Query         038616
Match_columns 431
No_of_seqs    22 out of 24
Neff          1.8 
Searched_HMMs 46136
Date          Fri Mar 29 12:51:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038616.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038616hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA00616 hypothetical protein   97.1 0.00028   6E-09   52.6   1.8   27  321-347     1-27  (44)
  2 PF00096 zf-C2H2:  Zinc finger,  97.0 0.00026 5.7E-09   43.3   0.9   23  322-345     1-23  (23)
  3 PF13912 zf-C2H2_6:  C2H2-type   96.8 0.00044 9.6E-09   43.7   0.9   26  321-347     1-26  (27)
  4 PF13894 zf-C2H2_4:  C2H2-type   96.6  0.0011 2.4E-08   39.2   1.4   24  322-345     1-24  (24)
  5 PHA02768 hypothetical protein;  95.9   0.004 8.7E-08   48.3   1.7   27  322-349     6-32  (55)
  6 smart00355 ZnF_C2H2 zinc finge  94.6   0.027 5.7E-07   33.1   1.9   24  322-346     1-24  (26)
  7 smart00451 ZnF_U1 U1-like zinc  94.2   0.028 6.1E-07   36.9   1.5   24  320-343     2-25  (35)
  8 PF13465 zf-H2C2_2:  Zinc-finge  93.3   0.023 4.9E-07   36.9  -0.1   21  313-333     6-26  (26)
  9 KOG3623 Homeobox transcription  93.3   0.028   6E-07   61.6   0.4   31  309-343   301-331 (1007)
 10 PF12756 zf-C2H2_2:  C2H2 type   92.8   0.064 1.4E-06   40.2   1.7   30  321-350    50-80  (100)
 11 PF12874 zf-met:  Zinc-finger o  92.6   0.052 1.1E-06   33.7   0.9   22  322-343     1-22  (25)
 12 PF12171 zf-C2H2_jaz:  Zinc-fin  92.1   0.044 9.5E-07   35.3  -0.0   22  322-343     2-23  (27)
 13 COG4049 Uncharacterized protei  91.6    0.11 2.5E-06   41.9   1.8   43  322-367    18-60  (65)
 14 PF09237 GAGA:  GAGA factor;  I  91.4    0.13 2.7E-06   40.6   1.9   31  317-347    20-50  (54)
 15 PHA00732 hypothetical protein   87.9    0.31 6.6E-06   39.4   1.7   26  321-346     1-26  (79)
 16 KOG2462 C2H2-type Zn-finger pr  86.5    0.47   1E-05   46.8   2.4   33  316-349   210-242 (279)
 17 PHA00733 hypothetical protein   85.9    0.55 1.2E-05   40.4   2.2   30  314-343    66-95  (128)
 18 KOG3623 Homeobox transcription  78.6    0.56 1.2E-05   51.9  -0.5   28  315-342   944-971 (1007)
 19 PF08209 Sgf11:  Sgf11 (transcr  78.3     1.1 2.3E-05   31.9   1.0   21  321-342     4-24  (33)
 20 PF07754 DUF1610:  Domain of un  74.5     1.4 3.1E-05   29.7   0.8   15  315-329    10-24  (24)
 21 PF05605 zf-Di19:  Drought indu  73.4     2.6 5.5E-05   31.0   1.9   27  321-348     2-28  (54)
 22 PF13913 zf-C2HC_2:  zinc-finge  72.7     2.5 5.5E-05   27.7   1.6   20  322-342     3-22  (25)
 23 PF13909 zf-H2C2_5:  C2H2-type   72.6     2.3   5E-05   26.3   1.3   21  322-343     1-21  (24)
 24 PF12756 zf-C2H2_2:  C2H2 type   72.4     1.2 2.6E-05   33.4   0.0   26  323-348     1-26  (100)
 25 PF05605 zf-Di19:  Drought indu  70.2     3.2   7E-05   30.4   1.9   23  321-345    31-53  (54)
 26 PHA00733 hypothetical protein   69.4     3.3 7.2E-05   35.7   2.1   26  320-345    98-123 (128)
 27 COG5188 PRP9 Splicing factor 3  67.1     4.5 9.7E-05   42.2   2.8   33  322-354   239-272 (470)
 28 PTZ00448 hypothetical protein;  65.8     3.5 7.6E-05   42.3   1.7   26  318-343   311-336 (373)
 29 KOG1074 Transcriptional repres  65.2       2 4.3E-05   48.1  -0.1   37  311-348   623-659 (958)
 30 PHA00732 hypothetical protein   64.0       3 6.5E-05   33.7   0.7   25  321-349    27-51  (79)
 31 PF12230 PRP21_like_P:  Pre-mRN  62.9     2.4 5.3E-05   38.6   0.0   41  322-364   169-209 (229)
 32 KOG3800 Predicted E3 ubiquitin  61.8     4.9 0.00011   40.3   1.9   53  318-380    37-92  (300)
 33 KOG4167 Predicted DNA-binding   61.6     4.3 9.4E-05   45.2   1.6   30  319-349   790-819 (907)
 34 KOG3993 Transcription factor (  60.6     3.7   8E-05   43.3   0.8   28  318-346   292-319 (500)
 35 KOG0717 Molecular chaperone (D  59.8     7.3 0.00016   41.4   2.8   26  318-343   288-314 (508)
 36 PF13878 zf-C2H2_3:  zinc-finge  57.8     6.2 0.00013   28.5   1.4   22  313-334     5-26  (41)
 37 KOG1146 Homeobox protein [Gene  57.1     5.8 0.00012   46.3   1.6   42  308-350   453-494 (1406)
 38 PF09723 Zn-ribbon_8:  Zinc rib  56.1     1.8 3.9E-05   31.0  -1.7   18  322-339     6-23  (42)
 39 PF09538 FYDLN_acid:  Protein o  56.0     5.1 0.00011   34.4   0.8   17  317-334    23-39  (108)
 40 TIGR03826 YvyF flagellar opero  52.5      10 0.00022   33.9   2.1   63  323-396     5-70  (137)
 41 KOG2785 C2H2-type Zn-finger pr  52.4     6.4 0.00014   40.7   1.0   24  320-350     2-27  (390)
 42 smart00834 CxxC_CXXC_SSSS Puta  52.4     4.7  0.0001   27.3  -0.0   17  322-338     6-22  (41)
 43 TIGR02605 CxxC_CxxC_SSSS putat  52.2     2.6 5.6E-05   30.3  -1.3   18  322-339     6-23  (52)
 44 PLN02748 tRNA dimethylallyltra  51.9      13 0.00027   38.7   2.9   29  315-343   412-441 (468)
 45 PHA02768 hypothetical protein;  51.6     5.1 0.00011   31.4   0.1   16  320-335    30-45  (55)
 46 PF14353 CpXC:  CpXC protein     48.5     6.5 0.00014   32.7   0.2   20  321-340    38-57  (128)
 47 COG1885 Uncharacterized protei  47.7     7.7 0.00017   34.5   0.6   16  319-334    47-62  (115)
 48 COG2888 Predicted Zn-ribbon RN  46.5     7.6 0.00017   31.4   0.4    8  321-328    50-57  (61)
 49 KOG3576 Ovo and related transc  46.1      12 0.00025   37.0   1.6   42  307-348   159-200 (267)
 50 PRK14890 putative Zn-ribbon RN  45.2     8.3 0.00018   30.9   0.4   10  320-329    47-56  (59)
 51 PF09855 DUF2082:  Nucleic-acid  43.9     9.4  0.0002   30.4   0.5    9  322-330     1-9   (64)
 52 PF14753 DUF4475:  Domain of un  42.5      11 0.00024   35.9   0.8   35  320-358   118-160 (196)
 53 KOG1280 Uncharacterized conser  42.1      16 0.00035   37.8   2.0   40  305-346    65-104 (381)
 54 PF06524 NOA36:  NOA36 protein;  41.7     8.1 0.00018   38.9  -0.2   28  313-342   201-228 (314)
 55 PF09986 DUF2225:  Uncharacteri  40.6     9.5 0.00021   35.2   0.1   21  320-340     4-24  (214)
 56 PLN02294 cytochrome c oxidase   40.2      18 0.00038   34.1   1.8   27  306-332   126-152 (174)
 57 KOG2907 RNA polymerase I trans  39.7      10 0.00022   33.9   0.1   12  322-333   103-114 (116)
 58 PF04423 Rad50_zn_hook:  Rad50   39.2      17 0.00036   26.8   1.2   25  323-350    22-46  (54)
 59 KOG2462 C2H2-type Zn-finger pr  38.9      12 0.00026   37.3   0.5   34  310-343   232-265 (279)
 60 KOG4317 Predicted Zn-finger pr  36.4      14  0.0003   38.1   0.5   12  322-333    20-31  (383)
 61 PF08646 Rep_fac-A_C:  Replicat  35.2      11 0.00024   31.8  -0.3   13  319-331    35-47  (146)
 62 PF04438 zf-HIT:  HIT zinc fing  35.0      12 0.00025   25.9  -0.2   13  319-331    11-23  (30)
 63 PF04641 Rtf2:  Rtf2 RING-finge  35.0     9.7 0.00021   35.7  -0.8   59  285-350    80-142 (260)
 64 KOG1814 Predicted E3 ubiquitin  34.8      36 0.00078   36.0   3.2   44  323-367   295-351 (445)
 65 PF09776 Mitoc_L55:  Mitochondr  34.3      24 0.00051   31.4   1.5   22  345-366    73-94  (116)
 66 PF07975 C1_4:  TFIIH C1-like d  32.6      15 0.00032   28.4  -0.0   15  319-333    19-33  (51)
 67 PF01927 Mut7-C:  Mut7-C RNAse   32.6      16 0.00034   31.6   0.1   12  321-332   124-135 (147)
 68 KOG1074 Transcriptional repres  32.4      16 0.00034   41.5   0.1   43  311-354   897-939 (958)
 69 PF04780 DUF629:  Protein of un  32.0      26 0.00055   37.0   1.6   31  317-347    53-83  (466)
 70 smart00531 TFIIE Transcription  31.1      17 0.00036   31.5   0.1   13  321-333    99-111 (147)
 71 PF10571 UPF0547:  Uncharacteri  30.7      17 0.00036   24.6   0.0   15  323-337     2-16  (26)
 72 TIGR02300 FYDLN_acid conserved  29.2      22 0.00047   32.2   0.5   15  320-334    25-39  (129)
 73 COG4640 Predicted membrane pro  28.9      27 0.00058   37.0   1.1   34  316-354    10-43  (465)
 74 PRK00398 rpoP DNA-directed RNA  28.8      19  0.0004   25.8  -0.0   14  321-334     3-16  (46)
 75 smart00154 ZnF_AN1 AN1-like Zi  28.2      23  0.0005   25.4   0.4   16  321-336    12-27  (39)
 76 TIGR00373 conserved hypothetic  27.7      40 0.00086   29.9   1.8   10  321-330   128-137 (158)
 77 KOG2636 Splicing factor 3a, su  26.6      20 0.00043   38.2  -0.2   43  309-352   260-303 (497)
 78 COG0777 AccD Acetyl-CoA carbox  26.2      51  0.0011   33.3   2.5   32  376-407    72-110 (294)
 79 PF05191 ADK_lid:  Adenylate ki  26.1      18  0.0004   25.7  -0.4   12  322-333     2-13  (36)
 80 PRK06266 transcription initiat  26.0      53  0.0012   29.9   2.4   12  321-332   136-147 (178)
 81 COG1813 Predicted transcriptio  25.5      79  0.0017   29.5   3.4   44  382-425   114-161 (165)
 82 PLN03086 PRLI-interacting fact  25.5      41 0.00088   36.3   1.7   21  320-342   477-497 (567)
 83 PF13719 zinc_ribbon_5:  zinc-r  25.2      30 0.00064   24.3   0.5   15  318-332    22-36  (37)
 84 PF12760 Zn_Tnp_IS1595:  Transp  25.2      34 0.00073   24.7   0.8   11  319-330    17-27  (46)
 85 PF08790 zf-LYAR:  LYAR-type C2  25.0      12 0.00026   26.2  -1.4   20  322-342     1-20  (28)
 86 PRK03922 hypothetical protein;  25.0      30 0.00065   30.9   0.6   16  319-334    47-62  (113)
 87 COG3809 Uncharacterized protei  24.6      75  0.0016   27.4   2.8   18  323-340    23-40  (88)
 88 COG1675 TFA1 Transcription ini  24.3      31 0.00067   32.1   0.6   11  322-332   133-143 (176)
 89 COG3364 Zn-ribbon containing p  24.3      28  0.0006   31.0   0.3   14  321-334     2-15  (112)
 90 PF09965 DUF2199:  Uncharacteri  24.3      24 0.00052   31.8  -0.2   36  322-358     1-36  (148)
 91 COG4888 Uncharacterized Zn rib  24.2      28 0.00062   30.7   0.3   13  320-332    21-33  (104)
 92 cd00924 Cyt_c_Oxidase_Vb Cytoc  23.6      32  0.0007   29.2   0.5   23  310-332    68-90  (97)
 93 COG1656 Uncharacterized conser  23.4      30 0.00066   32.3   0.3   12  322-333   131-142 (165)
 94 PF13248 zf-ribbon_3:  zinc-rib  23.3      27 0.00058   22.9  -0.0   18  322-339     3-20  (26)
 95 PF01428 zf-AN1:  AN1-like Zinc  23.0      25 0.00054   25.2  -0.3   19  320-338    12-30  (43)
 96 PRK06921 hypothetical protein;  22.8      39 0.00084   31.8   0.9   10  321-330    32-41  (266)
 97 PF12013 DUF3505:  Protein of u  22.7      62  0.0013   26.4   2.0   24  322-345    81-108 (109)
 98 smart00734 ZnF_Rad18 Rad18-lik  22.7      61  0.0013   21.6   1.6   19  323-342     3-21  (26)
 99 COG4338 Uncharacterized protei  22.7      76  0.0017   25.3   2.3   34  323-360    14-47  (54)
100 cd04476 RPA1_DBD_C RPA1_DBD_C:  22.3      35 0.00075   29.4   0.4   12  320-331    50-61  (166)
101 PF09845 DUF2072:  Zn-ribbon co  21.8      35 0.00076   30.9   0.4   15  321-335     1-15  (131)
102 KOG3993 Transcription factor (  20.8      52  0.0011   35.2   1.4   36  318-354   353-388 (500)
103 PTZ00222 60S ribosomal protein  20.3      74  0.0016   31.8   2.3   23  344-366    96-118 (263)
104 KOG1146 Homeobox protein [Gene  20.3      59  0.0013   38.6   1.8   27  318-344   515-541 (1406)

