Query         038669
Match_columns 244
No_of_seqs    349 out of 1885
Neff          8.2 
Searched_HMMs 46136
Date          Fri Mar 29 13:25:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038669.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038669hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462 C2H2-type Zn-finger pr  99.8 7.2E-21 1.6E-25  159.8   3.9   87   95-184   159-245 (279)
  2 KOG2462 C2H2-type Zn-finger pr  99.7 6.9E-18 1.5E-22  141.9   0.1   82   93-177   183-266 (279)
  3 KOG3623 Homeobox transcription  99.6 4.9E-16 1.1E-20  144.5   0.1   83   90-175   887-971 (1007)
  4 KOG3576 Ovo and related transc  99.5 2.4E-15 5.3E-20  121.3   1.5   84   91-177   111-197 (267)
  5 KOG1074 Transcriptional repres  99.5 7.9E-15 1.7E-19  138.4   0.3   54  126-182   608-661 (958)
  6 KOG3623 Homeobox transcription  99.3 2.1E-13 4.6E-18  127.1   1.5   80   95-177   238-332 (1007)
  7 KOG1074 Transcriptional repres  99.0 8.9E-10 1.9E-14  104.8   6.4   84   94-180   602-694 (958)
  8 KOG3576 Ovo and related transc  98.9 1.3E-10 2.8E-15   94.1  -1.8   85   93-180   141-238 (267)
  9 KOG3608 Zn finger proteins [Ge  98.9 2.8E-10 6.2E-15   98.9   0.1   82   95-179   235-317 (467)
 10 PHA00733 hypothetical protein   98.9 4.7E-10   1E-14   86.4   0.4   81   94-179    37-124 (128)
 11 PHA02768 hypothetical protein;  98.9 1.8E-09 3.8E-14   70.0   2.8   42   97-138     5-46  (55)
 12 PHA02768 hypothetical protein;  98.6 7.3E-09 1.6E-13   67.1  -0.7   44  123-171     5-48  (55)
 13 PLN03086 PRLI-interacting fact  98.5 6.4E-08 1.4E-12   90.7   3.7   77   95-177   451-537 (567)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.4   3E-08 6.4E-13   54.9  -1.1   24  143-166     3-26  (26)
 15 KOG3993 Transcription factor (  98.4 4.2E-08   9E-13   87.4  -1.4   81   97-180   267-382 (500)
 16 KOG3608 Zn finger proteins [Ge  98.4 6.1E-08 1.3E-12   84.6  -0.5   86   91-179   286-377 (467)
 17 PHA00733 hypothetical protein   98.2 7.3E-07 1.6E-11   68.7   1.6   53   94-149    70-122 (128)
 18 PHA00732 hypothetical protein   98.0 3.9E-06 8.4E-11   59.1   2.7   38   97-134     1-38  (79)
 19 PHA00616 hypothetical protein   98.0 1.4E-06   3E-11   53.9  -0.0   29  154-182     1-29  (44)
 20 PF00096 zf-C2H2:  Zinc finger,  97.8 1.6E-05 3.4E-10   42.3   2.7   23   98-120     1-23  (23)
 21 PF00096 zf-C2H2:  Zinc finger,  97.8 3.9E-06 8.4E-11   44.7   0.2   23  155-177     1-23  (23)
 22 PLN03086 PRLI-interacting fact  97.8 7.2E-06 1.6E-10   77.2   2.1   72   96-174   477-560 (567)
 23 PHA00616 hypothetical protein   97.8 1.2E-05 2.5E-10   49.7   1.3   25   97-121     1-25  (44)
 24 COG5189 SFP1 Putative transcri  97.7 1.9E-05 4.2E-10   68.3   2.9   71   94-175   346-419 (423)
 25 PHA00732 hypothetical protein   97.7 1.2E-05 2.6E-10   56.6   1.0   47  123-178     1-48  (79)
 26 PF13912 zf-C2H2_6:  C2H2-type   97.6 2.1E-05 4.6E-10   43.5   0.9   26  154-179     1-26  (27)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.4 9.2E-05   2E-09   40.9   1.6   25   97-121     1-25  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.4 5.4E-05 1.2E-09   40.2   0.6   24  155-178     1-24  (24)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00019 4.1E-09   38.0   2.7   24   98-121     1-24  (24)
 30 PF13465 zf-H2C2_2:  Zinc-finge  97.3 5.8E-05 1.2E-09   41.5   0.1   21  113-133     2-24  (26)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.2 0.00011 2.3E-09   53.3   1.0   72   99-177     1-73  (100)
 32 PF05605 zf-Di19:  Drought indu  97.2 0.00031 6.7E-09   45.7   2.8   52   97-178     2-53  (54)
 33 KOG3993 Transcription factor (  97.1 0.00053 1.1E-08   61.7   3.9  135   41-178   297-483 (500)
 34 smart00355 ZnF_C2H2 zinc finge  96.9 0.00031 6.7E-09   37.7   0.7   24  155-178     1-24  (26)
 35 smart00355 ZnF_C2H2 zinc finge  96.7 0.00098 2.1E-08   35.6   1.7   24   98-121     1-24  (26)
 36 PF09237 GAGA:  GAGA factor;  I  96.7 0.00079 1.7E-08   42.7   1.1   32  151-182    21-52  (54)
 37 PF12874 zf-met:  Zinc-finger o  96.5  0.0021 4.5E-08   34.6   1.8   23   98-120     1-23  (25)
 38 PF12874 zf-met:  Zinc-finger o  96.1  0.0021 4.5E-08   34.6   0.6   23  155-177     1-23  (25)
 39 PRK04860 hypothetical protein;  95.9  0.0056 1.2E-07   48.9   2.3   40   95-167   117-156 (160)
 40 PF12171 zf-C2H2_jaz:  Zinc-fin  95.8  0.0048 1.1E-07   34.0   1.3   23  155-177     2-24  (27)
 41 PF09237 GAGA:  GAGA factor;  I  95.8   0.015 3.2E-07   37.0   3.5   29   93-121    20-48  (54)
 42 PF13909 zf-H2C2_5:  C2H2-type   95.0  0.0077 1.7E-07   32.1   0.3   23  155-178     1-23  (24)
 43 PF13909 zf-H2C2_5:  C2H2-type   94.9   0.028 6.2E-07   29.8   2.4   22   98-120     1-22  (24)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  94.9   0.007 1.5E-07   33.3  -0.1   22   98-119     2-23  (27)
 45 KOG2893 Zn finger protein [Gen  94.1   0.018   4E-07   48.3   0.7   20   99-118    12-31  (341)
 46 COG5048 FOG: Zn-finger [Genera  93.6   0.059 1.3E-06   48.4   3.0   59  123-184   289-353 (467)
 47 KOG1146 Homeobox protein [Gene  93.5   0.038 8.2E-07   56.5   1.7   73   93-175   461-539 (1406)
 48 PF13913 zf-C2HC_2:  zinc-finge  93.1   0.038 8.2E-07   29.9   0.7   21  155-176     3-23  (25)
 49 smart00451 ZnF_U1 U1-like zinc  92.1    0.11 2.4E-06   29.9   1.8   23   97-119     3-25  (35)
 50 PF13913 zf-C2HC_2:  zinc-finge  91.6    0.15 3.3E-06   27.5   1.8   21   98-119     3-23  (25)
 51 smart00451 ZnF_U1 U1-like zinc  91.0    0.13 2.7E-06   29.7   1.2   23  154-176     3-25  (35)
 52 KOG2231 Predicted E3 ubiquitin  89.8    0.11 2.4E-06   50.1   0.4   32   98-129   100-146 (669)
 53 PF12756 zf-C2H2_2:  C2H2 type   89.5    0.32   7E-06   34.7   2.6   25   97-121    50-74  (100)
 54 PF09538 FYDLN_acid:  Protein o  85.9    0.54 1.2E-05   35.0   1.9   30  124-167    10-39  (108)
 55 KOG1146 Homeobox protein [Gene  84.8    0.29 6.3E-06   50.4   0.0   33  145-178  1320-1352(1406)
 56 PF09986 DUF2225:  Uncharacteri  82.6    0.35 7.6E-06   40.5  -0.3   22   95-116     3-24  (214)
 57 COG5189 SFP1 Putative transcri  82.2    0.63 1.4E-05   40.9   1.1   25   93-117   394-418 (423)
 58 COG4049 Uncharacterized protei  80.6     1.1 2.3E-05   29.1   1.4   29   91-119    11-39  (65)
 59 KOG4167 Predicted DNA-binding   78.1     1.1 2.4E-05   43.6   1.3   28   94-121   789-816 (907)
 60 COG5048 FOG: Zn-finger [Genera  78.0    0.92   2E-05   40.6   0.8   70   96-168   288-367 (467)
 61 PF05605 zf-Di19:  Drought indu  77.6     1.6 3.4E-05   28.0   1.6   26  154-180     2-28  (54)
 62 COG5236 Uncharacterized conser  77.4     1.8 3.8E-05   38.7   2.3   78   98-178   152-244 (493)
 63 TIGR02300 FYDLN_acid conserved  76.1     2.1 4.6E-05   32.6   2.1   21  151-171    23-43  (129)
 64 PF02892 zf-BED:  BED zinc fing  74.5     3.1 6.8E-05   25.3   2.3   25   94-118    13-41  (45)
 65 cd00350 rubredoxin_like Rubred  74.5     2.3 4.9E-05   24.4   1.5   11   98-108     2-12  (33)
 66 COG1997 RPL43A Ribosomal prote  73.8     3.5 7.6E-05   29.3   2.6   34  122-168    34-67  (89)
 67 PRK00464 nrdR transcriptional   73.5       2 4.4E-05   34.1   1.5   19  153-171    27-45  (154)
 68 PF14353 CpXC:  CpXC protein     73.1     1.4 3.1E-05   33.5   0.6   25  153-177    37-61  (128)
 69 COG4049 Uncharacterized protei  71.9     1.3 2.8E-05   28.7   0.1   29  148-176    11-39  (65)
 70 PF06524 NOA36:  NOA36 protein;  70.0     5.3 0.00012   34.3   3.3   83   94-180   139-235 (314)
 71 smart00614 ZnF_BED BED zinc fi  69.1     3.7   8E-05   25.8   1.8   25   96-120    17-47  (50)
 72 TIGR00622 ssl1 transcription f  68.8      10 0.00022   28.4   4.3   78   95-179    13-106 (112)
 73 PRK04860 hypothetical protein;  65.3     3.1 6.6E-05   33.3   1.0   26  153-182   118-143 (160)
 74 PF05443 ROS_MUCR:  ROS/MUCR tr  64.8       2 4.4E-05   33.2  -0.1   27  153-182    71-97  (132)
 75 PF13717 zinc_ribbon_4:  zinc-r  64.0     4.3 9.3E-05   23.8   1.2   14  152-165    23-36  (36)
 76 COG1198 PriA Primosomal protei  63.5     5.3 0.00012   39.6   2.4   15  149-163   470-484 (730)
 77 PF10571 UPF0547:  Uncharacteri  63.4     6.4 0.00014   21.4   1.7   10  156-165    16-25  (26)
 78 KOG0696 Serine/threonine prote  61.8     4.2 9.1E-05   37.7   1.3   58   94-162    70-129 (683)
 79 PRK00398 rpoP DNA-directed RNA  61.6       4 8.6E-05   25.2   0.8   11  154-164    21-31  (46)
 80 smart00531 TFIIE Transcription  61.4     4.7  0.0001   31.6   1.4   37  122-165    98-134 (147)
 81 KOG4124 Putative transcription  60.7     2.4 5.3E-05   37.8  -0.4   69   95-173   347-417 (442)
 82 KOG4167 Predicted DNA-binding   60.1     1.4   3E-05   42.9  -2.1   29  153-181   791-819 (907)
 83 TIGR00280 L37a ribosomal prote  60.0     8.8 0.00019   27.6   2.4   34  122-168    34-67  (91)
 84 PF13719 zinc_ribbon_5:  zinc-r  60.0     4.8  0.0001   23.7   0.9   15  151-165    22-36  (37)
 85 COG3677 Transposase and inacti  59.0      13 0.00029   28.4   3.5   45  114-166    21-65  (129)
 86 PF05443 ROS_MUCR:  ROS/MUCR tr  58.8     6.7 0.00014   30.3   1.8   25   94-121    69-93  (132)
 87 PHA00626 hypothetical protein   58.5     7.8 0.00017   25.2   1.7   14  153-166    22-35  (59)
 88 COG4530 Uncharacterized protei  58.1     5.3 0.00012   29.7   1.1   16  151-166    23-38  (129)
 89 PF09723 Zn-ribbon_8:  Zinc rib  57.9     3.9 8.5E-05   24.8   0.3   12   98-109     6-17  (42)
 90 PRK03976 rpl37ae 50S ribosomal  57.4      10 0.00022   27.3   2.4   34  122-168    35-68  (90)
 91 COG4957 Predicted transcriptio  57.2     5.2 0.00011   30.9   0.9   26  155-183    77-102 (148)
 92 PRK06266 transcription initiat  57.0     8.2 0.00018   31.3   2.1   31  123-165   117-147 (178)
 93 TIGR00373 conserved hypothetic  56.9     8.5 0.00018   30.6   2.2   31  122-164   108-138 (158)
 94 cd00729 rubredoxin_SM Rubredox  56.3     5.4 0.00012   23.1   0.7   10  153-162    17-26  (34)
 95 smart00734 ZnF_Rad18 Rad18-lik  56.2       6 0.00013   21.4   0.8   20  155-175     2-21  (26)
 96 KOG2186 Cell growth-regulating  55.7     4.1 8.9E-05   34.8   0.2   37   98-135     4-41  (276)
 97 PTZ00255 60S ribosomal protein  55.6     6.7 0.00015   28.1   1.2   34  122-168    35-68  (90)
 98 TIGR02605 CxxC_CxxC_SSSS putat  52.9     5.2 0.00011   25.2   0.3   13   97-109     5-17  (52)
 99 PF08790 zf-LYAR:  LYAR-type C2  50.0     5.5 0.00012   22.1   0.0   21  155-176     1-21  (28)
100 PF12013 DUF3505:  Protein of u  49.7     7.6 0.00017   28.6   0.8   81   95-179     9-109 (109)
101 KOG2186 Cell growth-regulating  49.2     6.5 0.00014   33.6   0.4   49  124-178     4-52  (276)
102 PF09845 DUF2072:  Zn-ribbon co  48.2     8.5 0.00018   29.6   0.8   15  154-168     1-15  (131)
103 TIGR02098 MJ0042_CXXC MJ0042 f  47.9     7.7 0.00017   22.7   0.5   12  154-165    25-36  (38)
104 KOG3408 U1-like Zn-finger-cont  47.3     8.2 0.00018   29.2   0.6   26  151-176    54-79  (129)
105 TIGR01206 lysW lysine biosynth  47.1      15 0.00032   23.7   1.7   11  154-164    22-32  (54)
106 KOG2785 C2H2-type Zn-finger pr  46.1     5.8 0.00013   35.9  -0.4   79   97-175     3-89  (390)
107 smart00659 RPOLCX RNA polymera  45.8      12 0.00026   23.1   1.1    9  154-162    19-27  (44)
108 PF07754 DUF1610:  Domain of un  44.6      24 0.00051   18.8   2.0   10  153-162    15-24  (24)
109 COG1592 Rubrerythrin [Energy p  44.4      13 0.00027   30.0   1.3   23  123-161   134-156 (166)
110 PRK09678 DNA-binding transcrip  44.1      13 0.00028   25.6   1.1   20  151-170    24-45  (72)
111 KOG2482 Predicted C2H2-type Zn  42.8      20 0.00042   32.2   2.3   24   97-120   195-218 (423)
112 PF01363 FYVE:  FYVE zinc finge  42.4      13 0.00028   24.8   0.9   13  153-165    24-36  (69)
113 PF04959 ARS2:  Arsenite-resist  42.2      29 0.00062   29.1   3.2   28   94-121    74-101 (214)
114 smart00834 CxxC_CXXC_SSSS Puta  42.0      12 0.00026   22.0   0.7   15  154-168     5-19  (41)
115 COG1327 Predicted transcriptio  40.9      18  0.0004   28.5   1.7   15  153-167    27-41  (156)
116 TIGR00244 transcriptional regu  40.6      23 0.00051   27.8   2.2   18  153-170    27-44  (147)
117 PRK06266 transcription initiat  40.4     5.9 0.00013   32.2  -1.1   29   97-132   117-145 (178)
118 COG1996 RPC10 DNA-directed RNA  40.1      12 0.00025   23.8   0.4   13   95-107     4-16  (49)
119 PF01780 Ribosomal_L37ae:  Ribo  40.1     8.3 0.00018   27.7  -0.3   33  122-167    34-66  (90)
120 KOG2231 Predicted E3 ubiquitin  39.9      14 0.00031   36.1   1.1   69   98-175   183-260 (669)
121 KOG2071 mRNA cleavage and poly  39.8      14  0.0003   35.4   1.0   28   94-121   415-442 (579)
122 COG3364 Zn-ribbon containing p  39.1      16 0.00035   26.8   1.1   14  154-167     2-15  (112)
123 cd00065 FYVE FYVE domain; Zinc  38.5      22 0.00048   22.5   1.6   12  154-165    18-29  (57)
124 KOG2071 mRNA cleavage and poly  38.4      14 0.00031   35.4   0.9   30  152-181   416-445 (579)
125 smart00154 ZnF_AN1 AN1-like Zi  38.3      16 0.00036   21.7   0.9   14  154-167    12-25  (39)
126 KOG4173 Alpha-SNAP protein [In  38.1     5.1 0.00011   33.2  -1.8   80   95-178    77-171 (253)
127 PF12013 DUF3505:  Protein of u  37.0      32 0.00069   25.2   2.5   26   96-121    79-108 (109)
128 KOG2932 E3 ubiquitin ligase in  37.0      37  0.0008   30.1   3.1   26  151-176   141-169 (389)
129 PF10013 DUF2256:  Uncharacteri  36.6      24 0.00052   21.5   1.3   14  156-169    10-23  (42)
130 KOG3408 U1-like Zn-finger-cont  36.5      24 0.00053   26.7   1.7   27   93-119    53-79  (129)
131 PF01286 XPA_N:  XPA protein N-  36.3      17 0.00036   21.2   0.6   10  126-135     6-15  (34)
132 PF09986 DUF2225:  Uncharacteri  36.1      12 0.00027   31.2   0.1   25  152-176     3-27  (214)
133 COG1773 Rubredoxin [Energy pro  36.1      18 0.00038   23.5   0.8   13   97-109     3-15  (55)
134 COG2888 Predicted Zn-ribbon RN  35.3      35 0.00076   22.5   2.1   11  152-162    48-58  (61)
135 smart00661 RPOL9 RNA polymeras  35.3      27 0.00059   21.6   1.6   16  154-169    20-35  (52)
136 KOG2785 C2H2-type Zn-finger pr  35.0      12 0.00025   34.0  -0.3   72   95-175   164-241 (390)
137 COG5151 SSL1 RNA polymerase II  33.3      37 0.00081   30.1   2.6   28  153-180   387-414 (421)
138 COG3357 Predicted transcriptio  33.3      29 0.00063   24.9   1.6   14  122-135    57-70  (97)
139 KOG2893 Zn finger protein [Gen  33.2     9.8 0.00021   32.3  -0.9   28   94-121    31-59  (341)
140 PF04959 ARS2:  Arsenite-resist  32.9      12 0.00027   31.3  -0.4   30  151-180    74-103 (214)
141 PF13878 zf-C2H2_3:  zinc-finge  31.9      40 0.00087   20.3   1.8   24   98-121    14-39  (41)
142 PF03811 Zn_Tnp_IS1:  InsA N-te  31.6      49  0.0011   19.4   2.1   18  143-160    18-35  (36)
143 PF01428 zf-AN1:  AN1-like Zinc  31.5      18  0.0004   21.9   0.3   15  153-167    12-26  (43)
144 cd00924 Cyt_c_Oxidase_Vb Cytoc  31.3      22 0.00049   25.9   0.8   20  146-166    72-91  (97)
145 PF15269 zf-C2H2_7:  Zinc-finge  30.7      40 0.00087   20.9   1.7   25   96-120    19-43  (54)
146 KOG2593 Transcription initiati  30.3      20 0.00044   33.0   0.5   36  122-163   127-162 (436)
147 smart00064 FYVE Protein presen  30.2      34 0.00075   22.5   1.5   10   99-108    12-21  (68)
148 KOG2636 Splicing factor 3a, su  29.8      29 0.00063   32.2   1.4   27  148-174   395-422 (497)
149 PF09332 Mcm10:  Mcm10 replicat  29.3      14 0.00029   33.4  -0.8   18   96-113   251-268 (344)
150 PF03604 DNA_RNApol_7kD:  DNA d  29.1      21 0.00045   20.4   0.2   10  154-163    17-26  (32)
151 PF13451 zf-trcl:  Probable zin  28.5      26 0.00057   22.2   0.6   16  152-167     2-17  (49)
152 KOG2593 Transcription initiati  28.3      28 0.00061   32.1   1.0   16   97-112   128-143 (436)
153 PLN02294 cytochrome c oxidase   27.8      31 0.00066   27.8   1.0   16  152-167   139-154 (174)
154 PHA02998 RNA polymerase subuni  27.1      49  0.0011   26.9   2.1   31   30-60     69-100 (195)
155 PF15135 UPF0515:  Uncharacteri  27.0      51  0.0011   28.3   2.3   61   94-170   109-171 (278)
156 PF07282 OrfB_Zn_ribbon:  Putat  26.8      49  0.0011   21.9   1.8   16  151-166    43-58  (69)
157 KOG0978 E3 ubiquitin ligase in  26.5      58  0.0013   32.2   2.9   21  153-173   677-697 (698)
158 PRK14873 primosome assembly pr  26.0      31 0.00068   34.0   1.0   11  153-163   421-431 (665)
159 COG1571 Predicted DNA-binding   25.8      46   0.001   30.8   2.0   30  125-168   352-381 (421)
160 COG5112 UFD2 U1-like Zn-finger  25.6      22 0.00047   26.3  -0.1   25  151-175    52-76  (126)
161 PF00301 Rubredoxin:  Rubredoxi  25.4      41  0.0009   21.0   1.1   14   97-110     1-14  (47)
162 COG3091 SprT Zn-dependent meta  25.4      31 0.00067   27.3   0.7   14   94-108   114-127 (156)
163 PF10276 zf-CHCC:  Zinc-finger   25.3      31 0.00068   20.8   0.5   12  153-164    28-39  (40)
164 KOG0717 Molecular chaperone (D  25.0      48   0.001   31.0   1.9   22   98-119   293-314 (508)
165 smart00440 ZnF_C2C2 C2C2 Zinc   24.9      41 0.00089   20.1   1.0   12  154-165    28-39  (40)
166 KOG2482 Predicted C2H2-type Zn  24.2      33 0.00072   30.8   0.7   31  154-184   195-227 (423)
167 PF04810 zf-Sec23_Sec24:  Sec23  24.2      44 0.00096   19.9   1.1   17  148-164    18-34  (40)
168 PF13240 zinc_ribbon_2:  zinc-r  24.2      62  0.0013   16.8   1.5    7  157-163    16-22  (23)
169 PF07975 C1_4:  TFIIH C1-like d  24.0      34 0.00073   21.8   0.5   27  153-179    20-46  (51)
170 PF14446 Prok-RING_1:  Prokaryo  23.6      57  0.0012   21.1   1.5   12  155-166    22-33  (54)
171 TIGR00100 hypA hydrogenase nic  23.3      42  0.0009   25.1   1.0   19   43-61     39-57  (115)
172 PRK12380 hydrogenase nickel in  23.1      40 0.00087   25.1   0.9   21   42-62     38-58  (113)
173 COG0068 HypF Hydrogenase matur  22.8      17 0.00037   35.7  -1.4   54  100-163   126-182 (750)
174 PF11931 DUF3449:  Domain of un  22.7      28 0.00061   28.7   0.0   23  152-174    99-122 (196)
175 PRK03824 hypA hydrogenase nick  22.4      33 0.00071   26.5   0.3   47   41-110    37-83  (135)
176 PF14311 DUF4379:  Domain of un  22.4      78  0.0017   20.0   2.0   17   95-111    26-42  (55)
177 PRK04023 DNA polymerase II lar  21.7      58  0.0013   33.5   1.9   11   96-106   625-635 (1121)
178 COG5188 PRP9 Splicing factor 3  21.1      50  0.0011   29.8   1.2   27  148-174   368-395 (470)
179 KOG2636 Splicing factor 3a, su  20.7      51  0.0011   30.7   1.2   24   95-118   399-423 (497)
180 cd00730 rubredoxin Rubredoxin;  20.7      38 0.00082   21.4   0.3   12   98-109     2-13  (50)
181 PRK14873 primosome assembly pr  20.6      63  0.0014   31.9   1.9   15  149-163   405-419 (665)
182 PF12760 Zn_Tnp_IS1595:  Transp  20.5 2.1E+02  0.0046   17.3   4.1   29  122-162    17-45  (46)
183 PRK12496 hypothetical protein;  20.5      57  0.0012   26.0   1.3    8  156-163   145-152 (164)
184 PF04423 Rad50_zn_hook:  Rad50   20.4      37 0.00081   21.5   0.2   12  156-167    22-33  (54)
185 PF11787 Aft1_HRR:  Aft1 HRR do  20.0      77  0.0017   22.0   1.7   14   46-59     63-76  (76)
186 PF10083 DUF2321:  Uncharacteri  20.0      77  0.0017   25.2   1.9   19  151-169    65-83  (158)

