Citrus Sinensis ID: 038621

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------
MDFTFLFLLPFASICFILCFYLFLKFISSNGRNLPLPPGTLGWPYIGETFELYSQNPNVFFASKVKRYGSIFKTHILGCPCVMISSPEAAKFVLVTRAHLFKPTFPASKERMIGKQAIFFHQGDYHIKLRKLVLRAFMPEAIKNIIPDIECIAKDSLQSWQGRLINTYQEMKIYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPINLPGTLFHKSMKARKELAQIVAKIISTRRQMKLDHNDLLGSFMGAKEGLTDEQIADNIIGVIFAARDTTASALTWIVKYLGENPGVLQAVTEEQEAIIKSKEKSGEEEVLSWADTKKMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPEIFPDPEKFDPSRFEVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTVVGTNTGIQYGPFALPMNGLPIRLAQKSKDKSEITIHNM
ccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHcccEEEccccccEEEEccHHHHHHHHHccccccccccccHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccccccHHHHccccHHHHHHHHHHccccccccccEEEcccEEEccEECccccEEEccHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccCEECccccccCECcccccccccccEEEEEccccccccccccc
MDFTFLFLLPFASICFILCFYLFLKFISSNGRNLPLPPGTLGWPYIGETFELYSQNPNVFFASKVKRYGSIFKTHILGCPCVMISSPEAAKFVLVTRAHLFKPTFPASKERMIGKQAIFFHQGDYHIKLRKLVLRAFMPEAIKNIIPDIECIAKDSLQSWQGRLINTYQEMKIYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPINLPGTLFHKSMKARKELAQIVAKIISTRRQMKLDHNDLLGSFMGAKEGLTDEQIADNIIGVIFAARDTTASALTWIVKYLGENPGVLQAVTEEQE**************LSWADTKKMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPEIFPDPEKFDPSRFEVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTVVGTNTGIQYGPFALPMNGLPIR****************
xxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFTFLFLLPFASICFILCFYLFLKFISSNGRNLPLPPGTLGWPYIGETFELYSQNPNVFFASKVKRYGSIFKTHILGCPCVMISSPEAAKFVLVTRAHLFKPTFPASKERMIGKQAIFFHQGDYHIKLRKLVLRAFMPEAIKNIIPDIECIAKDSLQSWQGRLINTYQEMKIYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPINLPGTLFHKSMKARKELAQIVAKIISTRRQMKLDHNDLLGSFMGAKEGLTDEQIADNIIGVIFAARDTTASALTWIVKYLGENPGVLQAVTEEQEAIIKSKEKSGEEEVLSWADTKKMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPEIFPDPEKFDPSRFEVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTVVGTNTGIQYGPFALPMNGLPIRLAQKSKDKSEITIHNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Abscisic acid 8'-hydroxylase 1 Involved in the oxidative degradation of abscisic acid. Plays an important role in determining abscisic acid levels in dry seeds and in the control of postgermination growth.confidentQ949P1
Abscisic acid 8'-hydroxylase 1 Involved in the oxidative degradation of abscisic acid.probableQ05JG2
Cytochrome P450 26A1 Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA.probableO43174

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.13.-With NADH or NADPH as one donor, and incorporation of one atom of oxygen.probable
1.14.13.93(+)-abscisic acid 8'-hydroxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DAX, chain A
Confidence level:very confident
Coverage over the Query: 30-466
View the alignment between query and template
View the model in PyMOL