No 1  
>PHA00616 hypothetical protein
Probab=97.08  E-value=0.00028  Score=52.62  Aligned_cols=27  Identities=26%  Similarity=0.482  Sum_probs=24.4

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhccc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAHYR  347 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~HYK  347 (431)
                      ||.||.|+++|...+.+..|+.+.|-.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC
Confidence            899999999999999999999985543


No 2  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.01  E-value=0.00026  Score=43.25  Aligned_cols=23  Identities=30%  Similarity=0.765  Sum_probs=21.8

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhc
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAH  345 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~H  345 (431)
                      |+|+.|+++|.+...|..||.. |
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~-H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR-H   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH-H
T ss_pred             CCCCCCCCccCCHHHHHHHHhH-C
Confidence            7999999999999999999986 6


No 3  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.83  E-value=0.00044  Score=43.69  Aligned_cols=26  Identities=27%  Similarity=0.623  Sum_probs=23.5

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhccc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAHYR  347 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~HYK  347 (431)
                      ||+|..|++.|.+.+.|.+|+.. |.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~-h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRS-HCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCT-TTT
T ss_pred             CCCCCccCCccCChhHHHHHhHH-hcC
Confidence            79999999999999999999985 653


No 4  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.59  E-value=0.0011  Score=39.19  Aligned_cols=24  Identities=25%  Similarity=0.703  Sum_probs=20.1

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhc
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAH  345 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~H  345 (431)
                      |.|+.|++.|.+...+..||...|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999999744


No 5  
>PHA02768 hypothetical protein; Provisional
Probab=95.93  E-value=0.004  Score=48.31  Aligned_cols=27  Identities=26%  Similarity=0.578  Sum_probs=24.3

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhccccc
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAHYRFE  349 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~HYK~E  349 (431)
                      |.|++|++.|..++.+..||.. |-|.+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~-H~k~~   32 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRK-HNTNL   32 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHh-cCCcc
Confidence            7999999999999999999996 87543


No 6  
>smart00355 ZnF_C2H2 zinc finger.
Probab=94.60  E-value=0.027  Score=33.15  Aligned_cols=24  Identities=29%  Similarity=0.769  Sum_probs=21.9

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhcc
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAHY  346 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~HY  346 (431)
                      |.|+.|.+.|.+...|..||. .|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~-~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH-Hhc
Confidence            789999999999999999998 475


No 7  
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.18  E-value=0.028  Score=36.87  Aligned_cols=24  Identities=29%  Similarity=0.581  Sum_probs=22.2

Q ss_pred             CcccCcccchhhhhhHHHHHHHhh
Q 038616          320 GPYICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      |+|.|.-|++.|..+..+.+|+.+
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            689999999999999999999886


No 8  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=93.29  E-value=0.023  Score=36.95  Aligned_cols=21  Identities=29%  Similarity=0.605  Sum_probs=17.1

Q ss_pred             eccccccCcccCcccchhhhh
Q 038616          313 SLSRKKYGPYICPKCIQEFLT  333 (431)
Q Consensus       313 SLP~~KyGPYtCPKCN~VFdT  333 (431)
                      -.-|.+..||.|+.|++.|.+
T Consensus         6 ~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    6 MRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHSSSSSEEESSSSEEESS
T ss_pred             hhhcCCCCCCCCCCCcCeeCc
Confidence            334678899999999999864


No 9  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=93.26  E-value=0.028  Score=61.60  Aligned_cols=31  Identities=39%  Similarity=0.734  Sum_probs=28.3

Q ss_pred             CeeeeccccccCcccCcccchhhhhhHHHHHHHhh
Q 038616          309 GVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       309 GrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      =||||    +..||.||-|.|.|..|-.|.+||+|
T Consensus       301 lRIHS----GEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  301 LRIHS----GEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             heeec----CCCCcCCcccccccccCCcccccccc
Confidence            36666    78899999999999999999999999


No 10 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=92.79  E-value=0.064  Score=40.20  Aligned_cols=30  Identities=23%  Similarity=0.617  Sum_probs=23.8

Q ss_pred             cccCcccchhhhhhHHHHHHHhhh-cccccc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASA-HYRFET  350 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~-HYK~ET  350 (431)
                      +++|+.|++.|.+...+..||.+. |.+...
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~H~~~~~   80 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKHHKKRNS   80 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTTTTC-S-
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCccCCCccc
Confidence            799999999999999999999963 555543


No 11 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=92.65  E-value=0.052  Score=33.66  Aligned_cols=22  Identities=27%  Similarity=0.661  Sum_probs=21.0

Q ss_pred             ccCcccchhhhhhHHHHHHHhh
Q 038616          322 YICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      |.|.-|++.|.+...|.+|+.|
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            7899999999999999999986


No 12 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=92.05  E-value=0.044  Score=35.29  Aligned_cols=22  Identities=23%  Similarity=0.600  Sum_probs=20.9

Q ss_pred             ccCcccchhhhhhHHHHHHHhh
Q 038616          322 YICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      |.|.-|++.|.+...|..||.|
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999986


No 13 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.58  E-value=0.11  Score=41.85  Aligned_cols=43  Identities=30%  Similarity=0.407  Sum_probs=34.5