No 1  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.81  E-value=7.2e-21  Score=159.83  Aligned_cols=87  Identities=23%  Similarity=0.300  Sum_probs=81.1

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhhcc
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGGHK  174 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~  174 (244)
                      .+-+.|++|+|.|.+-.+|+.|+++|+-++.|.+||+.|.+.+.|   +-|+|+|+|||||.|.+|+|+|+..++|+.||
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLL---QGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLL---QGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHh---hcccccccCCCCccCCcccchhcchHHHHHHH
Confidence            566888899999999999999999999999999999999999999   99999999999999999999999999999999


Q ss_pred             cccccccCCC
Q 038669          175 RCHYDGGEKS  184 (244)
Q Consensus       175 r~H~~~~~~~  184 (244)
                      ++|.+.+.-.
T Consensus       236 QTHS~~K~~q  245 (279)
T KOG2462|consen  236 QTHSDVKKHQ  245 (279)
T ss_pred             HhhcCCcccc
Confidence            9999887543


No 2  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.67  E-value=6.9e-18  Score=141.93  Aligned_cols=82  Identities=26%  Similarity=0.368  Sum_probs=77.6

Q ss_pred             CCCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhH
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQAL  170 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L  170 (244)
                      +...+++|.+|||.|....-|++|+|+||  |||.|..|++.|..+.+|   +.|+.+|.+.|+|+|..|+|.|...+.|
T Consensus       183 TH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNL---RAHmQTHS~~K~~qC~~C~KsFsl~SyL  259 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNL---RAHMQTHSDVKKHQCPRCGKSFALKSYL  259 (279)
T ss_pred             ccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHH---HHHHHhhcCCccccCcchhhHHHHHHHH
Confidence            45578999999999999999999999999  999999999999999999   9999999999999999999999999999


Q ss_pred             hhccccc
Q 038669          171 GGHKRCH  177 (244)
Q Consensus       171 ~~H~r~H  177 (244)
                      .+|...-
T Consensus       260 nKH~ES~  266 (279)
T KOG2462|consen  260 NKHSESA  266 (279)
T ss_pred             HHhhhhc
Confidence            9997643


No 3  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.55  E-value=4.9e-16  Score=144.47  Aligned_cols=83  Identities=20%  Similarity=0.321  Sum_probs=78.9

Q ss_pred             CCCCCCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCc
Q 038669           90 SSSDQKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTG  167 (244)
Q Consensus        90 ~~~~~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~  167 (244)
                      ...+...+|.|+.|+|.|.-.+.|.+|+--|+  +||.|.+|.+.|..+.+|   ..|+|.|.|||||+|..|+|.|...
T Consensus       887 ~~kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHL---tEHkRLHSGEKPfQCdKClKRFSHS  963 (1007)
T KOG3623|consen  887 HAKTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHL---TEHKRLHSGEKPFQCDKCLKRFSHS  963 (1007)
T ss_pred             cccCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhh---hhhhhhccCCCcchhhhhhhhcccc
Confidence            44567789999999999999999999999999  899999999999999999   9999999999999999999999999


Q ss_pred             hhHhhccc
Q 038669          168 QALGGHKR  175 (244)
Q Consensus       168 ~~L~~H~r  175 (244)
                      +.+.+||-
T Consensus       964 GSYSQHMN  971 (1007)
T KOG3623|consen  964 GSYSQHMN  971 (1007)
T ss_pred             cchHhhhc
Confidence            99999985


No 4  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.52  E-value=2.4e-15  Score=121.26  Aligned_cols=84  Identities=26%  Similarity=0.349  Sum_probs=77.8

Q ss_pred             CCCCCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669           91 SSDQKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus        91 ~~~~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      +..+...|.|.+|+|.|....-|.+|+..|.  +.+-|..|++.|.....|   ++|+|+|+|.|||+|..|+|+|.+..
T Consensus       111 sssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdl---krh~rthtgvrpykc~~c~kaftqrc  187 (267)
T KOG3576|consen  111 SSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDL---KRHTRTHTGVRPYKCSLCEKAFTQRC  187 (267)
T ss_pred             CCCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhh---hhhhccccCccccchhhhhHHHHhhc
Confidence            3445678999999999999999999999999  889999999999999999   99999999999999999999999999


Q ss_pred             hHhhccc-cc
Q 038669          169 ALGGHKR-CH  177 (244)
Q Consensus       169 ~L~~H~r-~H  177 (244)
                      .|..|.+ +|
T Consensus       188 sleshl~kvh  197 (267)
T KOG3576|consen  188 SLESHLKKVH  197 (267)
T ss_pred             cHHHHHHHHc
Confidence            9999975 45


