++.++--+...|. -+|.+|+.-+   .-.+-|+|+|.+
T Consensus       204 ~e~I~~Gd~fQvvlS~~~~~~~~~~----p~~~y~~Lr~~NP-spY~~~~~~~---~~~lvg~SPE~~  263 (462)
T COG0147         204 KEYIRAGDIYQVVLSRRFEAPCDGD----PLALYRRLRQRNP-SPYMFFLRLG---DFTLVGASPELF  263 (462)
T ss_pred             HHHHHcCCeEEEEeeEEEEEecCCC----HHHHHHHHHhcCC-CcceeEEEcC---CeEEEEechhhh
Confidence            3467899999776655555555543    4555544444443 5677766533   123555666554


Done!