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhccccccHHHHHHHHHHHhhhhhH
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAHYRFETAAERKKRLAAKYKKKNI  367 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eERKKRl~Ar~kKr~~  367 (431)
                      +.||+|+++|..+-....|+--+|--   ...|-||.-.|.||++.
T Consensus        18 lrCPRC~~~FR~~K~Y~RHVNKaH~~---~~~r~k~~~k~~Kk~~d   60 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHVNKAHGW---LFGRGKPKGKRLKKKYD   60 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHhhHHhhh---hhcCCchhHHHHHHhhh
Confidence            68999999999999999999876742   23456777777788874


No 14 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=91.40  E-value=0.13  Score=40.57  Aligned_cols=31  Identities=23%  Similarity=0.517  Sum_probs=23.0

Q ss_pred             cccCcccCcccchhhhhhHHHHHHHhhhccc
Q 038616          317 KKYGPYICPKCIQEFLTSQSFAAHVASAHYR  347 (431)
Q Consensus       317 ~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK  347 (431)
                      +-+-|-|||.|..++..|..+-.||.+.|.+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            4467999999999999999999999988865


No 15 
>PHA00732 hypothetical protein
Probab=87.92  E-value=0.31  Score=39.36  Aligned_cols=26  Identities=23%  Similarity=0.397  Sum_probs=22.9

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhcc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAHY  346 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~HY  346 (431)
                      ||.|+.|++.|.+...+..||...|-
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~   26 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT   26 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC
Confidence            79999999999999999999984353


No 16 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=86.53  E-value=0.47  Score=46.84  Aligned_cols=33  Identities=24%  Similarity=0.591  Sum_probs=28.9

Q ss_pred             ccccCcccCcccchhhhhhHHHHHHHhhhccccc
Q 038616          316 RKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFE  349 (431)
Q Consensus       316 ~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~E  349 (431)
                      |.+..||-||-|+|.|.-...+-|||- +|.-.+
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K  242 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVK  242 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHH-hhcCCc
Confidence            467899999999999999999999999 576543


No 17 
>PHA00733 hypothetical protein
Probab=85.87  E-value=0.55  Score=40.36  Aligned_cols=30  Identities=37%  Similarity=0.811  Sum_probs=26.1

Q ss_pred             ccccccCcccCcccchhhhhhHHHHHHHhh
Q 038616          314 LSRKKYGPYICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       314 LP~~KyGPYtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      ++.....||+|+.|++.|.+...+..|+..
T Consensus        66 ~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~   95 (128)
T PHA00733         66 LTSKAVSPYVCPLCLMPFSSSVSLKQHIRY   95 (128)
T ss_pred             cccCCCCCccCCCCCCcCCCHHHHHHHHhc
Confidence            566667899999999999999999999984


No 18 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=78.61  E-value=0.56  Score=51.95  Aligned_cols=28  Identities=29%  Similarity=0.667  Sum_probs=22.7

Q ss_pred             cccccCcccCcccchhhhhhHHHHHHHh
Q 038616          315 SRKKYGPYICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       315 P~~KyGPYtCPKCN~VFdTSQkFAAHms  342 (431)
                      =|-+..||.|.||.|.|..|-...-||-
T Consensus       944 LHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  944 LHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             hccCCCcchhhhhhhhcccccchHhhhc
Confidence            3456788888888888888888888887


No 19 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=78.28  E-value=1.1  Score=31.92  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=16.6

Q ss_pred             cccCcccchhhhhhHHHHHHHh
Q 038616          321 PYICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHms  342 (431)
                      -++||.|++.+..+ +||+|..
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHHH
Confidence            37899999988755 7999986


No 20 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=74.49  E-value=1.4  Score=29.68  Aligned_cols=15  Identities=33%  Similarity=0.815  Sum_probs=13.3

Q ss_pred             cccccCcccCcccch
Q 038616          315 SRKKYGPYICPKCIQ  329 (431)
Q Consensus       315 P~~KyGPYtCPKCN~  329 (431)
                      |.++.-+|.||+|+.
T Consensus        10 ~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen   10 PREQAVPFPCPNCGF   24 (24)
T ss_pred             CcccCceEeCCCCCC
Confidence            788899999999974


No 21 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=73.40  E-value=2.6  Score=30.97  Aligned_cols=27  Identities=26%  Similarity=0.566  Sum_probs=21.9

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhcccc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAHYRF  348 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~HYK~  348 (431)
                      .|+||-|++.|+ -+.|..|+...|...
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~~   28 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRSE   28 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcCC
Confidence            489999999665 468999999878753


No 22 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=72.72  E-value=2.5  Score=27.68  Aligned_cols=20  Identities=25%  Similarity=0.615  Sum_probs=17.0

Q ss_pred             ccCcccchhhhhhHHHHHHHh
Q 038616          322 YICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHms  342 (431)
                      ..||.|++-| ....++.|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3799999999 6778899876


No 23 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=72.63  E-value=2.3  Score=26.34  Aligned_cols=21  Identities=24%  Similarity=0.615  Sum_probs=15.4

Q ss_pred             ccCcccchhhhhhHHHHHHHhh
Q 038616          322 YICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      |.|+.|+-... ...|..||..
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            78999997665 6778888875


No 24 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=72.41  E-value=1.2  Score=33.38  Aligned_cols=26  Identities=19%  Similarity=0.286  Sum_probs=0.0

Q ss_pred             cCcccchhhhhhHHHHHHHhhhcccc
Q 038616          323 ICPKCIQEFLTSQSFAAHVASAHYRF  348 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHmsS~HYK~  348 (431)
                      .|+-|+..|++-+.+..||...|--.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~   26 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD   26 (100)
T ss_dssp             --------------------------
T ss_pred             Cccccccccccccccccccccccccc
Confidence            39999999999999999999877654


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=70.19  E-value=3.2  Score=30.43  Aligned_cols=23  Identities=26%  Similarity=0.694  Sum_probs=18.8

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAH  345 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~H  345 (431)
                      .+.||.|..-+  +..|..||.+.|
T Consensus        31 ~v~CPiC~~~~--~~~l~~Hl~~~H   53 (54)
T PF05605_consen   31 NVVCPICSSRV--TDNLIRHLNSQH   53 (54)
T ss_pred             CccCCCchhhh--hhHHHHHHHHhc
Confidence            58999999854  459999999766


No 26 
>PHA00733 hypothetical protein
Probab=69.41  E-value=3.3  Score=35.65  Aligned_cols=26  Identities=35%  Similarity=0.658  Sum_probs=23.0

Q ss_pred             CcccCcccchhhhhhHHHHHHHhhhc
Q 038616          320 GPYICPKCIQEFLTSQSFAAHVASAH  345 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQkFAAHmsS~H  345 (431)
                      .||+|+.|.+.|..+..|..|+.-.|
T Consensus        98 ~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         98 HSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             cCccCCCCCCccCCHHHHHHHHHHhc
Confidence            36999999999999999999998644


No 27 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=67.08  E-value=4.5  Score=42.16  Aligned_cols=33  Identities=30%  Similarity=0.509  Sum_probs=27.6

Q ss_pred             ccCcccchhhhhhHHHHHHHh-hhccccccHHHH
Q 038616          322 YICPKCIQEFLTSQSFAAHVA-SAHYRFETAAER  354 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHms-S~HYK~ET~eER  354 (431)
                      +-|++|.+.|.||.-|-+|.. -.|.|.+...+-
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~gK~H~k~~~~~~~  272 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLEGKRHCKEGQGKEE  272 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHhhhhhhhhhhhhhH
Confidence            569999999999999999987 468887775444


No 28 
>PTZ00448 hypothetical protein; Provisional
Probab=65.82  E-value=3.5  Score=42.28  Aligned_cols=26  Identities=27%  Similarity=0.561  Sum_probs=22.5

Q ss_pred             ccCcccCcccchhhhhhHHHHHHHhh
Q 038616          318 KYGPYICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       318 KyGPYtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      +-++|+|..|+-.|.+++.+-.||.|
T Consensus       311 ~~~~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        311 KSNMLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccCCccccccccccCCHHHHHHHhhh
Confidence            34689999999999999998888776


No 29 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=65.25  E-value=2  Score=48.12  Aligned_cols=37  Identities=24%  Similarity=0.448  Sum_probs=32.3

Q ss_pred             eeeccccccCcccCcccchhhhhhHHHHHHHhhhcccc
Q 038616          311 IHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRF  348 (431)
Q Consensus       311 tHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~  348 (431)
                      +|---|....||.|-.|++.|.|.-.+-|||+- |--.
T Consensus       623 mHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~v-Hka~  659 (958)
T KOG1074|consen  623 MHYRTHTGERPFKCKICGRAFTTKGNLKAHMSV-HKAK  659 (958)
T ss_pred             hhhhcccCcCccccccccchhccccchhhcccc-cccC
Confidence            566678899999999999999999999999994 8543


No 30 
>PHA00732 hypothetical protein
Probab=64.01  E-value=3  Score=33.74  Aligned_cols=25  Identities=28%  Similarity=0.602  Sum_probs=19.7

Q ss_pred             cccCcccchhhhhhHHHHHHHhhhccccc
Q 038616          321 PYICPKCIQEFLTSQSFAAHVASAHYRFE  349 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAHmsS~HYK~E  349 (431)
                      +|+|+.|++.|.   ..+.|+.+ +|-.|
T Consensus        27 ~~~C~~CgKsF~---~l~~H~~~-~~~~~   51 (79)
T PHA00732         27 LTKCPVCNKSYR---RLNQHFYS-QYDIE   51 (79)
T ss_pred             CCccCCCCCEeC---Chhhhhcc-cCCcc
Confidence            579999999998   58888864 66554


No 31 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=62.88  E-value=2.4  Score=38.60  Aligned_cols=41  Identities=22%  Similarity=0.262  Sum_probs=0.0