No 5  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.46  E-value=7.9e-15  Score=138.44  Aligned_cols=54  Identities=17%  Similarity=0.163  Sum_probs=43.6

Q ss_pred             CCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhhcccccccccC
Q 038669          126 GGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGGHKRCHYDGGE  182 (244)
Q Consensus       126 c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~~~  182 (244)
                      |-+|.+.......|   +.|.|+|+|||||+|.+||++|.++.+|+.|+-+|.-..+
T Consensus       608 CiiC~rVlSC~saL---qmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~  661 (958)
T KOG1074|consen  608 CIICLRVLSCPSAL---QMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP  661 (958)
T ss_pred             eeeeeecccchhhh---hhhhhcccCcCccccccccchhccccchhhcccccccCcc
Confidence            44444444444444   8899999999999999999999999999999999976644


No 6  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.35  E-value=2.1e-13  Score=127.14  Aligned_cols=80  Identities=18%  Similarity=0.282  Sum_probs=73.8

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhc---------------CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcc
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHR---------------KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSI  159 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~---------------k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~  159 (244)
                      +..|.|..|.++|.++..|.+||.+|.               +.|.|.+|++.|..+.+|   +.|+|+|.|||||+|+.
T Consensus       238 e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHL---KEHlRIHSGEKPfeCpn  314 (1007)
T KOG3623|consen  238 EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHL---KEHLRIHSGEKPFECPN  314 (1007)
T ss_pred             CCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHH---HhhheeecCCCCcCCcc
Confidence            445889999999999999999999986               468999999999999999   99999999999999999


Q ss_pred             cccccCCchhHhhccccc
Q 038669          160 CHKSFPTGQALGGHKRCH  177 (244)
Q Consensus       160 Cgk~F~~~~~L~~H~r~H  177 (244)
                      |+|.|...+.+..||-.-
T Consensus       315 CkKRFSHSGSySSHmSSK  332 (1007)
T KOG3623|consen  315 CKKRFSHSGSYSSHMSSK  332 (1007)
T ss_pred             cccccccCCccccccccc
Confidence            999999999999998543


No 7  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=98.96  E-value=8.9e-10  Score=104.79  Aligned_cols=84  Identities=24%  Similarity=0.290  Sum_probs=77.8

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCccccccccccCCC----CceeCc---cccccc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGVPNATG----RTHECS---ICHKSF  164 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~e----kp~~C~---~Cgk~F  164 (244)
                      ...|.+|-+|-++....++|+.|.|+|+  +||+|.+|++.|..+.+|   +.|+.+|...    -+|.|+   +|.+.|
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNL---kaH~~vHka~p~~R~q~ScP~~~ic~~kf  678 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNL---KAHMSVHKAKPPARVQFSCPSTFICQKKF  678 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccch---hhcccccccCccccccccCCchhhhcccc
Confidence            4568999999999999999999999999  999999999999999999   9999999764    358899   999999


Q ss_pred             CCchhHhhcccccccc
Q 038669          165 PTGQALGGHKRCHYDG  180 (244)
Q Consensus       165 ~~~~~L~~H~r~H~~~  180 (244)
                      ...-.|.+|+|+|.+.
T Consensus       679 tn~V~lpQhIriH~~~  694 (958)
T KOG1074|consen  679 TNAVTLPQHIRIHLGG  694 (958)
T ss_pred             cccccccceEEeecCC
Confidence            9999999999999955


No 8  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=98.89  E-value=1.3e-10  Score=94.14  Aligned_cols=85  Identities=15%  Similarity=0.119  Sum_probs=73.5

Q ss_pred             CCCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCcccccccc-ccC----------CCCceeCcc
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGV-PNA----------TGRTHECSI  159 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r-~h~----------~ekp~~C~~  159 (244)
                      ...+.|-|..|||.|.....|++|+|+|+  +||.|..|++.|.+.-.|   ..|.+ +|.          ..|-|.|+.
T Consensus       141 ~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsl---eshl~kvhgv~~~yaykerr~kl~vced  217 (267)
T KOG3576|consen  141 SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSL---ESHLKKVHGVQHQYAYKERRAKLYVCED  217 (267)
T ss_pred             cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccH---HHHHHHHcCchHHHHHHHhhhheeeecc
Confidence            34577889999999999999999999999  899999999999999888   66765 443          247799999


Q ss_pred             cccccCCchhHhhcccccccc
Q 038669          160 CHKSFPTGQALGGHKRCHYDG  180 (244)
Q Consensus       160 Cgk~F~~~~~L~~H~r~H~~~  180 (244)
                      ||..-.....+..|++.|+-.
T Consensus       218 cg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  218 CGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             cCCCCCChhHHHHHHHhcCCC
Confidence            999999999999999888654


No 9  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=98.89  E-value=2.8e-10  Score=98.93  Aligned_cols=82  Identities=18%  Similarity=0.273  Sum_probs=75.4

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCcccccccc-ccCCCCceeCcccccccCCchhHhhc
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGV-PNATGRTHECSICHKSFPTGQALGGH  173 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r-~h~~ekp~~C~~Cgk~F~~~~~L~~H  173 (244)
                      ..+|+|..|.|.|.+...|+.|+..|..-|.|+.|.........|   ..|++ .|+..|||+|..|.+.|.+.+.|.+|
T Consensus       235 ~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL---~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  235 TNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSL---TTHIRYRHSKDKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             CCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHH---HHHHHhhhccCCCccccchhhhhccHHHHHHH
Confidence            357999999999999999999999999999999999999888888   99998 78889999999999999999999999


Q ss_pred             cccccc
Q 038669          174 KRCHYD  179 (244)
Q Consensus       174 ~r~H~~  179 (244)
                      ..+|..
T Consensus       312 ~~~HS~  317 (467)
T KOG3608|consen  312 VQVHSK  317 (467)
T ss_pred             HHhccc
Confidence            988874


No 10 
>PHA00733 hypothetical protein
Probab=98.86  E-value=4.7e-10  Score=86.43  Aligned_cols=81  Identities=11%  Similarity=0.009  Sum_probs=67.9

Q ss_pred             CCceeEeccccccccCHHHHHHh--H----HHhc-CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCC
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGH--K----ASHR-KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPT  166 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H--~----~~H~-k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~  166 (244)
                      .++++.|.+|.+.|.....|..|  +    ..|. ++|.|..|++.|.....|   ..|++.|  +.+|.|.+|++.|..
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L---~~H~r~h--~~~~~C~~CgK~F~~  111 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSL---KQHIRYT--EHSKVCPVCGKEFRN  111 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHH---HHHHhcC--CcCccCCCCCCccCC
Confidence            56889999999999888777766  2    2232 799999999999999988   8898876  467999999999999


Q ss_pred             chhHhhccccccc
Q 038669          167 GQALGGHKRCHYD  179 (244)
Q Consensus       167 ~~~L~~H~r~H~~  179 (244)
                      ...|..|++.+++
T Consensus       112 ~~sL~~H~~~~h~  124 (128)
T PHA00733        112 TDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHHhcC
Confidence            9999999876543


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=98.85  E-value=1.8e-09  Score=69.96  Aligned_cols=42  Identities=14%  Similarity=0.293  Sum_probs=32.5

Q ss_pred             eeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCC
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNT  138 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~  138 (244)
                      -|+|+.||+.|...++|..|+++|++++.|..|++.|...+.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHNTNLKLSNCKRISLRTGE   46 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcCCcccCCcccceecccce
Confidence            389999999999999999999999765555555555554443


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=98.57  E-value=7.3e-09  Score=67.10  Aligned_cols=44  Identities=9%  Similarity=-0.125  Sum_probs=36.5

Q ss_pred             CCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHh
Q 038669          123 GSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALG  171 (244)
Q Consensus       123 ~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~  171 (244)
                      .|.|+.|++.|.....|   ..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L---~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSM---ITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHH---HHHHHhcC--CcccCCcccceecccceeE
Confidence            46888888888888888   88888887  6888888888888777664


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.52  E-value=6.4e-08  Score=90.73  Aligned_cols=77  Identities=13%  Similarity=0.181  Sum_probs=65.6

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCC--------
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPT--------  166 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~--------  166 (244)
                      ++.+.|..|++.|. ...|..|+.+|++++.|. |+..+ ....|   ..|+.+|..+|++.|.+|++.|..        
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L---~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~  524 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFHEPLQCP-CGVVL-EKEQM---VQHQASTCPLRLITCRFCGDMVQAGGSAMDVR  524 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcCCCccCC-CCCCc-chhHH---HhhhhccCCCCceeCCCCCCccccCccccchh
Confidence            45678999999996 678999999988999999 99755 45677   889999999999999999999953        


Q ss_pred             --chhHhhccccc
Q 038669          167 --GQALGGHKRCH  177 (244)
Q Consensus       167 --~~~L~~H~r~H  177 (244)
                        ...|..|..++
T Consensus       525 d~~s~Lt~HE~~C  537 (567)
T PLN03086        525 DRLRGMSEHESIC  537 (567)
T ss_pred             hhhhhHHHHHHhc
Confidence              34788998876


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.40  E-value=3e-08  Score=54.87  Aligned_cols=24  Identities=21%  Similarity=0.420  Sum_probs=21.0

Q ss_pred             cccccccCCCCceeCcccccccCC
Q 038669          143 TTTGVPNATGRTHECSICHKSFPT  166 (244)
Q Consensus       143 ~~H~r~h~~ekp~~C~~Cgk~F~~  166 (244)
                      ..|+++|+++|||.|++|++.|.+
T Consensus         3 ~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    3 RRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHHhhhcCCCCCCCCCCCcCeeCc
Confidence            667788889999999999999964


No 15 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.37  E-value=4.2e-08  Score=87.36  Aligned_cols=81  Identities=15%  Similarity=0.229  Sum_probs=66.2

Q ss_pred             eeEeccccccccCHHHHHHhH--HHhcCCCCCCCCCCCCCCCCCCccccccccccC--------C---------------
Q 038669           97 VFKCSVCDKAFSSYQALGGHK--ASHRKGSGGGDEHSASTTTNTNATATTTGVPNA--------T---------------  151 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~--~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~--------~---------------  151 (244)
                      -|.|..|...|.....|.+|+  ++-+-.|.|.+|++.|....+|   ..|.|.|.        +               
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANL---ASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~  343 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANL---ASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQ  343 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhh---hhhhcccCCchhhhhcCCCChhhhhhhhhhhh
Confidence            388999999998888888887  3334788999999999988888   77777763        1               


Q ss_pred             ----------CCceeCcccccccCCchhHhhcccccccc
Q 038669          152 ----------GRTHECSICHKSFPTGQALGGHKRCHYDG  180 (244)
Q Consensus       152 ----------ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~  180 (244)
                                +-.|.|.+|+|.|.+...|++|+-+|..-
T Consensus       344 ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  344 EAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             hccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence                      12599999999999999999998888754


No 16 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=98.37  E-value=6.1e-08  Score=84.62  Aligned_cols=86  Identities=19%  Similarity=0.232  Sum_probs=70.1

Q ss_pred             CCCCCceeEeccccccccCHHHHHHhHHHhc-CCCCCCC--CCCCCCCCCCCccccccccccC-C--CCceeCccccccc
Q 038669           91 SSDQKLVFKCSVCDKAFSSYQALGGHKASHR-KGSGGGD--EHSASTTTNTNATATTTGVPNA-T--GRTHECSICHKSF  164 (244)
Q Consensus        91 ~~~~~~p~~C~~C~k~F~~~~~L~~H~~~H~-k~~~c~~--c~~~f~~~~~l~~~~~H~r~h~-~--ekp~~C~~Cgk~F  164 (244)
                      .++..+||+|+.|++.|...+.|..|..+|. -.|.|..  |...|.....+   .+|++.+. |  +-+|.|..|.+.|
T Consensus       286 rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~---~~H~~evhEg~np~~Y~CH~Cdr~f  362 (467)
T KOG3608|consen  286 RHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQM---RRHFLEVHEGNNPILYACHCCDRFF  362 (467)
T ss_pred             hhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHH---HHHHHHhccCCCCCceeeecchhhh
Confidence            3567899999999999999999999999999 5688876  77777766666   78887443 4  4679999999999


Q ss_pred             CCchhHhhccccccc
Q 038669          165 PTGQALGGHKRCHYD  179 (244)
Q Consensus       165 ~~~~~L~~H~r~H~~  179 (244)
                      .++.+|..|++.-++
T Consensus       363 t~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  363 TSGKSLSAHLMKKHG  377 (467)
T ss_pred             ccchhHHHHHHHhhc
Confidence            999999999754443


No 17 
>PHA00733 hypothetical protein
Probab=98.17  E-value=7.3e-07  Score=68.70  Aligned_cols=53  Identities=15%  Similarity=0.107  Sum_probs=47.4

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCcccccccccc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPN  149 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h  149 (244)
                      +.+||.|..|++.|.....|..|++.|..+|.|..|++.|.....|   ..|+...
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL---~~H~~~~  122 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDST---LDHVCKK  122 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHH---HHHHHHh
Confidence            4689999999999999999999999888889999999999998888   7776643


No 18 
>PHA00732 hypothetical protein
Probab=98.02  E-value=3.9e-06  Score=59.10  Aligned_cols=38  Identities=18%  Similarity=0.258  Sum_probs=28.4

Q ss_pred             eeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCC
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSAST  134 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~  134 (244)
                      ||.|..|++.|....+|..|++.+..++.|..|++.|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~   38 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYR   38 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeC
Confidence            58899999999999999999885333345555555554


No 19 
>PHA00616 hypothetical protein
Probab=97.98  E-value=1.4e-06  Score=53.87  Aligned_cols=29  Identities=14%  Similarity=0.173  Sum_probs=26.6

Q ss_pred             ceeCcccccccCCchhHhhcccccccccC
Q 038669          154 THECSICHKSFPTGQALGGHKRCHYDGGE  182 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~L~~H~r~H~~~~~  182 (244)
                      ||+|..||+.|...+.|..|++.|+++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            68999999999999999999999998865


No 20 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.85  E-value=1.6e-05  Score=42.30  Aligned_cols=23  Identities=43%  Similarity=0.870  Sum_probs=21.8

Q ss_pred             eEeccccccccCHHHHHHhHHHh
Q 038669           98 FKCSVCDKAFSSYQALGGHKASH  120 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H  120 (244)
                      |+|.+|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            79999999999999999999876


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.84  E-value=3.9e-06  Score=44.71  Aligned_cols=23  Identities=43%  Similarity=0.769  Sum_probs=21.7

Q ss_pred             eeCcccccccCCchhHhhccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCH  177 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H  177 (244)
                      |.|.+|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999875


No 22 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.84  E-value=7.2e-06  Score=77.16  Aligned_cols=72  Identities=15%  Similarity=0.168  Sum_probs=59.0

Q ss_pred             ceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCC----------CCCccccccccccCCCCceeCcccccc
Q 038669           96 LVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTT----------NTNATATTTGVPNATGRTHECSICHKS  163 (244)
Q Consensus        96 ~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~----------~~l~~~~~H~r~h~~ekp~~C~~Cgk~  163 (244)
                      ++|.|. |++.| .+..|..|+.+|.  +++.|..|+..|...          ..|   ..|..++ |.+++.|..||+.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~L---t~HE~~C-G~rt~~C~~Cgk~  550 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGM---SEHESIC-GSRTAPCDSCGRS  550 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhH---HHHHHhc-CCcceEccccCCe
Confidence            679999 99766 6689999999988  899999999988521          245   7888886 8999999999999


Q ss_pred             cCCchhHhhcc
Q 038669          164 FPTGQALGGHK  174 (244)
Q Consensus       164 F~~~~~L~~H~  174 (244)
                      |... .|..|+
T Consensus       551 Vrlr-dm~~H~  560 (567)
T PLN03086        551 VMLK-EMDIHQ  560 (567)
T ss_pred             eeeh-hHHHHH
Confidence            9765 566775


No 23 
>PHA00616 hypothetical protein
Probab=97.76  E-value=1.2e-05  Score=49.74  Aligned_cols=25  Identities=20%  Similarity=0.422  Sum_probs=23.4

Q ss_pred             eeEeccccccccCHHHHHHhHHHhc
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      ||+|..||+.|...+.|..|++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h   25 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH   25 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc
Confidence            6899999999999999999999887


No 24 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.74  E-value=1.9e-05  Score=68.31  Aligned_cols=71  Identities=20%  Similarity=0.424  Sum_probs=47.8

Q ss_pred             CCceeEecc--ccccccCHHHHHHhHHH-hcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhH
Q 038669           94 QKLVFKCSV--CDKAFSSYQALGGHKAS-HRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQAL  170 (244)
Q Consensus        94 ~~~p~~C~~--C~k~F~~~~~L~~H~~~-H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L  170 (244)
                      ++|||+|.+  |.|.|+..-.|+-|+.- |..+..-.        ...-   ..|..--...|||.|++|+|.+..-.-|
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~--------~p~p---~~~~~F~~~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHE--------NPSP---EKMNIFSAKDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCC--------CCCc---cccccccccCCceeccccchhhccCccc
Confidence            359999997  99999999999999754 32111000        0000   1111112256999999999999999999


Q ss_pred             hhccc
Q 038669          171 GGHKR  175 (244)
Q Consensus       171 ~~H~r  175 (244)
                      +.|+.
T Consensus       415 KYHr~  419 (423)
T COG5189         415 KYHRK  419 (423)
T ss_pred             eeccc
Confidence            88864


No 25 
>PHA00732 hypothetical protein
Probab=97.71  E-value=1.2e-05  Score=56.60  Aligned_cols=47  Identities=17%  Similarity=0.177  Sum_probs=38.2

Q ss_pred             CCCCCCCCCCCCCCCCCccccccccc-cCCCCceeCcccccccCCchhHhhcccccc
Q 038669          123 GSGGGDEHSASTTTNTNATATTTGVP-NATGRTHECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       123 ~~~c~~c~~~f~~~~~l~~~~~H~r~-h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      +|.|..|++.|.....|   ..|++. |.   ++.|+.|++.|.   .|..|.+++.
T Consensus         1 py~C~~Cgk~F~s~s~L---k~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFAL---KQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHH---HHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            57899999999998888   899884 65   368999999997   5777876553


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.61  E-value=2.1e-05  Score=43.49  Aligned_cols=26  Identities=42%  Similarity=0.731  Sum_probs=24.2

Q ss_pred             ceeCcccccccCCchhHhhccccccc
Q 038669          154 THECSICHKSFPTGQALGGHKRCHYD  179 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~L~~H~r~H~~  179 (244)
                      ||+|..|++.|....+|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999999864


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.39  E-value=9.2e-05  Score=40.87  Aligned_cols=25  Identities=52%  Similarity=0.836  Sum_probs=23.2

Q ss_pred             eeEeccccccccCHHHHHHhHHHhc
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      +|+|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6999999999999999999998874


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.38  E-value=5.4e-05  Score=40.16  Aligned_cols=24  Identities=42%  Similarity=0.754  Sum_probs=20.2

Q ss_pred             eeCcccccccCCchhHhhcccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      |.|++|++.|.+...|..|+++|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999998763


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.37  E-value=0.00019  Score=37.98  Aligned_cols=24  Identities=38%  Similarity=0.841  Sum_probs=20.3

Q ss_pred             eEeccccccccCHHHHHHhHHHhc
Q 038669           98 FKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      |.|.+|++.|.+...|..|++.|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999998873


No 30 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=97.30  E-value=5.8e-05  Score=41.54  Aligned_cols=21  Identities=19%  Similarity=-0.005  Sum_probs=12.2

Q ss_pred             HHHhHHHhc--CCCCCCCCCCCC
Q 038669          113 LGGHKASHR--KGSGGGDEHSAS  133 (244)
Q Consensus       113 L~~H~~~H~--k~~~c~~c~~~f  133 (244)
                      |..|+++|+  ++|.|..|++.|
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEE
T ss_pred             HHHHhhhcCCCCCCCCCCCcCee
Confidence            555666665  555666665554


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.24  E-value=0.00011  Score=53.32  Aligned_cols=72  Identities=24%  Similarity=0.379  Sum_probs=21.9

Q ss_pred             EeccccccccCHHHHHHhHHHhcC-CCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhhccccc
Q 038669           99 KCSVCDKAFSSYQALGGHKASHRK-GSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGGHKRCH  177 (244)
Q Consensus        99 ~C~~C~k~F~~~~~L~~H~~~H~k-~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H  177 (244)
                      +|..|+..|.....|..|+....+ ....   ...+.....+   ..+.+.. -...+.|.+|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~---~~~l~~~~~~---~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPD---QKYLVDPNRL---LNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccccc---cccccccccc---ccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            599999999999999999865441 1110   0001111111   1222211 123699999999999999999999865


No 32 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.21  E-value=0.00031  Score=45.69  Aligned_cols=52  Identities=23%  Similarity=0.423  Sum_probs=36.9

Q ss_pred             eeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhhcccc
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      .|.|++|++. .+...|..|......                        .   ..+.+.|++|...+.  .+|..|++.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~------------------------~---~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHR------------------------S---ESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCc------------------------C---CCCCccCCCchhhhh--hHHHHHHHH
Confidence            4889999994 556789999655320                        0   234688999998655  489999876


Q ss_pred             cc
Q 038669          177 HY  178 (244)
Q Consensus       177 H~  178 (244)
                      ++
T Consensus        52 ~H   53 (54)
T PF05605_consen   52 QH   53 (54)
T ss_pred             hc
Confidence            54


No 33 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=97.08  E-value=0.00053  Score=61.70  Aligned_cols=135  Identities=17%  Similarity=0.278  Sum_probs=76.9

Q ss_pred             CCChHHHHHHHHHHHhcCCCCCccccCCCC-CCcCcCCC--CCCCCCCCCCCCCCCCCceeEeccccccccCHHHHHHhH
Q 038669           41 PPTEEEYLALCLVMLARGTTSTAALTNCNT-TTTASQRQ--KSPAPSTAATTSSSDQKLVFKCSVCDKAFSSYQALGGHK  117 (244)
Q Consensus        41 ~~s~ee~~a~cl~~ls~~~~~~~~~~~~~~-~~~~~~~~--~~~~~~~~~~~~~~~~~~p~~C~~C~k~F~~~~~L~~H~  117 (244)
                      .+.|.+.+.+|-.-|+..+++...-..... .......+  ..........+.+.....-|.|.+|+|.|.....|+.|+
T Consensus       297 rCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  297 RCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             cCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhH
Confidence            446888899999999888876432211110 00000000  000000000122223445899999999999999999999


Q ss_pred             HHhc-----CC-----C--------------------------------------CCCCCCCCCCCCCCCcccccccccc
Q 038669          118 ASHR-----KG-----S--------------------------------------GGGDEHSASTTTNTNATATTTGVPN  149 (244)
Q Consensus       118 ~~H~-----k~-----~--------------------------------------~c~~c~~~f~~~~~l~~~~~H~r~h  149 (244)
                      .+|.     +.     +                                      .|..|+..+..+..-   ..+.+.-
T Consensus       377 lthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~s---gg~~rlg  453 (500)
T KOG3993|consen  377 LTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSS---GGYGRLG  453 (500)
T ss_pred             HhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCC---Ccccccc
Confidence            8887     11     1                                      122333333333222   3333333


Q ss_pred             CCCCceeCcccccccCCchhHhhcc-cccc
Q 038669          150 ATGRTHECSICHKSFPTGQALGGHK-RCHY  178 (244)
Q Consensus       150 ~~ekp~~C~~Cgk~F~~~~~L~~H~-r~H~  178 (244)
                      ..+.-|.|.+|.-.|.....|.+|+ +.|-
T Consensus       454 ~~~q~f~~ky~~atfyss~~ltrhin~~Hp  483 (500)
T KOG3993|consen  454 IAEQGFTCKYCPATFYSSPGLTRHINKCHP  483 (500)
T ss_pred             chhhccccccchHhhhcCcchHhHhhhcCh
Confidence            3456688999999999999999986 4453


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.93  E-value=0.00031  Score=37.67  Aligned_cols=24  Identities=38%  Similarity=0.641  Sum_probs=22.1

Q ss_pred             eeCcccccccCCchhHhhcccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      |+|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            689999999999999999999775


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.73  E-value=0.00098  Score=35.62  Aligned_cols=24  Identities=38%  Similarity=0.775  Sum_probs=22.0

Q ss_pred             eEeccccccccCHHHHHHhHHHhc
Q 038669           98 FKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      |+|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            679999999999999999999874


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.67  E-value=0.00079  Score=42.69  Aligned_cols=32  Identities=16%  Similarity=0.253  Sum_probs=23.5

Q ss_pred             CCCceeCcccccccCCchhHhhcccccccccC
Q 038669          151 TGRTHECSICHKSFPTGQALGGHKRCHYDGGE  182 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~~~  182 (244)
                      .+.|..|++|+..+.+..+|.+|+.++++.++
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            46899999999999999999999988877665


No 37 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.45  E-value=0.0021  Score=34.60  Aligned_cols=23  Identities=43%  Similarity=0.820  Sum_probs=21.3

Q ss_pred             eEeccccccccCHHHHHHhHHHh
Q 038669           98 FKCSVCDKAFSSYQALGGHKASH  120 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H  120 (244)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            78999999999999999999765


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.09  E-value=0.0021  Score=34.61  Aligned_cols=23  Identities=39%  Similarity=0.761  Sum_probs=21.2

Q ss_pred             eeCcccccccCCchhHhhccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCH  177 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H  177 (244)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999865


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=95.85  E-value=0.0056  Score=48.91  Aligned_cols=40  Identities=15%  Similarity=0.438  Sum_probs=27.9

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCc
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTG  167 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~  167 (244)
                      .-+|.|. |++   ....+.+|.++|+                             ++++|.|..|++.|...
T Consensus       117 ~~~Y~C~-C~~---~~~~~rrH~ri~~-----------------------------g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        117 TFPYRCK-CQE---HQLTVRRHNRVVR-----------------------------GEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEEcC-CCC---eeCHHHHHHHHhc-----------------------------CCccEECCCCCceeEEe
Confidence            3679998 987   4555666766664                             66778888887777543


No 40 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.82  E-value=0.0048  Score=33.96  Aligned_cols=23  Identities=26%  Similarity=0.582  Sum_probs=21.1

Q ss_pred             eeCcccccccCCchhHhhccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCH  177 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H  177 (244)
                      |.|..|++.|.+...|..|++.+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCcccCCCCcCCHHHHHHHHccC
Confidence            78999999999999999999764


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.77  E-value=0.015  Score=36.97  Aligned_cols=29  Identities=14%  Similarity=0.330  Sum_probs=21.1

Q ss_pred             CCCceeEeccccccccCHHHHHHhHHHhc
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      ..+.|..|++|+..+.+..+|.+|+.+++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHh
Confidence            35789999999999999999999997765


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.98  E-value=0.0077  Score=32.05  Aligned_cols=23  Identities=26%  Similarity=0.395  Sum_probs=18.6

Q ss_pred             eeCcccccccCCchhHhhcccccc
Q 038669          155 HECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      |+|..|..... ...|..|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            78999999998 889999998864


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.92  E-value=0.028  Score=29.79  Aligned_cols=22  Identities=32%  Similarity=0.579  Sum_probs=18.2

Q ss_pred             eEeccccccccCHHHHHHhHHHh
Q 038669           98 FKCSVCDKAFSSYQALGGHKASH  120 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H  120 (244)
                      |+|..|+.... ...|..|++.|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            79999999998 89999999886


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.88  E-value=0.007  Score=33.29  Aligned_cols=22  Identities=50%  Similarity=0.783  Sum_probs=20.1

Q ss_pred             eEeccccccccCHHHHHHhHHH
Q 038669           98 FKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      |-|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999865


No 45 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=94.12  E-value=0.018  Score=48.33  Aligned_cols=20  Identities=25%  Similarity=0.527  Sum_probs=14.7

Q ss_pred             EeccccccccCHHHHHHhHH
Q 038669           99 KCSVCDKAFSSYQALGGHKA  118 (244)
Q Consensus        99 ~C~~C~k~F~~~~~L~~H~~  118 (244)
                      -|=+|++.|....-|.+|++
T Consensus        12 wcwycnrefddekiliqhqk   31 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK   31 (341)
T ss_pred             eeeecccccchhhhhhhhhh
Confidence            37788888888777776654


No 46 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.56  E-value=0.059  Score=48.43  Aligned_cols=59  Identities=15%  Similarity=0.159  Sum_probs=50.9

Q ss_pred             CCCCCCCCCCCCCCCCCcccccccc--ccCCC--CceeCc--ccccccCCchhHhhcccccccccCCC
Q 038669          123 GSGGGDEHSASTTTNTNATATTTGV--PNATG--RTHECS--ICHKSFPTGQALGGHKRCHYDGGEKS  184 (244)
Q Consensus       123 ~~~c~~c~~~f~~~~~l~~~~~H~r--~h~~e--kp~~C~--~Cgk~F~~~~~L~~H~r~H~~~~~~~  184 (244)
                      .+.|..|...|.....+   ..|.+  .|.++  ++|.|.  .|++.|.+...+..|..+|++.....
T Consensus       289 ~~~~~~~~~~~s~~~~l---~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (467)
T COG5048         289 PIKSKQCNISFSRSSPL---TRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAK  353 (467)
T ss_pred             CCCCccccCCccccccc---cccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccc
Confidence            56778888888888888   88888  79999  999999  79999999999999999998876543


No 47 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=93.49  E-value=0.038  Score=56.49  Aligned_cols=73  Identities=22%  Similarity=0.291  Sum_probs=50.6