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhccccccHHHHHHHHHHHhhh
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAHYRFETAAERKKRLAAKYKK  364 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eERKKRl~Ar~kK  364 (431)
                      .+||.|+..+.-+ +|+.||-. .---=.=+|-++|+.+|.+.
T Consensus       169 ~~cPitGe~IP~~-e~~eHmRi-~LlDP~wkEqr~~~~~k~~~  209 (229)
T PF12230_consen  169 IICPITGEMIPAD-EMDEHMRI-ELLDPRWKEQRDRYEAKRKQ  209 (229)
T ss_dssp             -------------------------------------------
T ss_pred             ccccccccccccc-cccccccc-cccccccccccccccccccc
Confidence            6899999999876 47777763 22222223445666666655


No 32 
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]
Probab=61.79  E-value=4.9  Score=40.32  Aligned_cols=53  Identities=19%  Similarity=0.424  Sum_probs=36.1

Q ss_pred             ccCcccCcccchhhhhhHHHHHHHhhhccccccHHHHHHHHHHHhhhhhHHHHhhh---cCCCcee
Q 038616          318 KYGPYICPKCIQEFLTSQSFAAHVASAHYRFETAAERKKRLAAKYKKKNILRMARS---SNGSLTI  380 (431)
Q Consensus       318 KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eERKKRl~Ar~kKr~~l~i~~K---lnG~lqe  380 (431)
                      -+|||.||.|+.+.--          .-++.++-|+--++..-.+|||-++...++   +.|+|.+
T Consensus        37 ~~g~~~CpeC~~iLRk----------~nfr~q~fED~~vekEv~iRrri~~~~nk~~eeF~~~Lae   92 (300)
T KOG3800|consen   37 SLGPAQCPECMVILRK----------NNFRVQTFEDPTVEKEVDIRRRILRIFNKKEEEFTGSLAE   92 (300)
T ss_pred             hcCCCCCCcccchhhh----------cccchhhcchhHHHHHHHHHHHHHHHhccchhhhhhhHHH
Confidence            3799999999987542          367777777777777777777765444333   5555544


No 33 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=61.58  E-value=4.3  Score=45.20  Aligned_cols=30  Identities=30%  Similarity=0.537  Sum_probs=26.3

Q ss_pred             cCcccCcccchhhhhhHHHHHHHhhhccccc
Q 038616          319 YGPYICPKCIQEFLTSQSFAAHVASAHYRFE  349 (431)
Q Consensus       319 yGPYtCPKCN~VFdTSQkFAAHmsS~HYK~E  349 (431)
                      .|=|.|-.|.|||+---..-|||.+ |---|
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~-Hr~q~  819 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKT-HRQQE  819 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHH-HHHHH
Confidence            6779999999999999999999996 76544


No 34 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=60.62  E-value=3.7  Score=43.33  Aligned_cols=28  Identities=29%  Similarity=0.481  Sum_probs=23.9

Q ss_pred             ccCcccCcccchhhhhhHHHHHHHhhhcc
Q 038616          318 KYGPYICPKCIQEFLTSQSFAAHVASAHY  346 (431)
Q Consensus       318 KyGPYtCPKCN~VFdTSQkFAAHmsS~HY  346 (431)
                      -.--|.||.|.|||.---.+|+|--. |-
T Consensus       292 V~vEYrCPEC~KVFsCPANLASHRRW-HK  319 (500)
T KOG3993|consen  292 VHVEYRCPECDKVFSCPANLASHRRW-HK  319 (500)
T ss_pred             EEeeecCCcccccccCchhhhhhhcc-cC
Confidence            34468999999999999999999985 63


No 35 
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=59.81  E-value=7.3  Score=41.42  Aligned_cols=26  Identities=23%  Similarity=0.482  Sum_probs=23.2

Q ss_pred             ccCc-ccCcccchhhhhhHHHHHHHhh
Q 038616          318 KYGP-YICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       318 KyGP-YtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      .+|+ +-|+-|||.|-|--.++.|.-|
T Consensus       288 ~~ge~lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  288 NEGEVLYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             hcCCceEEeeccccccchHHHHhhHHH
Confidence            5666 8899999999999999999887


No 36 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=57.85  E-value=6.2  Score=28.49  Aligned_cols=22  Identities=27%  Similarity=0.683  Sum_probs=17.1

Q ss_pred             eccccccCcccCcccchhhhhh
Q 038616          313 SLSRKKYGPYICPKCIQEFLTS  334 (431)
Q Consensus       313 SLP~~KyGPYtCPKCN~VFdTS  334 (431)
                      .|.-++.|.-+|++|+.++...
T Consensus         5 d~gq~~~~~~~C~~CgM~Y~~~   26 (41)
T PF13878_consen    5 DLGQKSFGATTCPTCGMLYSPG   26 (41)
T ss_pred             eCCCCccCCcCCCCCCCEECCC
Confidence            3455667899999999988654


No 37 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=57.07  E-value=5.8  Score=46.30  Aligned_cols=42  Identities=24%  Similarity=0.389  Sum_probs=36.1

Q ss_pred             CCeeeeccccccCcccCcccchhhhhhHHHHHHHhhhcccccc
Q 038616          308 DGVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFET  350 (431)
Q Consensus       308 DGrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET  350 (431)
                      .|-|.-|+.-+ .-|.|||||.++.-.+.+..||.+.|--++.
T Consensus       453 ~~~t~~L~S~~-kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~  494 (1406)
T KOG1146|consen  453 EGQTVVLHSFF-KTLKCPKCNWHYKLAQTLGVHMRSKHPESQS  494 (1406)
T ss_pred             ccceeeeeccc-ccccCCccchhhhhHHHhhhcccccccccch
Confidence            45566677666 7899999999999999999999999988777


No 38 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=56.08  E-value=1.8  Score=31.02  Aligned_cols=18  Identities=39%  Similarity=0.713  Sum_probs=16.1

Q ss_pred             ccCcccchhhhhhHHHHH
Q 038616          322 YICPKCIQEFLTSQSFAA  339 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAA  339 (431)
                      |.|++|+.+|+.-++++.
T Consensus         6 y~C~~Cg~~fe~~~~~~~   23 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE   23 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC
Confidence            899999999999887766


No 39 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=55.99  E-value=5.1  Score=34.37  Aligned_cols=17  Identities=47%  Similarity=1.019  Sum_probs=15.1

Q ss_pred             cccCcccCcccchhhhhh
Q 038616          317 KKYGPYICPKCIQEFLTS  334 (431)
Q Consensus       317 ~KyGPYtCPKCN~VFdTS  334 (431)
                      +| .|-+||||+.+|.-+
T Consensus        23 nk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   23 NK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CC-CCccCCCCCCccCcc
Confidence            55 899999999999887


No 40 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=52.49  E-value=10  Score=33.88  Aligned_cols=63  Identities=24%  Similarity=0.346  Sum_probs=31.8

Q ss_pred             cCcccchhhhhhHHHHHHHhhhcc-ccccHHHHHHHHHHHhhh--hhHHHHhhhcCCCceeecCCccchhHHHHHHH
Q 038616          323 ICPKCIQEFLTSQSFAAHVASAHY-RFETAAERKKRLAAKYKK--KNILRMARSSNGSLTIVHGRSFKNIADWRRKE  396 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHmsS~HY-K~ET~eERKKRl~Ar~kK--r~~l~i~~KlnG~lqeVhg~S~kiikd~~r~~  396 (431)
                      .||+|+++|..+  +. -+=..=| +-|..-++-+.|...+..  -....|+..        =|-|.+.|..|.|..
T Consensus         5 nC~~CgklF~~~--~~-~iCp~C~~~~e~~f~kV~~yLr~~p~~~ati~eV~e~--------tgVs~~~I~~~IreG   70 (137)
T TIGR03826         5 NCPKCGRLFVKT--GR-DVCPSCYEEEEREFEKVYKFLRKHENRQATVSEIVEE--------TGVSEKLILKFIREG   70 (137)
T ss_pred             cccccchhhhhc--CC-ccCHHHhHHHHHHHHHHHHHHHHCCCCCCCHHHHHHH--------HCcCHHHHHHHHHcC
Confidence            699999999762  11 1111112 223344445555444443  222333222        245677788888754


No 41 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=52.44  E-value=6.4  Score=40.73  Aligned_cols=24  Identities=33%  Similarity=0.628  Sum_probs=19.0

Q ss_pred             CcccCcccchhhhhh--HHHHHHHhhhcccccc
Q 038616          320 GPYICPKCIQEFLTS--QSFAAHVASAHYRFET  350 (431)
Q Consensus       320 GPYtCPKCN~VFdTS--QkFAAHmsS~HYK~ET  350 (431)
                      +-|||.-|+..|+++  |+       .|||+|=
T Consensus         2 t~ftC~tC~v~F~~ad~Qr-------~HyKSdW   27 (390)
T KOG2785|consen    2 TGFTCNTCNVEFDDADEQR-------AHYKSDW   27 (390)
T ss_pred             CcceeeceeeeeccHHHHH-------HHhhhhH
Confidence            359999999999999  65       3666663


No 42 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=52.35  E-value=4.7  Score=27.27  Aligned_cols=17  Identities=29%  Similarity=0.628  Sum_probs=14.0

Q ss_pred             ccCcccchhhhhhHHHH
Q 038616          322 YICPKCIQEFLTSQSFA  338 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFA  338 (431)
                      |.|++|+.+|+.-+.++
T Consensus         6 y~C~~Cg~~fe~~~~~~   22 (41)
T smart00834        6 YRCEDCGHTFEVLQKIS   22 (41)
T ss_pred             EEcCCCCCEEEEEEecC
Confidence            78999999998766554


No 43 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=52.21  E-value=2.6  Score=30.25  Aligned_cols=18  Identities=28%  Similarity=0.602  Sum_probs=14.7

Q ss_pred             ccCcccchhhhhhHHHHH
Q 038616          322 YICPKCIQEFLTSQSFAA  339 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAA  339 (431)
                      |.|++|+.+|+.-+.++.
T Consensus         6 y~C~~Cg~~fe~~~~~~~   23 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD   23 (52)
T ss_pred             EEeCCCCCEeEEEEecCC
Confidence            789999999998766553


No 44 
>PLN02748 tRNA dimethylallyltransferase
Probab=51.90  E-value=13  Score=38.73  Aligned_cols=29  Identities=21%  Similarity=0.520  Sum_probs=25.1