Q ss_pred             CCCceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccc------cCCCCceeCcccccccCC
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVP------NATGRTHECSICHKSFPT  166 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~------h~~ekp~~C~~Cgk~F~~  166 (244)
                      +-.+.|+|..|+..|.....|..|||+-+-.+.-..|...          +.|.+.      -.+.++|.|..|...|..
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~g----------q~~~~~arg~~~~~~~~p~~C~~C~~sttt  530 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAG----------QNHPRLARGEVYRCPGKPYPCRACNYSTTT  530 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhc----------cccccccccccccCCCCcccceeeeeeeec
Confidence            3457799999999999999999999884411111222100          122221      124589999999999999


Q ss_pred             chhHhhccc
Q 038669          167 GQALGGHKR  175 (244)
Q Consensus       167 ~~~L~~H~r  175 (244)
                      +.+|.+|+.
T Consensus       531 ng~Lsihlq  539 (1406)
T KOG1146|consen  531 NGNLSIHLQ  539 (1406)
T ss_pred             chHHHHHHH
Confidence            999999985


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=93.14  E-value=0.038  Score=29.90  Aligned_cols=21  Identities=29%  Similarity=0.689  Sum_probs=17.4

Q ss_pred             eeCcccccccCCchhHhhcccc
Q 038669          155 HECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      ..|..||+.| ....|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4699999999 67889999754


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.08  E-value=0.11  Score=29.94  Aligned_cols=23  Identities=22%  Similarity=0.559  Sum_probs=20.6

Q ss_pred             eeEeccccccccCHHHHHHhHHH
Q 038669           97 VFKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      +|.|.+|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58999999999999999999854


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.55  E-value=0.15  Score=27.49  Aligned_cols=21  Identities=24%  Similarity=0.645  Sum_probs=17.0

Q ss_pred             eEeccccccccCHHHHHHhHHH
Q 038669           98 FKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      ..|..||+.| ....|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 56678888764


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=90.99  E-value=0.13  Score=29.74  Aligned_cols=23  Identities=17%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             ceeCcccccccCCchhHhhcccc
Q 038669          154 THECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      +|.|.+|++.|....++..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999999753


No 52 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=89.84  E-value=0.11  Score=50.14  Aligned_cols=32  Identities=25%  Similarity=0.389  Sum_probs=23.3

Q ss_pred             eEecccccccc---------------CHHHHHHhHHHhcCCCCCCCC
Q 038669           98 FKCSVCDKAFS---------------SYQALGGHKASHRKGSGGGDE  129 (244)
Q Consensus        98 ~~C~~C~k~F~---------------~~~~L~~H~~~H~k~~~c~~c  129 (244)
                      +.|.+|++.|.               +...|+.|++..++-+.|..|
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~~~c~lC  146 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKLHLCSLC  146 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhhhccccc
Confidence            56889988874               678899999655555655555


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=89.55  E-value=0.32  Score=34.66  Aligned_cols=25  Identities=40%  Similarity=0.772  Sum_probs=22.2

Q ss_pred             eeEeccccccccCHHHHHHhHHHhc
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      .+.|.+|++.|.+...|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6999999999999999999999763


No 54 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.85  E-value=0.54  Score=35.02  Aligned_cols=30  Identities=13%  Similarity=0.151  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCc
Q 038669          124 SGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTG  167 (244)
Q Consensus       124 ~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~  167 (244)
                      +.|..|++.|--   |           +..|-.|++||..|.-.
T Consensus        10 R~Cp~CG~kFYD---L-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C-----------CCCCccCCCCCCccCcc
Confidence            356666666633   3           34788899999999776


No 55 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=84.77  E-value=0.29  Score=50.37  Aligned_cols=33  Identities=21%  Similarity=0.264  Sum_probs=25.7

Q ss_pred             cccccCCCCceeCcccccccCCchhHhhcccccc
Q 038669          145 TGVPNATGRTHECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       145 H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      |...+..-+.| |.+|...|.....|..|||+-.
T Consensus      1320 ~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1320 PPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             CcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence            33344444667 9999999999999999998643


No 56 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=82.59  E-value=0.35  Score=40.50  Aligned_cols=22  Identities=27%  Similarity=0.628  Sum_probs=15.3

Q ss_pred             CceeEeccccccccCHHHHHHh
Q 038669           95 KLVFKCSVCDKAFSSYQALGGH  116 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H  116 (244)
                      ++.+.|++|++.|....-..+.
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~   24 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGK   24 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCC
Confidence            3567899999999876544333


No 57 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=82.24  E-value=0.63  Score=40.93  Aligned_cols=25  Identities=28%  Similarity=0.725  Sum_probs=21.0

Q ss_pred             CCCceeEeccccccccCHHHHHHhH
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHK  117 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~  117 (244)
                      ...|||+|++|+|.|+..-.|+-|+
T Consensus       394 ~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         394 AKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             ccCCceeccccchhhccCccceecc
Confidence            3569999999999998888888774


No 58 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=80.55  E-value=1.1  Score=29.10  Aligned_cols=29  Identities=17%  Similarity=0.369  Sum_probs=24.8

Q ss_pred             CCCCCceeEeccccccccCHHHHHHhHHH
Q 038669           91 SSDQKLVFKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        91 ~~~~~~p~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      +-.||.-++|+.|+..|.....+.+|...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            34588899999999999999999999753


No 59 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=78.08  E-value=1.1  Score=43.64  Aligned_cols=28  Identities=29%  Similarity=0.603  Sum_probs=25.2

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      ...-|.|..|+|+|.-...+..||++|.
T Consensus       789 ~~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  789 PTGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CCceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3466999999999999999999999997


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=78.04  E-value=0.92  Score=40.62  Aligned_cols=70  Identities=13%  Similarity=0.076  Sum_probs=58.3

Q ss_pred             ceeEeccccccccCHHHHHHhHH--Hhc-C---CCCCC--CCCCCCCCCCCCccccccccccCCCCceeCcc--cccccC
Q 038669           96 LVFKCSVCDKAFSSYQALGGHKA--SHR-K---GSGGG--DEHSASTTTNTNATATTTGVPNATGRTHECSI--CHKSFP  165 (244)
Q Consensus        96 ~p~~C~~C~k~F~~~~~L~~H~~--~H~-k---~~~c~--~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~--Cgk~F~  165 (244)
                      .++.|..|...|.....|..|.+  .|. .   ++.|.  .|++.|.....+   ..|...|.+.+++.|..  |.+.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~  364 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDAL---KRHILLHTSISPAKEKLLNSSSKFS  364 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccc---cCCcccccCCCccccccccCccccc
Confidence            57999999999999999999999  787 3   67788  799999999988   99999999988888865  445554


Q ss_pred             Cch
Q 038669          166 TGQ  168 (244)
Q Consensus       166 ~~~  168 (244)
                      ...
T Consensus       365 ~~~  367 (467)
T COG5048         365 PLL  367 (467)
T ss_pred             ccc
Confidence            433


No 61 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=77.59  E-value=1.6  Score=27.99  Aligned_cols=26  Identities=23%  Similarity=0.368  Sum_probs=19.5

Q ss_pred             ceeCcccccccCCchhHhhcccc-cccc
Q 038669          154 THECSICHKSFPTGQALGGHKRC-HYDG  180 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~L~~H~r~-H~~~  180 (244)
                      -|.|++|++. .+...|..|... |..+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~   28 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSE   28 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCC
Confidence            4899999995 456789999654 5444


No 62 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=77.38  E-value=1.8  Score=38.65  Aligned_cols=78  Identities=18%  Similarity=0.196  Sum_probs=50.6

Q ss_pred             eEecc--ccccccCHHHHHHhHHHhcCCCCCCCCC---CCCCCC------CCCccccccccccCCC---Cc-eeCccccc
Q 038669           98 FKCSV--CDKAFSSYQALGGHKASHRKGSGGGDEH---SASTTT------NTNATATTTGVPNATG---RT-HECSICHK  162 (244)
Q Consensus        98 ~~C~~--C~k~F~~~~~L~~H~~~H~k~~~c~~c~---~~f~~~------~~l~~~~~H~r~h~~e---kp-~~C~~Cgk  162 (244)
                      |.|+.  |..+......|+.|..+.+..+-|.+|-   +.|...      ..|   ..|...-..+   |- -.|.+|.+
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~L---r~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTL---RDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccc---cccccCCccccCcCCCchhhhccc
Confidence            77874  7666666788999988776667777773   334332      223   4444332222   21 25999999


Q ss_pred             ccCCchhHhhcccccc
Q 038669          163 SFPTGQALGGHKRCHY  178 (244)
Q Consensus       163 ~F~~~~~L~~H~r~H~  178 (244)
                      .|-....|.+|+|-.+
T Consensus       229 ~FYdDDEL~~HcR~~H  244 (493)
T COG5236         229 YFYDDDELRRHCRLRH  244 (493)
T ss_pred             eecChHHHHHHHHhhh
Confidence            9999999988877433


No 63 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=76.11  E-value=2.1  Score=32.65  Aligned_cols=21  Identities=24%  Similarity=0.347  Sum_probs=15.2

Q ss_pred             CCCceeCcccccccCCchhHh
Q 038669          151 TGRTHECSICHKSFPTGQALG  171 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~L~  171 (244)
                      +..|-.|++||..|.....+.
T Consensus        23 nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        23 NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             CCCCccCCCcCCccCcchhhc
Confidence            346888999999887664444


No 64 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=74.55  E-value=3.1  Score=25.27  Aligned_cols=25  Identities=28%  Similarity=0.390  Sum_probs=16.6

Q ss_pred             CCceeEeccccccccCH----HHHHHhHH
Q 038669           94 QKLVFKCSVCDKAFSSY----QALGGHKA  118 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~----~~L~~H~~  118 (244)
                      +..-.+|..|++.+...    .+|..|++
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            45668999999998774    78889983


No 65 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=74.53  E-value=2.3  Score=24.42  Aligned_cols=11  Identities=27%  Similarity=0.999  Sum_probs=6.5

Q ss_pred             eEecccccccc
Q 038669           98 FKCSVCDKAFS  108 (244)
Q Consensus        98 ~~C~~C~k~F~  108 (244)
                      |+|.+||..+.
T Consensus         2 ~~C~~CGy~y~   12 (33)
T cd00350           2 YVCPVCGYIYD   12 (33)
T ss_pred             EECCCCCCEEC
Confidence            56666665543


No 66 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.81  E-value=3.5  Score=29.33  Aligned_cols=34  Identities=12%  Similarity=0.078  Sum_probs=24.5

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      ..|.|+.|++.-           +.|+-  -..+.|..||..|+-..
T Consensus        34 ~~~~Cp~C~~~~-----------VkR~a--~GIW~C~kCg~~fAGga   67 (89)
T COG1997          34 AKHVCPFCGRTT-----------VKRIA--TGIWKCRKCGAKFAGGA   67 (89)
T ss_pred             cCCcCCCCCCcc-----------eeeec--cCeEEcCCCCCeecccc
Confidence            678999998752           23332  35699999999998654


No 67 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=73.51  E-value=2  Score=34.07  Aligned_cols=19  Identities=37%  Similarity=0.648  Sum_probs=13.7

Q ss_pred             CceeCcccccccCCchhHh
Q 038669          153 RTHECSICHKSFPTGQALG  171 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~  171 (244)
                      +.|+|..||+.|...-.+.
T Consensus        27 ~~~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         27 RRRECLACGKRFTTFERVE   45 (154)
T ss_pred             eeeeccccCCcceEeEecc
Confidence            3488999999997754443


No 68 
>PF14353 CpXC:  CpXC protein
Probab=73.14  E-value=1.4  Score=33.51  Aligned_cols=25  Identities=20%  Similarity=0.274  Sum_probs=19.1

Q ss_pred             CceeCcccccccCCchhHhhccccc
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCH  177 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H  177 (244)
                      --|.|+.||+.|.-...+..|-..|
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~~   61 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPEK   61 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCCC
Confidence            3589999999998877777765433


No 69 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=71.94  E-value=1.3  Score=28.73  Aligned_cols=29  Identities=14%  Similarity=0.159  Sum_probs=24.4

Q ss_pred             ccCCCCceeCcccccccCCchhHhhcccc
Q 038669          148 PNATGRTHECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       148 ~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      ...||.-+.|+-||+.|...-.+.+|...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            44577889999999999999999999743


No 70 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=70.02  E-value=5.3  Score=34.30  Aligned_cols=83  Identities=19%  Similarity=0.258  Sum_probs=50.4

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc----CCCCCCCCCCCCCCCC------CCccccccccc----cCCCCceeCcc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR----KGSGGGDEHSASTTTN------TNATATTTGVP----NATGRTHECSI  159 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~----k~~~c~~c~~~f~~~~------~l~~~~~H~r~----h~~ekp~~C~~  159 (244)
                      |.+.|+|..|...+-....+ .|+++-.    ..|.|..|++.-..+-      .-   ..|.+.    ....+++.|+.
T Consensus       139 GGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfC---ddHvrrKg~ky~k~k~~PCPK  214 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFC---DDHVRRKGFKYEKGKPIPCPK  214 (314)
T ss_pred             CCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeeh---hhhhhhcccccccCCCCCCCC
Confidence            67899999998655433333 4554432    5666665554322110      00   112221    12348899999


Q ss_pred             cccccCCchhHhhcccccccc
Q 038669          160 CHKSFPTGQALGGHKRCHYDG  180 (244)
Q Consensus       160 Cgk~F~~~~~L~~H~r~H~~~  180 (244)
                      ||.-......|..-.|+|.-+
T Consensus       215 Cg~et~eTkdLSmStR~hkyG  235 (314)
T PF06524_consen  215 CGYETQETKDLSMSTRSHKYG  235 (314)
T ss_pred             CCCcccccccceeeeecchhc
Confidence            999998888888888888633


No 71 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=69.09  E-value=3.7  Score=25.81  Aligned_cols=25  Identities=32%  Similarity=0.476  Sum_probs=19.6

Q ss_pred             ceeEeccccccccCH-----HHHHHhHH-Hh
Q 038669           96 LVFKCSVCDKAFSSY-----QALGGHKA-SH  120 (244)
Q Consensus        96 ~p~~C~~C~k~F~~~-----~~L~~H~~-~H  120 (244)
                      .--.|..|++.+...     ++|.+|++ .|
T Consensus        17 ~~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       17 QRAKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             eEEEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            456899999999765     68888887 45


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=68.76  E-value=10  Score=28.38  Aligned_cols=78  Identities=14%  Similarity=0.167  Sum_probs=51.8

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhc----CCC------------CCCCCCCCCCCCCCCccccccccccCCCCceeCc
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHR----KGS------------GGGDEHSASTTTNTNATATTTGVPNATGRTHECS  158 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~----k~~------------~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~  158 (244)
                      +.|-.|.+||-..-+...|.+.  -|+    ++|            .|-.|...|......   ..-.  -.....|+|.
T Consensus        13 ~LP~~CpiCgLtLVss~HLARS--yHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~---~~~~--~~~~~~y~C~   85 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARS--YHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVS---PFDE--LKDSHRYVCA   85 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHh--hhccCCCcccccccccccCCCCcccCcCCCCCCcccc---cccc--cccccceeCC
Confidence            4678899999888777777643  233    333            266677777653221   0000  1123469999


Q ss_pred             ccccccCCchhHhhccccccc
Q 038669          159 ICHKSFPTGQALGGHKRCHYD  179 (244)
Q Consensus       159 ~Cgk~F~~~~~L~~H~r~H~~  179 (244)
                      .|...|--.-+.-.|...|.-
T Consensus        86 ~C~~~FC~dCD~fiHe~Lh~C  106 (112)
T TIGR00622        86 VCKNVFCVDCDVFVHESLHCC  106 (112)
T ss_pred             CCCCccccccchhhhhhccCC
Confidence            999999999999999888863


No 73 
>PRK04860 hypothetical protein; Provisional
Probab=65.33  E-value=3.1  Score=33.27  Aligned_cols=26  Identities=15%  Similarity=0.305  Sum_probs=22.4

Q ss_pred             CceeCcccccccCCchhHhhcccccccccC
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCHYDGGE  182 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H~~~~~  182 (244)
                      -+|.|. |++   ....+.+|.++|++++.
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~  143 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV  143 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc
Confidence            379998 998   77889999999999874


No 74 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=64.84  E-value=2  Score=33.17  Aligned_cols=27  Identities=33%  Similarity=0.369  Sum_probs=17.1

Q ss_pred             CceeCcccccccCCchhHhhcccccccccC
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCHYDGGE  182 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H~~~~~  182 (244)
                      .-..|-+|||.|..   |.+|++.|+|-.+
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCCH
Confidence            44689999999965   5999999987655


No 75 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=64.04  E-value=4.3  Score=23.82  Aligned_cols=14  Identities=43%  Similarity=0.816  Sum_probs=10.7

Q ss_pred             CCceeCcccccccC
Q 038669          152 GRTHECSICHKSFP  165 (244)
Q Consensus       152 ekp~~C~~Cgk~F~  165 (244)
                      .+..+|..|+..|.
T Consensus        23 g~~v~C~~C~~~f~   36 (36)
T PF13717_consen   23 GRKVRCSKCGHVFF   36 (36)
T ss_pred             CcEEECCCCCCEeC
Confidence            45678999988873


No 76 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=63.55  E-value=5.3  Score=39.56  Aligned_cols=15  Identities=13%  Similarity=0.344  Sum_probs=10.6

Q ss_pred             cCCCCceeCcccccc
Q 038669          149 NATGRTHECSICHKS  163 (244)
Q Consensus       149 h~~ekp~~C~~Cgk~  163 (244)
                      |....|+.|+.||-.
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            334578889999854


No 77 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=63.43  E-value=6.4  Score=21.39  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=7.9

Q ss_pred             eCcccccccC
Q 038669          156 ECSICHKSFP  165 (244)
Q Consensus       156 ~C~~Cgk~F~  165 (244)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5888888884


No 78 
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=61.75  E-value=4.2  Score=37.65  Aligned_cols=58  Identities=19%  Similarity=0.285  Sum_probs=40.6

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc-CCCCCCCCCCCCCCCCCCccccccc-cccCCCCceeCccccc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR-KGSGGGDEHSASTTTNTNATATTTG-VPNATGRTHECSICHK  162 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~-k~~~c~~c~~~f~~~~~l~~~~~H~-r~h~~ekp~~C~~Cgk  162 (244)
                      |+.-|+|.+|.        +..|++.|. ..|.|+.-++.+..-..-   ..|. ++|+-.-|--|.+||-
T Consensus        70 gKQGfQCqvC~--------fvvHkrChefVtF~CPGadkg~dtDdpr---~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   70 GKQGFQCQVCC--------FVVHKRCHEFVTFSCPGADKGPDTDDPR---SKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             ccCceeeeEEe--------ehhhhhhcceEEEECCCCCCCCCCCCcc---cccceeeeecCCCchhhhHHH
Confidence            55669999996        457999998 778888777766554433   4443 4677667777888863


No 79 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=61.64  E-value=4  Score=25.19  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=6.9

Q ss_pred             ceeCccccccc
Q 038669          154 THECSICHKSF  164 (244)
Q Consensus       154 p~~C~~Cgk~F  164 (244)
                      .+.|+.||..+
T Consensus        21 ~~~Cp~CG~~~   31 (46)
T PRK00398         21 GVRCPYCGYRI   31 (46)
T ss_pred             ceECCCCCCeE
Confidence            46777776544


No 80 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=61.40  E-value=4.7  Score=31.56  Aligned_cols=37  Identities=16%  Similarity=0.141  Sum_probs=21.5

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccC
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFP  165 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~  165 (244)
                      ..|.|+.|+..|.....+   ..   .+. ..-|.|+.||....
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~---~~---~d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       98 AYYKCPNCQSKYTFLEAN---QL---LDM-DGTFTCPRCGEELE  134 (147)
T ss_pred             cEEECcCCCCEeeHHHHH---Hh---cCC-CCcEECCCCCCEEE
Confidence            456788888777653222   11   011 23399999987653


No 81 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=60.74  E-value=2.4  Score=37.82  Aligned_cols=69  Identities=25%  Similarity=0.394  Sum_probs=37.3

Q ss_pred             CceeEecc--ccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhh
Q 038669           95 KLVFKCSV--CDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGG  172 (244)
Q Consensus        95 ~~p~~C~~--C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~  172 (244)
                      .++|+|.+  |.+.+...-.|+.|...-+       |...-.....-   .-|..--...|+|.|++|.+.+..-..|.-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h-------~s~i~~~s~~~---~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGH-------CSPITTPTPAP---IPHQGFVVENKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCc-------CCCCCCCCCCC---CCcceeeeccCcccChhhhhhhccCCCCCc
Confidence            46678865  8888777666666643211       11000000000   122222224599999999998877655554


Q ss_pred             c
Q 038669          173 H  173 (244)
Q Consensus       173 H  173 (244)
                      |
T Consensus       417 ~  417 (442)
T KOG4124|consen  417 H  417 (442)
T ss_pred             e
Confidence            4


No 82 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=60.14  E-value=1.4  Score=42.94  Aligned_cols=29  Identities=21%  Similarity=0.334  Sum_probs=26.0

Q ss_pred             CceeCcccccccCCchhHhhccccccccc
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCHYDGG  181 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H~~~~  181 (244)
                      -.|-|..|+|.|-.--.++.||++|....
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q~  819 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQE  819 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            46999999999999999999999998654


No 83 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=60.00  E-value=8.8  Score=27.61  Aligned_cols=34  Identities=12%  Similarity=0.118  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      ..|.|+.|++.-....             +.-.++|..|++.|+-..
T Consensus        34 a~y~CpfCgk~~vkR~-------------a~GIW~C~~C~~~~AGGA   67 (91)
T TIGR00280        34 AKYVCPFCGKKTVKRG-------------STGIWTCRKCGAKFAGGA   67 (91)
T ss_pred             cCccCCCCCCCceEEE-------------eeEEEEcCCCCCEEeCCc
Confidence            6789999986432211             224699999999997653


No 84 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=59.98  E-value=4.8  Score=23.70  Aligned_cols=15  Identities=33%  Similarity=0.762  Sum_probs=11.3

Q ss_pred             CCCceeCcccccccC
Q 038669          151 TGRTHECSICHKSFP  165 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~  165 (244)
                      +.+..+|..|+..|.
T Consensus        22 ~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   22 GGRKVRCPKCGHVFR   36 (37)
T ss_pred             CCcEEECCCCCcEee
Confidence            345688999988874


No 85 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=59.02  E-value=13  Score=28.45  Aligned_cols=45  Identities=11%  Similarity=0.099  Sum_probs=26.6

Q ss_pred             HHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCC
Q 038669          114 GGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPT  166 (244)
Q Consensus       114 ~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~  166 (244)
                      ..+++.+...-.|+.|+....        ..+-..-.+...|+|..|++.|..
T Consensus        21 ~~~~~~~~~~~~cP~C~s~~~--------~k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          21 AYAIRMQITKVNCPRCKSSNV--------VKIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             HHHHhhhcccCcCCCCCccce--------eeECCccccccccccCCcCcceee
Confidence            345555555556777765441        111112223567999999999974


No 86 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=58.78  E-value=6.7  Score=30.30  Aligned_cols=25  Identities=28%  Similarity=0.494  Sum_probs=16.6

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      .+.--.|-+|||.|..   |++|++.|.
T Consensus        69 ~~d~i~clecGk~~k~---LkrHL~~~~   93 (132)
T PF05443_consen   69 TPDYIICLECGKKFKT---LKRHLRTHH   93 (132)
T ss_dssp             -SS-EE-TBT--EESB---HHHHHHHTT
T ss_pred             ccCeeEEccCCcccch---HHHHHHHcc
Confidence            3455789999999976   689999994


No 87 
>PHA00626 hypothetical protein
Probab=58.51  E-value=7.8  Score=25.20  Aligned_cols=14  Identities=14%  Similarity=0.199  Sum_probs=11.7

Q ss_pred             CceeCcccccccCC
Q 038669          153 RTHECSICHKSFPT  166 (244)
Q Consensus       153 kp~~C~~Cgk~F~~  166 (244)
                      ..|+|..||..|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            56999999998865


No 88 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.09  E-value=5.3  Score=29.68  Aligned_cols=16  Identities=19%  Similarity=0.231  Sum_probs=13.0

Q ss_pred             CCCceeCcccccccCC
Q 038669          151 TGRTHECSICHKSFPT  166 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~  166 (244)
                      ...|..|++||++|..
T Consensus        23 NrdPiVsPytG~s~P~   38 (129)
T COG4530          23 NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             CCCccccCcccccchH
Confidence            3478999999999954


No 89 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=57.92  E-value=3.9  Score=24.81  Aligned_cols=12  Identities=25%  Similarity=0.999  Sum_probs=7.1

Q ss_pred             eEeccccccccC
Q 038669           98 FKCSVCDKAFSS  109 (244)
Q Consensus        98 ~~C~~C~k~F~~  109 (244)
                      |+|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            666666666543


No 90 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=57.39  E-value=10  Score=27.27  Aligned_cols=34  Identities=15%  Similarity=0.126  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      ..|.|+.|++.-....             +.-.+.|..|++.|+-..
T Consensus        35 a~y~CpfCgk~~vkR~-------------a~GIW~C~~C~~~~AGGA   68 (90)
T PRK03976         35 AKHVCPVCGRPKVKRV-------------GTGIWECRKCGAKFAGGA   68 (90)
T ss_pred             cCccCCCCCCCceEEE-------------EEEEEEcCCCCCEEeCCc
Confidence            6789999975432211             224699999999997643


No 91 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=57.16  E-value=5.2  Score=30.86  Aligned_cols=26  Identities=27%  Similarity=0.277  Sum_probs=22.2

Q ss_pred             eeCcccccccCCchhHhhcccccccccCC
Q 038669          155 HECSICHKSFPTGQALGGHKRCHYDGGEK  183 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~H~~~~~~  183 (244)
                      ..|-+|||.|.   .|++|+++|++-.+.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTPd  102 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTPD  102 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCHH
Confidence            47999999995   699999999987764


No 92 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=57.03  E-value=8.2  Score=31.35  Aligned_cols=31  Identities=13%  Similarity=0.011  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccC
Q 038669          123 GSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFP  165 (244)
Q Consensus       123 ~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~  165 (244)
                      -|.|+.|+..|..-..+            +--|.|+.||....
T Consensus       117 ~Y~Cp~C~~rytf~eA~------------~~~F~Cp~Cg~~L~  147 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM------------EYGFRCPQCGEMLE  147 (178)
T ss_pred             EEECCCCCcEEeHHHHh------------hcCCcCCCCCCCCe
Confidence            45677776666554333            12477888876543


No 93 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=56.85  E-value=8.5  Score=30.58  Aligned_cols=31  Identities=10%  Similarity=-0.060  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCccccccc
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSF  164 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F  164 (244)
                      .-|.|+.|+..|..-..+            +--|.|+.||...
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~------------~~~F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAM------------ELNFTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHH------------HcCCcCCCCCCEe
Confidence            345666666665553333            1247777777554


No 94 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=56.35  E-value=5.4  Score=23.08  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=6.4

Q ss_pred             CceeCccccc
Q 038669          153 RTHECSICHK  162 (244)
Q Consensus       153 kp~~C~~Cgk  162 (244)
                      .|..|++||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4566777764


No 95 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=56.19  E-value=6  Score=21.43  Aligned_cols=20  Identities=15%  Similarity=0.586  Sum_probs=15.5

Q ss_pred             eeCcccccccCCchhHhhccc
Q 038669          155 HECSICHKSFPTGQALGGHKR  175 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r  175 (244)
                      ..|++|++.+ ....++.|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3699999998 5577788865


No 96 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=55.73  E-value=4.1  Score=34.80  Aligned_cols=37  Identities=19%  Similarity=0.247  Sum_probs=22.9

Q ss_pred             eEeccccccccCHHHHHHhHHHhc-CCCCCCCCCCCCCC
Q 038669           98 FKCSVCDKAFSSYQALGGHKASHR-KGSGGGDEHSASTT  135 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H~-k~~~c~~c~~~f~~  135 (244)
                      |.|.+||....-. .|..|+..-+ .-|.|-.|++.|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRNAYFSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccCCeeEEeeccccccc
Confidence            7899999776543 4566765443 44555555555554


No 97 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=55.61  E-value=6.7  Score=28.15  Aligned_cols=34  Identities=12%  Similarity=0.049  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      ..|.|+.|++.-....             +.-.+.|..|++.|+-..
T Consensus        35 a~y~CpfCgk~~vkR~-------------a~GIW~C~~C~~~~AGGA   68 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQ-------------AVGIWRCKGCKKTVAGGA   68 (90)
T ss_pred             CCccCCCCCCCceeee-------------eeEEEEcCCCCCEEeCCc
Confidence            6789999986432211             235799999999997653


No 98 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=52.89  E-value=5.2  Score=25.17  Aligned_cols=13  Identities=23%  Similarity=0.943  Sum_probs=8.5

Q ss_pred             eeEeccccccccC
Q 038669           97 VFKCSVCDKAFSS  109 (244)
Q Consensus        97 p~~C~~C~k~F~~  109 (244)
                      -|+|..||..|..
T Consensus         5 ey~C~~Cg~~fe~   17 (52)
T TIGR02605         5 EYRCTACGHRFEV   17 (52)
T ss_pred             EEEeCCCCCEeEE
Confidence            3677777776653


No 99 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=49.98  E-value=5.5  Score=22.11  Aligned_cols=21  Identities=33%  Similarity=0.846  Sum_probs=13.7

Q ss_pred             eeCcccccccCCchhHhhcccc
Q 038669          155 HECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       155 ~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      |.|-.|++.| .......|...
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~C   21 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTSC   21 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT----
T ss_pred             CeeecCCCCc-CcCCcCCCCcc
Confidence            5788999999 66677777654


No 100
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=49.68  E-value=7.6  Score=28.59  Aligned_cols=81  Identities=12%  Similarity=0.073  Sum_probs=46.5