Q ss_pred             cccccCcccCcccch-hhhhhHHHHHHHhh
Q 038616          315 SRKKYGPYICPKCIQ-EFLTSQSFAAHVAS  343 (431)
Q Consensus       315 P~~KyGPYtCPKCN~-VFdTSQkFAAHmsS  343 (431)
                      +-+....|+|.-|++ ++-+-.....|+.|
T Consensus       412 ~~~~~~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        412 SRELWTQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccccccccCCCCcccCCHHHHHHHhcc
Confidence            445567899999997 99999999999997


No 45 
>PHA02768 hypothetical protein; Provisional
Probab=51.55  E-value=5.1  Score=31.39  Aligned_cols=16  Identities=13%  Similarity=0.112  Sum_probs=13.4

Q ss_pred             CcccCcccchhhhhhH
Q 038616          320 GPYICPKCIQEFLTSQ  335 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQ  335 (431)
                      .||.|.+|.++|.+..
T Consensus        30 k~~kc~~C~k~f~~~s   45 (55)
T PHA02768         30 TNLKLSNCKRISLRTG   45 (55)
T ss_pred             CcccCCcccceecccc
Confidence            3999999999998643


No 46 
>PF14353 CpXC:  CpXC protein
Probab=48.46  E-value=6.5  Score=32.71  Aligned_cols=20  Identities=25%  Similarity=0.675  Sum_probs=15.1

Q ss_pred             cccCcccchhhhhhHHHHHH
Q 038616          321 PYICPKCIQEFLTSQSFAAH  340 (431)
Q Consensus       321 PYtCPKCN~VFdTSQkFAAH  340 (431)
                      -|+||.|+..|.-...|.-|
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             EEECCCCCCceecCCCEEEE
Confidence            48999999998766555444


No 47 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=47.69  E-value=7.7  Score=34.52  Aligned_cols=16  Identities=38%  Similarity=0.823  Sum_probs=13.2

Q ss_pred             cCcccCcccchhhhhh
Q 038616          319 YGPYICPKCIQEFLTS  334 (431)
Q Consensus       319 yGPYtCPKCN~VFdTS  334 (431)
                      -|.+.||+|+.-|+.-
T Consensus        47 ~G~t~CP~Cg~~~e~~   62 (115)
T COG1885          47 VGSTSCPKCGEPFESA   62 (115)
T ss_pred             cccccCCCCCCcccee
Confidence            4889999999988753


No 48 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=46.55  E-value=7.6  Score=31.44  Aligned_cols=8  Identities=75%  Similarity=1.759  Sum_probs=5.9

Q ss_pred             cccCcccc
Q 038616          321 PYICPKCI  328 (431)
Q Consensus       321 PYtCPKCN  328 (431)
                      ||+||||+
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            67777776


No 49 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=46.13  E-value=12  Score=36.97  Aligned_cols=42  Identities=24%  Similarity=0.335  Sum_probs=34.8

Q ss_pred             CCCeeeeccccccCcccCcccchhhhhhHHHHHHHhhhcccc
Q 038616          307 GDGVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRF  348 (431)
Q Consensus       307 ~DGrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~  348 (431)
                      .|=..|.--|..-.||.|.-|+|.|...-.+-+|..-+|---
T Consensus       159 fdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~  200 (267)
T KOG3576|consen  159 FDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQ  200 (267)
T ss_pred             hhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCch
Confidence            344556666789999999999999999999999999878543


No 50 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=45.16  E-value=8.3  Score=30.88  Aligned_cols=10  Identities=60%  Similarity=1.394  Sum_probs=7.8

Q ss_pred             CcccCcccch
Q 038616          320 GPYICPKCIQ  329 (431)
Q Consensus       320 GPYtCPKCN~  329 (431)
                      -+|+||+|+-
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4789999973


No 51 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=43.91  E-value=9.4  Score=30.40  Aligned_cols=9  Identities=67%  Similarity=1.453  Sum_probs=7.6

Q ss_pred             ccCcccchh
Q 038616          322 YICPKCIQE  330 (431)
Q Consensus       322 YtCPKCN~V  330 (431)
                      |.||||+..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            899999873


No 52 
>PF14753 DUF4475:  Domain of unknown function (DUF4475)
Probab=42.46  E-value=11  Score=35.85  Aligned_cols=35  Identities=46%  Similarity=0.736  Sum_probs=24.8

Q ss_pred             CcccCcccch--hhhhh------HHHHHHHhhhccccccHHHHHHHH
Q 038616          320 GPYICPKCIQ--EFLTS------QSFAAHVASAHYRFETAAERKKRL  358 (431)
Q Consensus       320 GPYtCPKCN~--VFdTS------QkFAAHmsS~HYK~ET~eERKKRl  358 (431)
                      +||.|.||.+  -|+++      |.+++|.-.    +||++||.+|=
T Consensus       118 ~~~~C~k~~~C~~F~S~f~C~Cd~~~~~HeTv----~ET~~eR~~~G  160 (196)
T PF14753_consen  118 GPHKCKKCCGCSGFESSFLCACDQPWEAHETV----FETEEERRARG  160 (196)
T ss_pred             CCccCCCCCCCCCCCCCceecCcCchhheeee----EecHHHHHHcC
Confidence            6677777642  24443      678889875    89999998763


No 53 
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=42.12  E-value=16  Score=37.80  Aligned_cols=40  Identities=28%  Similarity=0.257  Sum_probs=29.5

Q ss_pred             cCCCCeeeeccccccCcccCcccchhhhhhHHHHHHHhhhcc
Q 038616          305 EEGDGVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHY  346 (431)
Q Consensus       305 ~~~DGrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HY  346 (431)
                      -.+.|--.|.=+  .-.||||-|+.-=-|-..|--|+++.|-
T Consensus        65 L~f~Ge~i~~y~--~qSftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   65 LYFGGEPISHYD--PQSFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             eEecCccccccc--cccccCCcccccccchhHHHHHhhhcCc
Confidence            344444433322  2399999999998899999999999885


No 54 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=41.68  E-value=8.1  Score=38.90  Aligned_cols=28  Identities=25%  Similarity=0.471  Sum_probs=21.3

Q ss_pred             eccccccCcccCcccchhhhhhHHHHHHHh
Q 038616          313 SLSRKKYGPYICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       313 SLP~~KyGPYtCPKCN~VFdTSQkFAAHms  342 (431)
                      -+.|+|..|++||||+  |+|+++----||
T Consensus       201 g~ky~k~k~~PCPKCg--~et~eTkdLSmS  228 (314)
T PF06524_consen  201 GFKYEKGKPIPCPKCG--YETQETKDLSMS  228 (314)
T ss_pred             ccccccCCCCCCCCCC--Ccccccccceee
Confidence            3678999999999998  567666544454


No 55 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=40.64  E-value=9.5  Score=35.17  Aligned_cols=21  Identities=29%  Similarity=0.532  Sum_probs=16.0

Q ss_pred             CcccCcccchhhhhhHHHHHH
Q 038616          320 GPYICPKCIQEFLTSQSFAAH  340 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQkFAAH  340 (431)
                      ..++||-|++.|.|..-+...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~   24 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGK   24 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCC
Confidence            358999999999987654433


No 56 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=40.22  E-value=18  Score=34.15  Aligned_cols=27  Identities=26%  Similarity=0.384  Sum_probs=20.6

Q ss_pred             CCCCeeeeccccccCcccCcccchhhh
Q 038616          306 EGDGVIHSLSRKKYGPYICPKCIQEFL  332 (431)
Q Consensus       306 ~~DGrtHSLP~~KyGPYtCPKCN~VFd  332 (431)
                      +|+--++-+=-+|-.|+.||.|+.+|.
T Consensus       126 eDsh~v~Wf~L~kGkp~RCpeCG~~fk  152 (174)
T PLN02294        126 EDEHDVVWFWLEKGKSFECPVCTQYFE  152 (174)
T ss_pred             CCCceeEEEEecCCCceeCCCCCCEEE
Confidence            345556666667778999999999984


No 57 
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=39.68  E-value=10  Score=33.88  Aligned_cols=12  Identities=50%  Similarity=1.220  Sum_probs=9.7

Q ss_pred             ccCcccchhhhh
Q 038616          322 YICPKCIQEFLT  333 (431)
Q Consensus       322 YtCPKCN~VFdT  333 (431)
                      ||||||..-|.+
T Consensus       103 YTC~kC~~k~~e  114 (116)
T KOG2907|consen  103 YTCPKCKYKFTE  114 (116)
T ss_pred             EEcCccceeeec
Confidence            899999887754


No 58 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=39.21  E-value=17  Score=26.78  Aligned_cols=25  Identities=20%  Similarity=0.476  Sum_probs=13.1

Q ss_pred             cCcccchhhhhhHHHHHHHhhhcccccc
Q 038616          323 ICPKCIQEFLTSQSFAAHVASAHYRFET  350 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHmsS~HYK~ET  350 (431)
                      .||-|++-|+.-.+  ..... +|+.+.
T Consensus        22 ~CPlC~r~l~~e~~--~~li~-~~~~~i   46 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR--QELIK-KYKSEI   46 (54)
T ss_dssp             E-TTT--EE-HHHH--HHHHH-HHHHHH
T ss_pred             cCCCCCCCCCHHHH--HHHHH-HHHHHH
Confidence            89999999987655  44443 554444


No 59 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=38.90  E-value=12  Score=37.35  Aligned_cols=34  Identities=21%  Similarity=0.373  Sum_probs=28.0

Q ss_pred             eeeeccccccCcccCcccchhhhhhHHHHHHHhh
Q 038616          310 VIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVAS  343 (431)
Q Consensus       310 rtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS  343 (431)
                      |-|-.-|-...+|.|++|+|.|.--.-+..|-.|
T Consensus       232 RAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  232 RAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            5555556677799999999999998888888876


No 60 
>KOG4317 consensus Predicted Zn-finger protein [Function unknown]
Probab=36.36  E-value=14  Score=38.15  Aligned_cols=12  Identities=33%  Similarity=1.065  Sum_probs=9.9