Q ss_pred             CceeEeccccccccCHHHHHHhHHH-hcCC--C----------CCC--CC-CCCCCCCCCCccccccccccCCCCceeC-
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKAS-HRKG--S----------GGG--DE-HSASTTTNTNATATTTGVPNATGRTHEC-  157 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~-H~k~--~----------~c~--~c-~~~f~~~~~l~~~~~H~r~h~~ekp~~C-  157 (244)
                      -+-..|..|+..... ..+..|++. |...  .          ...  .. ...+............+.++.   =|.| 
T Consensus         9 ~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~---G~~C~   84 (109)
T PF12013_consen    9 YRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYD---GYRCQ   84 (109)
T ss_pred             CCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCC---Ceeee
Confidence            355789999988766 778899884 3311  0          000  00 000000000000012223332   2899 


Q ss_pred             ---cccccccCCchhHhhccccccc
Q 038669          158 ---SICHKSFPTGQALGGHKRCHYD  179 (244)
Q Consensus       158 ---~~Cgk~F~~~~~L~~H~r~H~~  179 (244)
                         ..|+..+.+...+..|.+.++|
T Consensus        85 ~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   85 CDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             cCCCCCCcEeccHHHHHHHHHHhcC
Confidence               9999999999999999987764


No 101
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=49.18  E-value=6.5  Score=33.62  Aligned_cols=49  Identities=12%  Similarity=0.127  Sum_probs=35.3

Q ss_pred             CCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhHhhcccccc
Q 038669          124 SGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQALGGHKRCHY  178 (244)
Q Consensus       124 ~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L~~H~r~H~  178 (244)
                      |.|..|+..-.-.. +   .+|+....+ .-|.|-.|++.|-+ -.+..|..+-+
T Consensus         4 FtCnvCgEsvKKp~-v---ekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-V---EKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhccccc-h---HHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            56888876654432 3   567765555 67999999999988 67778877654


No 102
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=48.21  E-value=8.5  Score=29.59  Aligned_cols=15  Identities=33%  Similarity=0.972  Sum_probs=12.4

Q ss_pred             ceeCcccccccCCch
Q 038669          154 THECSICHKSFPTGQ  168 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~  168 (244)
                      ||+|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            688888999998765


No 103
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=47.86  E-value=7.7  Score=22.66  Aligned_cols=12  Identities=17%  Similarity=0.515  Sum_probs=8.9

Q ss_pred             ceeCcccccccC
Q 038669          154 THECSICHKSFP  165 (244)
Q Consensus       154 p~~C~~Cgk~F~  165 (244)
                      ...|+.|+..|.
T Consensus        25 ~v~C~~C~~~~~   36 (38)
T TIGR02098        25 KVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEE
Confidence            477888887764


No 104
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=47.30  E-value=8.2  Score=29.21  Aligned_cols=26  Identities=27%  Similarity=0.459  Sum_probs=22.7

Q ss_pred             CCCceeCcccccccCCchhHhhcccc
Q 038669          151 TGRTHECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      |.-.|-|-.|.+-|....+|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44569999999999999999999864


No 105
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=47.12  E-value=15  Score=23.74  Aligned_cols=11  Identities=18%  Similarity=0.461  Sum_probs=8.0

Q ss_pred             ceeCccccccc
Q 038669          154 THECSICHKSF  164 (244)
Q Consensus       154 p~~C~~Cgk~F  164 (244)
                      ...|+.||..|
T Consensus        22 iV~Cp~CGael   32 (54)
T TIGR01206        22 LVICDECGAEL   32 (54)
T ss_pred             EEeCCCCCCEE
Confidence            46788888665


No 106
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=46.12  E-value=5.8  Score=35.86  Aligned_cols=79  Identities=20%  Similarity=0.310  Sum_probs=45.7

Q ss_pred             eeEeccccccccCHHHHHHhHHH--hc---CC--CCCC-CCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669           97 VFKCSVCDKAFSSYQALGGHKAS--HR---KG--SGGG-DEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~--H~---k~--~~c~-~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      -|.|.-|...|.....-+.|+.+  |.   |.  +.-+ +-...|...........-...-.++-++.|.+|.|.|....
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            38999999999998777888764  54   21  1111 11111111100000000000122456799999999999999


Q ss_pred             hHhhccc
Q 038669          169 ALGGHKR  175 (244)
Q Consensus       169 ~L~~H~r  175 (244)
                      +...|+.
T Consensus        83 a~~~hl~   89 (390)
T KOG2785|consen   83 AHENHLK   89 (390)
T ss_pred             hHHHHHH
Confidence            9998864


No 107
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=45.76  E-value=12  Score=23.08  Aligned_cols=9  Identities=22%  Similarity=0.556  Sum_probs=5.1

Q ss_pred             ceeCccccc
Q 038669          154 THECSICHK  162 (244)
Q Consensus       154 p~~C~~Cgk  162 (244)
                      +..|+.||.
T Consensus        19 ~irC~~CG~   27 (44)
T smart00659       19 VVRCRECGY   27 (44)
T ss_pred             ceECCCCCc
Confidence            455666653


No 108
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=44.60  E-value=24  Score=18.84  Aligned_cols=10  Identities=20%  Similarity=0.447  Sum_probs=8.2

Q ss_pred             CceeCccccc
Q 038669          153 RTHECSICHK  162 (244)
Q Consensus       153 kp~~C~~Cgk  162 (244)
                      -.|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            5799999984


No 109
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=44.41  E-value=13  Score=29.97  Aligned_cols=23  Identities=13%  Similarity=-0.000  Sum_probs=17.1

Q ss_pred             CCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccc
Q 038669          123 GSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICH  161 (244)
Q Consensus       123 ~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cg  161 (244)
                      .+.|..||..+                .|+-|-+|++||
T Consensus       134 ~~vC~vCGy~~----------------~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH----------------EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc----------------cCCCCCcCCCCC
Confidence            36788887543                356788999998


No 110
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=44.10  E-value=13  Score=25.58  Aligned_cols=20  Identities=30%  Similarity=0.644  Sum_probs=14.9

Q ss_pred             CCCceeCc--ccccccCCchhH
Q 038669          151 TGRTHECS--ICHKSFPTGQAL  170 (244)
Q Consensus       151 ~ekp~~C~--~Cgk~F~~~~~L  170 (244)
                      .++-++|.  .||..|.....+
T Consensus        24 ~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         24 KERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             heeeeecCCCCCCCEEEEEEEE
Confidence            45678998  899999875443


No 111
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=42.84  E-value=20  Score=32.19  Aligned_cols=24  Identities=25%  Similarity=0.569  Sum_probs=21.7

Q ss_pred             eeEeccccccccCHHHHHHhHHHh
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASH  120 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H  120 (244)
                      .++|-.|.|.|..+..|+.||+..
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhc
Confidence            488999999999999999999753


No 112
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=42.40  E-value=13  Score=24.78  Aligned_cols=13  Identities=31%  Similarity=0.723  Sum_probs=4.6

Q ss_pred             CceeCcccccccC
Q 038669          153 RTHECSICHKSFP  165 (244)
Q Consensus       153 kp~~C~~Cgk~F~  165 (244)
                      +.|.|..||..|-
T Consensus        24 rrhhCr~CG~~vC   36 (69)
T PF01363_consen   24 RRHHCRNCGRVVC   36 (69)
T ss_dssp             -EEE-TTT--EEE
T ss_pred             eeEccCCCCCEEC
Confidence            3455555555553


No 113
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=42.22  E-value=29  Score=29.13  Aligned_cols=28  Identities=18%  Similarity=0.444  Sum_probs=21.2

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      .+..|.|..|+|.|.-..-...|+..-+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            5667999999999999999999986533


No 114
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=42.05  E-value=12  Score=22.01  Aligned_cols=15  Identities=27%  Similarity=0.512  Sum_probs=11.6

Q ss_pred             ceeCcccccccCCch
Q 038669          154 THECSICHKSFPTGQ  168 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~  168 (244)
                      -|+|..||+.|....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            389999999886543


No 115
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=40.92  E-value=18  Score=28.50  Aligned_cols=15  Identities=40%  Similarity=0.687  Sum_probs=11.0

Q ss_pred             CceeCcccccccCCc
Q 038669          153 RTHECSICHKSFPTG  167 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~  167 (244)
                      +.-.|..||+.|++.
T Consensus        27 RRReC~~C~~RFTTf   41 (156)
T COG1327          27 RRRECLECGERFTTF   41 (156)
T ss_pred             hhhcccccccccchh
Confidence            446788888888764


No 116
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=40.59  E-value=23  Score=27.79  Aligned_cols=18  Identities=39%  Similarity=0.707  Sum_probs=13.4

Q ss_pred             CceeCcccccccCCchhH
Q 038669          153 RTHECSICHKSFPTGQAL  170 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L  170 (244)
                      +.-+|..||+.|++.-..
T Consensus        27 RRReC~~C~~RFTTyErv   44 (147)
T TIGR00244        27 RRRECLECHERFTTFERA   44 (147)
T ss_pred             ecccCCccCCccceeeec
Confidence            456899999999876443


No 117
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=40.43  E-value=5.9  Score=32.17  Aligned_cols=29  Identities=21%  Similarity=0.287  Sum_probs=15.3

Q ss_pred             eeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCC
Q 038669           97 VFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSA  132 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~  132 (244)
                      -|.|+.|+..|....++.       ..|.|+.|+..
T Consensus       117 ~Y~Cp~C~~rytf~eA~~-------~~F~Cp~Cg~~  145 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME-------YGFRCPQCGEM  145 (178)
T ss_pred             EEECCCCCcEEeHHHHhh-------cCCcCCCCCCC
Confidence            355666665555554442       24556655544


No 118
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=40.07  E-value=12  Score=23.76  Aligned_cols=13  Identities=23%  Similarity=0.841  Sum_probs=9.4

Q ss_pred             CceeEeccccccc
Q 038669           95 KLVFKCSVCDKAF  107 (244)
Q Consensus        95 ~~p~~C~~C~k~F  107 (244)
                      ...|+|..||+.|
T Consensus         4 ~~~Y~C~~Cg~~~   16 (49)
T COG1996           4 MMEYKCARCGREV   16 (49)
T ss_pred             eEEEEhhhcCCee
Confidence            3457888888777


No 119
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.05  E-value=8.3  Score=27.69  Aligned_cols=33  Identities=18%  Similarity=0.174  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCc
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTG  167 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~  167 (244)
                      ..|.|+.|++.-..           |...  -.++|..|++.|+-.
T Consensus        34 ~ky~Cp~Cgk~~vk-----------R~a~--GIW~C~~C~~~~AGG   66 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK-----------RVAT--GIWKCKKCGKKFAGG   66 (90)
T ss_dssp             S-BEESSSSSSEEE-----------EEET--TEEEETTTTEEEE-B
T ss_pred             CCCcCCCCCCceeE-----------Eeee--EEeecCCCCCEEeCC
Confidence            68889999875311           2222  359999999999754


No 120
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=39.91  E-value=14  Score=36.08  Aligned_cols=69  Identities=14%  Similarity=0.086  Sum_probs=41.4

Q ss_pred             eEeccccccccCHHHHHHhHHHhcCCCCCCCCC------CCCCCCCCCccccccccccCCCCceeCc--ccc-cccCCch
Q 038669           98 FKCSVCDKAFSSYQALGGHKASHRKGSGGGDEH------SASTTTNTNATATTTGVPNATGRTHECS--ICH-KSFPTGQ  168 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~------~~f~~~~~l~~~~~H~r~h~~ekp~~C~--~Cg-k~F~~~~  168 (244)
                      -.|..|...|-....|..|++.+.  |.|..|.      ..|..-..|   ..|-|    +..|.|.  .|- +.|....
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h--~~chfC~~~~~~neyy~~~~dL---e~HfR----~~HflCE~~~C~~~~f~~~~  253 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH--EFCHFCDYKTGQNEYYNDYDDL---EEHFR----KGHFLCEEEFCRTKKFYVAF  253 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce--eheeecCcccccchhcccchHH---HHHhh----hcCccccccccccceeeehh
Confidence            469999999999999999998764  3444443      223333334   44444    4557887  564 3444443


Q ss_pred             hHhhccc
Q 038669          169 ALGGHKR  175 (244)
Q Consensus       169 ~L~~H~r  175 (244)
                      .+..|++
T Consensus       254 ~~ei~lk  260 (669)
T KOG2231|consen  254 ELEIELK  260 (669)
T ss_pred             HHHHHHH
Confidence            4444444


No 121
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=39.79  E-value=14  Score=35.41  Aligned_cols=28  Identities=18%  Similarity=0.348  Sum_probs=24.5

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      ...+.+|..||..|........||-.|-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4567899999999999999999988886


No 122
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=39.07  E-value=16  Score=26.77  Aligned_cols=14  Identities=36%  Similarity=0.990  Sum_probs=8.7

Q ss_pred             ceeCcccccccCCc
Q 038669          154 THECSICHKSFPTG  167 (244)
Q Consensus       154 p~~C~~Cgk~F~~~  167 (244)
                      ||.|..||..|...
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45666666666654


No 123
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=38.46  E-value=22  Score=22.47  Aligned_cols=12  Identities=33%  Similarity=0.822  Sum_probs=6.0

Q ss_pred             ceeCcccccccC
Q 038669          154 THECSICHKSFP  165 (244)
Q Consensus       154 p~~C~~Cgk~F~  165 (244)
                      .|.|..||+.|-
T Consensus        18 k~~Cr~Cg~~~C   29 (57)
T cd00065          18 RHHCRNCGRIFC   29 (57)
T ss_pred             ccccCcCcCCcC
Confidence            344555555544


No 124
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=38.44  E-value=14  Score=35.35  Aligned_cols=30  Identities=20%  Similarity=0.354  Sum_probs=25.1

Q ss_pred             CCceeCcccccccCCchhHhhccccccccc
Q 038669          152 GRTHECSICHKSFPTGQALGGHKRCHYDGG  181 (244)
Q Consensus       152 ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~~  181 (244)
                      .+|.+|..||.+|........||..|-...
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~dwh  445 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDDWH  445 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhhhh
Confidence            467899999999999988888888776553


No 125
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=38.28  E-value=16  Score=21.74  Aligned_cols=14  Identities=21%  Similarity=0.475  Sum_probs=12.3

Q ss_pred             ceeCcccccccCCc
Q 038669          154 THECSICHKSFPTG  167 (244)
Q Consensus       154 p~~C~~Cgk~F~~~  167 (244)
                      ||+|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999999664


No 126
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=38.05  E-value=5.1  Score=33.20  Aligned_cols=80  Identities=20%  Similarity=0.258  Sum_probs=52.5

Q ss_pred             CceeEecc--ccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCcccccccc-c---------cCCCCceeCc--cc
Q 038669           95 KLVFKCSV--CDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGV-P---------NATGRTHECS--IC  160 (244)
Q Consensus        95 ~~p~~C~~--C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r-~---------h~~ekp~~C~--~C  160 (244)
                      ...|-|.+  |-..|........|...- -...|..|.+.|.....|   ..|+. .         -.|.-.|+|-  .|
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~-h~~sCs~C~r~~Pt~hLL---d~HI~E~HDs~Fqa~veRG~dMy~ClvEgC  152 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTL-HGNSCSFCKRAFPTGHLL---DAHILEWHDSLFQALVERGQDMYQCLVEGC  152 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhc-ccchhHHHHHhCCchhhh---hHHHHHHHHHHHHHHHHcCccHHHHHHHhh
Confidence            34577775  667777666666664322 123577888888776666   44442 2         2345569994  59