Q ss_pred             ccCcccchhhhh
Q 038616          322 YICPKCIQEFLT  333 (431)
Q Consensus       322 YtCPKCN~VFdT  333 (431)
                      ||||+||-.+-|
T Consensus        20 YtCPRCn~~YCs   31 (383)
T KOG4317|consen   20 YTCPRCNLLYCS   31 (383)
T ss_pred             ccCCCCCcccee
Confidence            999999976644


No 61 
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=35.20  E-value=11  Score=31.76  Aligned_cols=13  Identities=38%  Similarity=0.871  Sum_probs=11.4

Q ss_pred             cCcccCcccchhh
Q 038616          319 YGPYICPKCIQEF  331 (431)
Q Consensus       319 yGPYtCPKCN~VF  331 (431)
                      .|.|.|++|++..
T Consensus        35 ~~~y~C~~C~~~~   47 (146)
T PF08646_consen   35 DGSYRCEKCNKTV   47 (146)
T ss_dssp             TTEEEETTTTEEE
T ss_pred             CcEEECCCCCCcC
Confidence            5779999999986


No 62 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=35.04  E-value=12  Score=25.87  Aligned_cols=13  Identities=31%  Similarity=0.930  Sum_probs=8.1

Q ss_pred             cCcccCcccchhh
Q 038616          319 YGPYICPKCIQEF  331 (431)
Q Consensus       319 yGPYtCPKCN~VF  331 (431)
                      .+.|+||+|+..+
T Consensus        11 ~~kY~Cp~C~~~~   23 (30)
T PF04438_consen   11 PAKYRCPRCGARY   23 (30)
T ss_dssp             EESEE-TTT--EE
T ss_pred             CCEEECCCcCCce
Confidence            6789999998653


No 63 
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=35.02  E-value=9.7  Score=35.74  Aligned_cols=59  Identities=20%  Similarity=0.274  Sum_probs=38.1

Q ss_pred             ccccccccc----ccccCCccccccCCCCeeeeccccccCcccCcccchhhhhhHHHHHHHhhhcccccc
Q 038616          285 DLIYAPRKM----SEESSDDEDEDEEGDGVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFET  350 (431)
Q Consensus       285 ~~grslKki----~E~t~dyi~dd~~~DGrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET  350 (431)
                      ..+++||.+    |+...++.+++.       +.--...++|.||-+.++|.-+.+|++-...-|--+|.
T Consensus        80 ~hI~~LKDl~~l~~~~n~~~~~~~~-------~~~~~~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~  142 (260)
T PF04641_consen   80 SHIKSLKDLVELKFTKNPSYKEEDK-------SSGDNSEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEK  142 (260)
T ss_pred             ccccCccceeeEEeEecCccccccc-------cccccCCceeECCCCCcccCCceeEEEEcCCCCEeeHH
Confidence            456777775    555444432222       33445789999999999998888888765555544443


No 64 
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=34.80  E-value=36  Score=35.98  Aligned_cols=44  Identities=30%  Similarity=0.503  Sum_probs=35.7

Q ss_pred             cCcccchhhhhhHHHHHHHhhhccccc-------------cHHHHHHHHHHHhhhhhH
Q 038616          323 ICPKCIQEFLTSQSFAAHVASAHYRFE-------------TAAERKKRLAAKYKKKNI  367 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHmsS~HYK~E-------------T~eERKKRl~Ar~kKr~~  367 (431)
                      +|.|||-+|=|-=+.+-|..| -.|.+             +.++||.-+.+|+-||.+
T Consensus       295 ~CskCnFaFCtlCk~t~HG~s-~Ck~~~~~~~~l~~~~~~~d~a~k~ele~Ryg~rvv  351 (445)
T KOG1814|consen  295 ICSKCNFAFCTLCKLTWHGVS-PCKVKAEKLIELYLEYLEADEARKRELEKRYGKRVV  351 (445)
T ss_pred             hhccCccHHHHHHHHhhcCCC-cccCchHHHHHHHHHHhhcCHHHHHHHHHHhhHHHH
Confidence            899999999999999999865 66655             667788778788877753


No 65 
>PF09776 Mitoc_L55:  Mitochondrial ribosomal protein L55;  InterPro: IPR018615  Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. 
Probab=34.32  E-value=24  Score=31.36  Aligned_cols=22  Identities=32%  Similarity=0.344  Sum_probs=17.5

Q ss_pred             ccccccHHHHHHHHHHHhhhhh
Q 038616          345 HYRFETAAERKKRLAAKYKKKN  366 (431)
Q Consensus       345 HYK~ET~eERKKRl~Ar~kKr~  366 (431)
                      --..=|+|||+.|+++|.+|+.
T Consensus        73 Dl~~LSeeERk~rl~kR~pk~k   94 (116)
T PF09776_consen   73 DLDTLSEEERKARLRKRKPKKK   94 (116)
T ss_pred             CcccCCHHHHHHHHHHhCCccc
Confidence            3455689999999999888654


No 66 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=32.59  E-value=15  Score=28.39  Aligned_cols=15  Identities=40%  Similarity=0.904  Sum_probs=7.7

Q ss_pred             cCcccCcccchhhhh
Q 038616          319 YGPYICPKCIQEFLT  333 (431)
Q Consensus       319 yGPYtCPKCN~VFdT  333 (431)
                      .+.|.||+|+++|=-
T Consensus        19 ~~~y~C~~C~~~FC~   33 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCI   33 (51)
T ss_dssp             -EEE--TTTT--B-H
T ss_pred             CCeEECCCCCCcccc
Confidence            578999999999843


No 67 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=32.56  E-value=16  Score=31.65  Aligned_cols=12  Identities=25%  Similarity=0.725  Sum_probs=10.3

Q ss_pred             cccCcccchhhh
Q 038616          321 PYICPKCIQEFL  332 (431)
Q Consensus       321 PYtCPKCN~VFd  332 (431)
                      =|.||+|+++|=
T Consensus       124 f~~C~~C~kiyW  135 (147)
T PF01927_consen  124 FWRCPGCGKIYW  135 (147)
T ss_pred             EEECCCCCCEec
Confidence            478999999984


No 68 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=32.37  E-value=16  Score=41.46  Aligned_cols=43  Identities=23%  Similarity=0.509  Sum_probs=34.8

Q ss_pred             eeeccccccCcccCcccchhhhhhHHHHHHHhhhccccccHHHH
Q 038616          311 IHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFETAAER  354 (431)
Q Consensus       311 tHSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eER  354 (431)
                      ||.--|.+.+||.|--|.+-|-|.-.+-.||. +|.-.-+-..|
T Consensus       897 iH~rTHtg~KPF~C~fC~~aFttrgnLKvHMg-tH~w~q~~srr  939 (958)
T KOG1074|consen  897 IHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMG-THMWVQPPSRR  939 (958)
T ss_pred             HhhhcCCCCCCccchhhhhhhhhhhhhhhhhc-cccccCCCccC
Confidence            34444567899999999999999999999999 69887765443


No 69 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=31.98  E-value=26  Score=36.96  Aligned_cols=31  Identities=29%  Similarity=0.688  Sum_probs=25.4

Q ss_pred             cccCcccCcccchhhhhhHHHHHHHhhhccc
Q 038616          317 KKYGPYICPKCIQEFLTSQSFAAHVASAHYR  347 (431)
Q Consensus       317 ~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK  347 (431)
                      .+..=.+||.|.+.|.....|-.||..-|--
T Consensus        53 ~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   53 KSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             CceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3444568999999999999999999985643


No 70 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=31.08  E-value=17  Score=31.54  Aligned_cols=13  Identities=31%  Similarity=0.899  Sum_probs=11.5

Q ss_pred             cccCcccchhhhh
Q 038616          321 PYICPKCIQEFLT  333 (431)
Q Consensus       321 PYtCPKCN~VFdT  333 (431)
                      -|.||.|+..|+.
T Consensus        99 ~Y~Cp~C~~~y~~  111 (147)
T smart00531       99 YYKCPNCQSKYTF  111 (147)
T ss_pred             EEECcCCCCEeeH
Confidence            5999999999984


No 71 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=30.73  E-value=17  Score=24.55  Aligned_cols=15  Identities=40%  Similarity=0.820  Sum_probs=10.3

Q ss_pred             cCcccchhhhhhHHH
Q 038616          323 ICPKCIQEFLTSQSF  337 (431)
Q Consensus       323 tCPKCN~VFdTSQkF  337 (431)
                      +||.|.++...+.++
T Consensus         2 ~CP~C~~~V~~~~~~   16 (26)
T PF10571_consen    2 TCPECGAEVPESAKF   16 (26)
T ss_pred             cCCCCcCCchhhcCc
Confidence            577777777666554


No 72 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=29.16  E-value=22  Score=32.21  Aligned_cols=15  Identities=20%  Similarity=0.368  Sum_probs=13.5

Q ss_pred             CcccCcccchhhhhh
Q 038616          320 GPYICPKCIQEFLTS  334 (431)
Q Consensus       320 GPYtCPKCN~VFdTS  334 (431)
                      -|-+||||+.+|.-+
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            799999999998776


No 73 
>COG4640 Predicted membrane protein [Function unknown]
Probab=28.85  E-value=27  Score=36.97  Aligned_cols=34  Identities=26%  Similarity=0.350  Sum_probs=26.2

Q ss_pred             ccccCcccCcccchhhhhhHHHHHHHhhhccccccHHHH
Q 038616          316 RKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFETAAER  354 (431)
Q Consensus       316 ~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eER  354 (431)
                      ++-.+.+.|++|++.|..-|+.|.-..     +|+.++|
T Consensus        10 qk~Ed~~qC~qCG~~~t~~~sqan~~t-----n~i~~tr   43 (465)
T COG4640          10 QKAEDDVQCTQCGHKFTSRQSQANKST-----NEIIQTR   43 (465)
T ss_pred             ccccccccccccCCcCCchhhhhhHHH-----HHHHHhh
Confidence            344567789999999999999887544     4677777


No 74 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=28.82  E-value=19  Score=25.81  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=11.0

Q ss_pred             cccCcccchhhhhh
Q 038616          321 PYICPKCIQEFLTS  334 (431)
Q Consensus       321 PYtCPKCN~VFdTS  334 (431)
                      .|.|+.|+..|+-.
T Consensus         3 ~y~C~~CG~~~~~~   16 (46)
T PRK00398          3 EYKCARCGREVELD   16 (46)
T ss_pred             EEECCCCCCEEEEC
Confidence            58899999888654


No 75 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=28.20  E-value=23  Score=25.41  Aligned_cols=16  Identities=19%  Similarity=0.482  Sum_probs=13.1

Q ss_pred             cccCcccchhhhhhHH
Q 038616          321 PYICPKCIQEFLTSQS  336 (431)
Q Consensus       321 PYtCPKCN~VFdTSQk  336 (431)
                      |++|..|+++|=.+..
T Consensus        12 ~f~C~~C~~~FC~~HR   27 (39)
T smart00154       12 GFKCRHCGNLFCGEHR   27 (39)
T ss_pred             CeECCccCCccccccC
Confidence            8899999999965543


No 76 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=27.69  E-value=40  Score=29.95  Aligned_cols=10  Identities=30%  Similarity=1.006  Sum_probs=7.9

Q ss_pred             cccCcccchh
Q 038616          321 PYICPKCIQE  330 (431)
Q Consensus       321 PYtCPKCN~V  330 (431)
                      -|+||.|+.+
T Consensus       128 ~F~Cp~Cg~~  137 (158)
T TIGR00373       128 NFTCPRCGAM  137 (158)
T ss_pred             CCcCCCCCCE
Confidence            4888888877


No 77 
>KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=26.56  E-value=20  Score=38.18  Aligned_cols=43  Identities=14%  Similarity=0.129  Sum_probs=31.3

Q ss_pred             CeeeeccccccCcccCcccchhhhhhHHHHHHHh-hhccccccHH
Q 038616          309 GVIHSLSRKKYGPYICPKCIQEFLTSQSFAAHVA-SAHYRFETAA  352 (431)
Q Consensus       309 GrtHSLP~~KyGPYtCPKCN~VFdTSQkFAAHms-S~HYK~ET~e  352 (431)
                      |+.-+|-.+.-|-+ |++|.+.|.|+.++-.|.- ..|-|+++++
T Consensus       260 ~al~alglk~gGt~-~~ra~rlf~Tk~~~l~~L~~~~~~kn~s~~  303 (497)
T KOG2636|consen  260 SALTALGLKCGGTL-HERAQRLFSTKSKSLSHLDTKLFAKNPSKK  303 (497)
T ss_pred             HHHHHHHHhcCCee-cHHHHhhhhhcCcchhhhhhhhhccCcccc
Confidence            45556666666654 8899999999999977765 3466677766


No 78 
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=26.20  E-value=51  Score=33.34  Aligned_cols=32  Identities=19%  Similarity=0.277  Sum_probs=18.5

Q ss_pred             CCceeecCC-------ccchhHHHHHHHhhhccccccch
Q 038616          376 GSLTIVHGR-------SFKNIADWRRKEKRAAVKIEDGD  407 (431)
Q Consensus       376 G~lqeVhg~-------S~kiikd~~r~~k~a~~k~e~~~  407 (431)
                      |+..|+-..       .++-.|.|..|-++|..|-...|
T Consensus        72 gsf~el~~~l~~~dPL~F~d~k~Y~~rL~~a~~~tg~~d  110 (294)
T COG0777          72 GSFEELDSPLEPKDPLKFPDSKKYKDRLEAARKKTGLDD  110 (294)
T ss_pred             CcceecccCCCcCCcccCCcchhhHHHHHHHHhhcCCCc
Confidence            566666553       33334668877777765554433


No 79 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=26.11  E-value=18  Score=25.75  Aligned_cols=12  Identities=42%  Similarity=0.913  Sum_probs=9.6

Q ss_pred             ccCcccchhhhh
Q 038616          322 YICPKCIQEFLT  333 (431)
Q Consensus       322 YtCPKCN~VFdT  333 (431)
                      .+||+|+++|..
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            479999998853


No 80 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=26.04  E-value=53  Score=29.90  Aligned_cols=12  Identities=25%  Similarity=0.766  Sum_probs=9.0

Q ss_pred             cccCcccchhhh
Q 038616          321 PYICPKCIQEFL  332 (431)
Q Consensus       321 PYtCPKCN~VFd  332 (431)
                      -|+||.|+.+..
T Consensus       136 ~F~Cp~Cg~~L~  147 (178)
T PRK06266        136 GFRCPQCGEMLE  147 (178)
T ss_pred             CCcCCCCCCCCe
Confidence            488888887754


No 81 
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription]
Probab=25.51  E-value=79  Score=29.55  Aligned_cols=44  Identities=27%  Similarity=0.435  Sum_probs=29.8

Q ss_pred             cCCccchhHHHHHHHhhhcccccc-c-hh--hHhhcCCCcceeeceee
Q 038616          382 HGRSFKNIADWRRKEKRAAVKIED-G-DD--QVQKQGEDGLTIGGIAV  425 (431)
Q Consensus       382 hg~S~kiikd~~r~~k~a~~k~e~-~-~d--~vqk~g~~~~~~~~~~~  425 (431)
                      +|+....++.-+.=||.-++|.-. + ++  .--.-+.+|||+|-|++
T Consensus       114 ~g~~~P~~~~akkLEk~LgIkL~e~~~~~~~~~~~~~~~~~TLGdiv~  161 (165)
T COG1813         114 RGEATPNIKVAKKLEKLLGIKLVEKVDEEEEGPKGKDDDGLTLGDIVR  161 (165)
T ss_pred             hcccCccHHHHHHHHHHhCceeeeeccccccccccCCcCCCcccceEE
Confidence            667777777777777777776422 1 11  13456789999999985


No 82 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=25.46  E-value=41  Score=36.26  Aligned_cols=21  Identities=29%  Similarity=0.634  Sum_probs=12.1

Q ss_pred             CcccCcccchhhhhhHHHHHHHh
Q 038616          320 GPYICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQkFAAHms  342 (431)
                      .||.|| |++.| ....++.|+.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~  497 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQA  497 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhh
Confidence            466666 66544 4456666654


No 83 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=25.21  E-value=30  Score=24.31  Aligned_cols=15  Identities=33%  Similarity=0.516  Sum_probs=11.9

Q ss_pred             ccCcccCcccchhhh
Q 038616          318 KYGPYICPKCIQEFL  332 (431)
Q Consensus       318 KyGPYtCPKCN~VFd  332 (431)
                      +-+.-.||+|+.+|.
T Consensus        22 ~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   22 GGRKVRCPKCGHVFR   36 (37)
T ss_pred             CCcEEECCCCCcEee
Confidence            345678999999985


No 84 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=25.20  E-value=34  Score=24.66  Aligned_cols=11  Identities=36%  Similarity=1.174  Sum_probs=8.2

Q ss_pred             cCcccCcccchh
Q 038616          319 YGPYICPKCIQE  330 (431)
Q Consensus       319 yGPYtCPKCN~V  330 (431)
                      .| ++||+|+..
T Consensus        17 ~g-~~CP~Cg~~   27 (46)
T PF12760_consen   17 DG-FVCPHCGST   27 (46)
T ss_pred             CC-CCCCCCCCe
Confidence            45 669999964


No 85 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=25.04  E-value=12  Score=26.18  Aligned_cols=20  Identities=25%  Similarity=0.833  Sum_probs=14.7

Q ss_pred             ccCcccchhhhhhHHHHHHHh
Q 038616          322 YICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHms  342 (431)
                      |+|--|++.| +...+.+|.+
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            6899999999 6677788876


No 86 
>PRK03922 hypothetical protein; Provisional
Probab=25.03  E-value=30  Score=30.89  Aligned_cols=16  Identities=44%  Similarity=0.862  Sum_probs=13.1

Q ss_pred             cCcccCcccchhhhhh
Q 038616          319 YGPYICPKCIQEFLTS  334 (431)
Q Consensus       319 yGPYtCPKCN~VFdTS  334 (431)
                      -|-.+||+|+..|+.-
T Consensus        47 vG~~~cP~cge~~~~a   62 (113)
T PRK03922         47 VGLTICPKCGEPFDSA   62 (113)
T ss_pred             cCcccCCCCCCcCCcE
Confidence            3678999999999854


No 87 
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.63  E-value=75  Score=27.41  Aligned_cols=18  Identities=22%  Similarity=0.617  Sum_probs=12.2

Q ss_pred             cCcccchhhhhhHHHHHH
Q 038616          323 ICPKCIQEFLTSQSFAAH  340 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAH  340 (431)
                      -||+|.+|.-.--.+-.=
T Consensus        23 ~CPrCrGVWLDrGELdKl   40 (88)
T COG3809          23 YCPRCRGVWLDRGELDKL   40 (88)
T ss_pred             eCCccccEeecchhHHHH
Confidence            399999987655444333


No 88 
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=24.34  E-value=31  Score=32.10  Aligned_cols=11  Identities=36%  Similarity=1.132  Sum_probs=9.5

Q ss_pred             ccCcccchhhh
Q 038616          322 YICPKCIQEFL  332 (431)
Q Consensus       322 YtCPKCN~VFd  332 (431)
                      |+||+||....
T Consensus       133 F~Cp~Cg~~L~  143 (176)
T COG1675         133 FTCPKCGEDLE  143 (176)
T ss_pred             CCCCCCCchhh
Confidence            99999998754


No 89 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=24.32  E-value=28  Score=31.03  Aligned_cols=14  Identities=29%  Similarity=0.667  Sum_probs=12.2

Q ss_pred             cccCcccchhhhhh
Q 038616          321 PYICPKCIQEFLTS  334 (431)
Q Consensus       321 PYtCPKCN~VFdTS  334 (431)
                      |..|-+|+.||++-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            67899999999983


No 90 
>PF09965 DUF2199:  Uncharacterized protein conserved in bacteria (DUF2199);  InterPro: IPR018697 This domain has no known function.
Probab=24.29  E-value=24  Score=31.82  Aligned_cols=36  Identities=25%  Similarity=0.333  Sum_probs=28.6

Q ss_pred             ccCcccchhhhhhHHHHHHHhhhccccccHHHHHHHH
Q 038616          322 YICPKCIQEFLTSQSFAAHVASAHYRFETAAERKKRL  358 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eERKKRl  358 (431)
                      |+|..|+..++..-.|+.-.-- .|---.++||.+|.
T Consensus         1 y~C~~Cg~~h~~~P~~~~~~Pd-~~~~~~~~er~~r~   36 (148)
T PF09965_consen    1 YTCSCCGEEHEGLPSLGFDAPD-YYYELPEEEREARA   36 (148)
T ss_pred             CCCCcCCccCCCCcccccCCCh-hhhhCCHHHhhhhc
Confidence            8999999999988877765553 66666788888876


No 91 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=24.15  E-value=28  Score=30.65  Aligned_cols=13  Identities=31%  Similarity=0.912  Sum_probs=10.0

Q ss_pred             CcccCcccchhhh
Q 038616          320 GPYICPKCIQEFL  332 (431)
Q Consensus       320 GPYtCPKCN~VFd  332 (431)
                      .-||||.||++-.
T Consensus        21 k~FtCp~Cghe~v   33 (104)
T COG4888          21 KTFTCPRCGHEKV   33 (104)
T ss_pred             ceEecCccCCeee
Confidence            3499999997643


No 92 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=23.63  E-value=32  Score=29.24  Aligned_cols=23  Identities=26%  Similarity=0.376  Sum_probs=16.8

Q ss_pred             eeeeccccccCcccCcccchhhh
Q 038616          310 VIHSLSRKKYGPYICPKCIQEFL  332 (431)
Q Consensus       310 rtHSLP~~KyGPYtCPKCN~VFd  332 (431)
                      -++-+=-+|..|+.|+.|+.+|.
T Consensus        68 ~v~W~~l~~g~~~rC~eCG~~fk   90 (97)
T cd00924          68 DVIWMWLEKGKPKRCPECGHVFK   90 (97)
T ss_pred             eEEEEEEeCCCceeCCCCCcEEE
Confidence            34444445558999999999984


No 93 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=23.39  E-value=30  Score=32.27  Aligned_cols=12  Identities=42%  Similarity=1.054  Sum_probs=10.0

Q ss_pred             ccCcccchhhhh
Q 038616          322 YICPKCIQEFLT  333 (431)
Q Consensus       322 YtCPKCN~VFdT  333 (431)
                      |.||+|+++|=-
T Consensus       131 ~~C~~CgkiYW~  142 (165)
T COG1656         131 YRCPKCGKIYWK  142 (165)
T ss_pred             eECCCCcccccC
Confidence            679999999853


No 94 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=23.25  E-value=27  Score=22.89  Aligned_cols=18  Identities=28%  Similarity=0.674  Sum_probs=13.6

Q ss_pred             ccCcccchhhhhhHHHHH
Q 038616          322 YICPKCIQEFLTSQSFAA  339 (431)
Q Consensus       322 YtCPKCN~VFdTSQkFAA  339 (431)
                      -+||.|+...+...+|-.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             CCCcccCCcCCcccccCh
Confidence            479999998777776643


No 95 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=22.99  E-value=25  Score=25.16  Aligned_cols=19  Identities=21%  Similarity=0.597  Sum_probs=12.1

Q ss_pred             CcccCcccchhhhhhHHHH
Q 038616          320 GPYICPKCIQEFLTSQSFA  338 (431)
Q Consensus       320 GPYtCPKCN~VFdTSQkFA  338 (431)
                      =|++|+.|++.|=....+.
T Consensus        12 ~~~~C~~C~~~FC~~Hr~~   30 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKHRLP   30 (43)
T ss_dssp             SHEE-TTTS-EE-TTTHST
T ss_pred             CCeECCCCCcccCccccCc
Confidence            3899999999997665543


No 96 
>PRK06921 hypothetical protein; Provisional
Probab=22.79  E-value=39  Score=31.83  Aligned_cols=10  Identities=50%  Similarity=1.202  Sum_probs=8.4

Q ss_pred             cccCcccchh
Q 038616          321 PYICPKCIQE  330 (431)
Q Consensus       321 PYtCPKCN~V  330 (431)
                      .|+||+|+..
T Consensus        32 ~~~Cp~C~dt   41 (266)
T PRK06921         32 RYDCPKCKDR   41 (266)
T ss_pred             CCCCCCCCCC
Confidence            6999999864


No 97 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=22.73  E-value=62  Score=26.37  Aligned_cols=24  Identities=25%  Similarity=0.520  Sum_probs=22.2

Q ss_pred             ccC----cccchhhhhhHHHHHHHhhhc
Q 038616          322 YIC----PKCIQEFLTSQSFAAHVASAH  345 (431)
Q Consensus       322 YtC----PKCN~VFdTSQkFAAHmsS~H  345 (431)
                      |.|    +.|.-++.+..+.-.|+...|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            999    999999999999999998755


No 98 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=22.70  E-value=61  Score=21.60  Aligned_cols=19  Identities=26%  Similarity=0.726  Sum_probs=15.1

Q ss_pred             cCcccchhhhhhHHHHHHHh
Q 038616          323 ICPKCIQEFLTSQSFAAHVA  342 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHms  342 (431)
                      .||-|++-+ +...+-+|.-
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            699999998 6667777765


No 99 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.66  E-value=76  Score=25.32  Aligned_cols=34  Identities=32%  Similarity=0.560  Sum_probs=27.0

Q ss_pred             cCcccchhhhhhHHHHHHHhhhccccccHHHHHHHHHH
Q 038616          323 ICPKCIQEFLTSQSFAAHVASAHYRFETAAERKKRLAA  360 (431)
Q Consensus       323 tCPKCN~VFdTSQkFAAHmsS~HYK~ET~eERKKRl~A  360 (431)
                      +||-|.+-|.-.-|.|.---++-|-+    ||=+|+++
T Consensus        14 ICpvCqRPFsWRkKW~~cWDeVKyCS----eRCrr~Rs   47 (54)
T COG4338          14 ICPVCQRPFSWRKKWARCWDEVKYCS----ERCRRLRS   47 (54)
T ss_pred             hhhhhcCchHHHHHHHHHHHHHHHHH----HHHHHHhc
Confidence            89999999999999998877755544    56667754


No 100
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=22.29  E-value=35  Score=29.35  Aligned_cols=12  Identities=42%  Similarity=1.021  Sum_probs=11.0

Q ss_pred             CcccCcccchhh
Q 038616          320 GPYICPKCIQEF  331 (431)
Q Consensus       320 GPYtCPKCN~VF  331 (431)
                      |-|.|++|++.+
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            789999999986


No 101
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=21.80  E-value=35  Score=30.89  Aligned_cols=15  Identities=33%  Similarity=0.660  Sum_probs=12.8

Q ss_pred             cccCcccchhhhhhH
Q 038616          321 PYICPKCIQEFLTSQ  335 (431)
Q Consensus       321 PYtCPKCN~VFdTSQ  335 (431)
                      |..|-+|+++|+...
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999999764


No 102
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=20.85  E-value=52  Score=35.19  Aligned_cols=36  Identities=25%  Similarity=0.440  Sum_probs=30.5

Q ss_pred             ccCcccCcccchhhhhhHHHHHHHhhhccccccHHHH
Q 038616          318 KYGPYICPKCIQEFLTSQSFAAHVASAHYRFETAAER  354 (431)
Q Consensus       318 KyGPYtCPKCN~VFdTSQkFAAHmsS~HYK~ET~eER  354 (431)
                      -.|-|.|..|.|-|.+--.+--|.++ |-+.+..++.
T Consensus       353 s~gi~~C~~C~KkFrRqAYLrKHqlt-hq~~~~~k~~  388 (500)
T KOG3993|consen  353 SSGIFSCHTCGKKFRRQAYLRKHQLT-HQRAPLAKEK  388 (500)
T ss_pred             cCceeecHHhhhhhHHHHHHHHhHHh-hhccccchhc
Confidence            34579999999999999999999996 8888876653


No 103
>PTZ00222 60S ribosomal protein L7a; Provisional
Probab=20.33  E-value=74  Score=31.76  Aligned_cols=23  Identities=30%  Similarity=0.387  Sum_probs=19.4

Q ss_pred             hccccccHHHHHHHHHHHhhhhh
Q 038616          344 AHYRFETAAERKKRLAAKYKKKN  366 (431)
Q Consensus       344 ~HYK~ET~eERKKRl~Ar~kKr~  366 (431)
                      ..|+-||..|+|.||.++-.++-
T Consensus        96 ~KYrPEtk~~kk~Rl~~~A~~~~  118 (263)
T PTZ00222         96 KKYAPETRKARRDRLHKVAEEKK  118 (263)
T ss_pred             HHcCCccHHHHHHHHHHHHHHHh
Confidence            48999999999999998766543


No 104
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=20.31  E-value=59  Score=38.59  Aligned_cols=27  Identities=26%  Similarity=0.447  Sum_probs=24.6

Q ss_pred             ccCcccCcccchhhhhhHHHHHHHhhh
Q 038616          318 KYGPYICPKCIQEFLTSQSFAAHVASA  344 (431)
Q Consensus       318 KyGPYtCPKCN~VFdTSQkFAAHmsS~  344 (431)
                      .|+||.|-.|+-.+.|-+.+..||-|.
T Consensus       515 ~~~p~~C~~C~~stttng~LsihlqS~  541 (1406)
T KOG1146|consen  515 PGKPYPCRACNYSTTTNGNLSIHLQSD  541 (1406)
T ss_pred             CCCcccceeeeeeeecchHHHHHHHHH
Confidence            468999999999999999999999973


Done!