Q ss_pred             ccccCCchhHhhcc-cccc
Q 038669          161 HKSFPTGQALGGHK-RCHY  178 (244)
Q Consensus       161 gk~F~~~~~L~~H~-r~H~  178 (244)
                      +-.|.+..+-..|+ ++|.
T Consensus       153 t~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  153 TEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhhhhHHHHhcc
Confidence            99999998888885 6664


No 127
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=37.05  E-value=32  Score=25.20  Aligned_cols=26  Identities=15%  Similarity=0.291  Sum_probs=22.7

Q ss_pred             ceeEe----ccccccccCHHHHHHhHHHhc
Q 038669           96 LVFKC----SVCDKAFSSYQALGGHKASHR  121 (244)
Q Consensus        96 ~p~~C----~~C~k~F~~~~~L~~H~~~H~  121 (244)
                      .-|.|    ..|++.+.+...+..|.+.+.
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            44999    999999999999999988764


No 128
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=36.98  E-value=37  Score=30.08  Aligned_cols=26  Identities=19%  Similarity=0.498  Sum_probs=21.5

Q ss_pred             CCCceeCcc---cccccCCchhHhhcccc
Q 038669          151 TGRTHECSI---CHKSFPTGQALGGHKRC  176 (244)
Q Consensus       151 ~ekp~~C~~---Cgk~F~~~~~L~~H~r~  176 (244)
                      -+-.|.|..   |-++|.+.-+|..|+.-
T Consensus       141 ~g~iFmC~~~~GC~RTyLsqrDlqAHInh  169 (389)
T KOG2932|consen  141 MGGIFMCAAPHGCLRTYLSQRDLQAHINH  169 (389)
T ss_pred             ccceEEeecchhHHHHHhhHHHHHHHhhh
Confidence            356799965   99999999999999753


No 129
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.59  E-value=24  Score=21.54  Aligned_cols=14  Identities=21%  Similarity=0.695  Sum_probs=11.0

Q ss_pred             eCcccccccCCchh
Q 038669          156 ECSICHKSFPTGQA  169 (244)
Q Consensus       156 ~C~~Cgk~F~~~~~  169 (244)
                      .|.+||+.|...-.
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            59999999986543


No 130
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=36.50  E-value=24  Score=26.72  Aligned_cols=27  Identities=26%  Similarity=0.356  Sum_probs=24.1

Q ss_pred             CCCceeEeccccccccCHHHHHHhHHH
Q 038669           93 DQKLVFKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        93 ~~~~p~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      .|-..|-|-.|.+-|....+|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            367789999999999999999999875


No 131
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=36.26  E-value=17  Score=21.19  Aligned_cols=10  Identities=0%  Similarity=-0.217  Sum_probs=2.4

Q ss_pred             CCCCCCCCCC
Q 038669          126 GGDEHSASTT  135 (244)
Q Consensus       126 c~~c~~~f~~  135 (244)
                      |..|++.|..
T Consensus         6 C~eC~~~f~d   15 (34)
T PF01286_consen    6 CDECGKPFMD   15 (34)
T ss_dssp             -TTT--EES-
T ss_pred             HhHhCCHHHH
Confidence            3334444433


No 132
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=36.14  E-value=12  Score=31.22  Aligned_cols=25  Identities=28%  Similarity=0.620  Sum_probs=19.3

Q ss_pred             CCceeCcccccccCCchhHhhcccc
Q 038669          152 GRTHECSICHKSFPTGQALGGHKRC  176 (244)
Q Consensus       152 ekp~~C~~Cgk~F~~~~~L~~H~r~  176 (244)
                      +|.+.|++|++.|...--+.+..|.
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~   27 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRV   27 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceE
Confidence            4668999999999988766666553


No 133
>COG1773 Rubredoxin [Energy production and conversion]
Probab=36.06  E-value=18  Score=23.51  Aligned_cols=13  Identities=31%  Similarity=0.948  Sum_probs=10.8

Q ss_pred             eeEeccccccccC
Q 038669           97 VFKCSVCDKAFSS  109 (244)
Q Consensus        97 p~~C~~C~k~F~~  109 (244)
                      .|+|.+||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            5899999998854


No 134
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=35.30  E-value=35  Score=22.48  Aligned_cols=11  Identities=27%  Similarity=0.661  Sum_probs=7.8

Q ss_pred             CCceeCccccc
Q 038669          152 GRTHECSICHK  162 (244)
Q Consensus       152 ekp~~C~~Cgk  162 (244)
                      ..+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            35788888874


No 135
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=35.30  E-value=27  Score=21.62  Aligned_cols=16  Identities=25%  Similarity=0.414  Sum_probs=12.0

Q ss_pred             ceeCcccccccCCchh
Q 038669          154 THECSICHKSFPTGQA  169 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~  169 (244)
                      .|.|+.||..+.....
T Consensus        20 ~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       20 RFVCRKCGYEEPIEQK   35 (52)
T ss_pred             EEECCcCCCeEECCCc
Confidence            6899999987765443


No 136
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=34.98  E-value=12  Score=34.00  Aligned_cols=72  Identities=19%  Similarity=0.215  Sum_probs=46.6

Q ss_pred             CceeEeccccccccCHHHHHHhHHHhcCCCCCCCCCCCCCCCCCCccccccccccCC---CCceeCcccc---cccCCch
Q 038669           95 KLVFKCSVCDKAFSSYQALGGHKASHRKGSGGGDEHSASTTTNTNATATTTGVPNAT---GRTHECSICH---KSFPTGQ  168 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~~L~~H~~~H~k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~---ekp~~C~~Cg---k~F~~~~  168 (244)
                      ..|-.|-.|++.|.+-..-..||..|++.|.-..- +...        ..-...-.|   .+-|.|-.|.   +.|.+-.
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdre-YL~D--------~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sle  234 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDRE-YLTD--------EKGLLKYLGEKVGIGFICLFCNELGRPFSSLE  234 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchH-hhhc--------hhHHHHHHHHHhccCceEEEeccccCcccccH
Confidence            34577999999999998888999888865532210 0000        000000111   2347888888   9999999


Q ss_pred             hHhhccc
Q 038669          169 ALGGHKR  175 (244)
Q Consensus       169 ~L~~H~r  175 (244)
                      +...||+
T Consensus       235 avr~HM~  241 (390)
T KOG2785|consen  235 AVRAHMR  241 (390)
T ss_pred             HHHHHHh
Confidence            9999984


No 137
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=33.33  E-value=37  Score=30.06  Aligned_cols=28  Identities=18%  Similarity=0.362  Sum_probs=23.7

Q ss_pred             CceeCcccccccCCchhHhhcccccccc
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCHYDG  180 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H~~~  180 (244)
                      -.|.|+.|...|-...+.-.|...|..-
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh~C~  414 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLHFCI  414 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHhhCC
Confidence            4699999999999999998998877543


No 138
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=33.26  E-value=29  Score=24.94  Aligned_cols=14  Identities=0%  Similarity=-0.273  Sum_probs=8.7

Q ss_pred             CCCCCCCCCCCCCC
Q 038669          122 KGSGGGDEHSASTT  135 (244)
Q Consensus       122 k~~~c~~c~~~f~~  135 (244)
                      .|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45567777766654


No 139
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=33.21  E-value=9.8  Score=32.33  Aligned_cols=28  Identities=32%  Similarity=0.548  Sum_probs=22.2

Q ss_pred             CCceeEeccccccccCHHHHHHh-HHHhc
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGH-KASHR  121 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H-~~~H~  121 (244)
                      ..+-|+|.+|.|.+.+--.|..| |.+|.
T Consensus        31 kakhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   31 KAKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             hhccceeeeehhhhccCCCceeehhhhhh
Confidence            45779999999998888888887 56664


No 140
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=32.92  E-value=12  Score=31.27  Aligned_cols=30  Identities=17%  Similarity=0.258  Sum_probs=21.8

Q ss_pred             CCCceeCcccccccCCchhHhhcccccccc
Q 038669          151 TGRTHECSICHKSFPTGQALGGHKRCHYDG  180 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~L~~H~r~H~~~  180 (244)
                      .+..|.|..|+|.|.-..-..+|+..-+.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            445699999999999999999998654444


No 141
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=31.87  E-value=40  Score=20.27  Aligned_cols=24  Identities=25%  Similarity=0.405  Sum_probs=17.9

Q ss_pred             eEeccccccccC--HHHHHHhHHHhc
Q 038669           98 FKCSVCDKAFSS--YQALGGHKASHR  121 (244)
Q Consensus        98 ~~C~~C~k~F~~--~~~L~~H~~~H~  121 (244)
                      -+|..||..|..  ...-..|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            589999988854  456667877774


No 142
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=31.60  E-value=49  Score=19.41  Aligned_cols=18  Identities=17%  Similarity=0.418  Sum_probs=13.4

Q ss_pred             cccccccCCCCceeCccc
Q 038669          143 TTTGVPNATGRTHECSIC  160 (244)
Q Consensus       143 ~~H~r~h~~ekp~~C~~C  160 (244)
                      .+|-+...|...|.|..|
T Consensus        18 ~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCEeEecCcC
Confidence            556666667778999888


No 143
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=31.51  E-value=18  Score=21.87  Aligned_cols=15  Identities=33%  Similarity=0.565  Sum_probs=10.2

Q ss_pred             CceeCcccccccCCc
Q 038669          153 RTHECSICHKSFPTG  167 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~  167 (244)
                      -||.|..|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            489999999999765


No 144
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=31.27  E-value=22  Score=25.87  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=15.1

Q ss_pred             ccccCCCCceeCcccccccCC
Q 038669          146 GVPNATGRTHECSICHKSFPT  166 (244)
Q Consensus       146 ~r~h~~ekp~~C~~Cgk~F~~  166 (244)
                      +..+.| +++.|..||..|.-
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            344555 79999999988853


No 145
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=30.74  E-value=40  Score=20.88  Aligned_cols=25  Identities=20%  Similarity=0.305  Sum_probs=19.8

Q ss_pred             ceeEeccccccccCHHHHHHhHHHh
Q 038669           96 LVFKCSVCDKAFSSYQALGGHKASH  120 (244)
Q Consensus        96 ~p~~C~~C~k~F~~~~~L~~H~~~H  120 (244)
                      -.|+|-.|......++.|-.||.-.
T Consensus        19 ~~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   19 FKYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             ccceeecCCcccchHHHHHHHHHHH
Confidence            3488999998888888888888654


No 146
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=30.30  E-value=20  Score=33.04  Aligned_cols=36  Identities=11%  Similarity=0.125  Sum_probs=22.4

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccc
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKS  163 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~  163 (244)
                      ..|.|+.|.+.|.....+      +......-.|.|..|+--
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~------~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEAL------QLLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccCCccccchhhhHHH------HhhcccCceEEEecCCCc
Confidence            578899998888764432      111222345889888743


No 147
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=29.77  E-value=29  Score=32.21  Aligned_cols=27  Identities=19%  Similarity=0.337  Sum_probs=21.6

Q ss_pred             ccCCCCceeCcccc-cccCCchhHhhcc
Q 038669          148 PNATGRTHECSICH-KSFPTGQALGGHK  174 (244)
Q Consensus       148 ~h~~ekp~~C~~Cg-k~F~~~~~L~~H~  174 (244)
                      .|.-.+-|.|.+|| +++.-..++.+|-
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHh
Confidence            34446779999999 8888888888884


No 149
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=29.29  E-value=14  Score=33.36  Aligned_cols=18  Identities=11%  Similarity=0.157  Sum_probs=9.1

Q ss_pred             ceeEeccccccccCHHHH
Q 038669           96 LVFKCSVCDKAFSSYQAL  113 (244)
Q Consensus        96 ~p~~C~~C~k~F~~~~~L  113 (244)
                      +-+.|..|.+.+......
T Consensus       251 kav~C~~C~yt~~~~~~~  268 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDR  268 (344)
T ss_dssp             EEEEETTT--EESS--HH
T ss_pred             EEEEcCCCCCcccCcchh
Confidence            347788888776555443


No 150
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=29.09  E-value=21  Score=20.42  Aligned_cols=10  Identities=20%  Similarity=0.600  Sum_probs=5.9

Q ss_pred             ceeCcccccc
Q 038669          154 THECSICHKS  163 (244)
Q Consensus       154 p~~C~~Cgk~  163 (244)
                      +-.|..||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4567777743


No 151
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=28.54  E-value=26  Score=22.15  Aligned_cols=16  Identities=25%  Similarity=0.478  Sum_probs=13.1

Q ss_pred             CCceeCcccccccCCc
Q 038669          152 GRTHECSICHKSFPTG  167 (244)
Q Consensus       152 ekp~~C~~Cgk~F~~~  167 (244)
                      ++.+.|..||..|...
T Consensus         2 Dk~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFT   17 (49)
T ss_pred             CeeEEcccCCCeEEEe
Confidence            4678999999998754


No 152
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=28.32  E-value=28  Score=32.14  Aligned_cols=16  Identities=31%  Similarity=0.789  Sum_probs=8.2

Q ss_pred             eeEeccccccccCHHH
Q 038669           97 VFKCSVCDKAFSSYQA  112 (244)
Q Consensus        97 p~~C~~C~k~F~~~~~  112 (244)
                      -|.|..|.+.|....+
T Consensus       128 ~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEA  143 (436)
T ss_pred             cccCCccccchhhhHH
Confidence            3555555555544443


No 153
>PLN02294 cytochrome c oxidase subunit Vb
Probab=27.82  E-value=31  Score=27.83  Aligned_cols=16  Identities=31%  Similarity=0.926  Sum_probs=13.1

Q ss_pred             CCceeCcccccccCCc
Q 038669          152 GRTHECSICHKSFPTG  167 (244)
Q Consensus       152 ekp~~C~~Cgk~F~~~  167 (244)
                      ++|+.|..||..|.-.
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4799999999988643


No 154
>PHA02998 RNA polymerase subunit; Provisional
Probab=27.11  E-value=49  Score=26.90  Aligned_cols=31  Identities=32%  Similarity=0.351  Sum_probs=19.7

Q ss_pred             ccCCCCCCCC-CCCChHHHHHHHHHHHhcCCC
Q 038669           30 TKRKRSKRPH-NPPTEEEYLALCLVMLARGTT   60 (244)
Q Consensus        30 ~k~krskr~r-~~~s~ee~~a~cl~~ls~~~~   60 (244)
                      +|.|-|=|-+ .-++.+||-.+|.|.-+..+.
T Consensus        69 ~knklsyrnkp~i~tn~~y~~lc~~ir~tng~  100 (195)
T PHA02998         69 AKNKLSYRNKPSIETNLEYKDLCDMIRGTNGT  100 (195)
T ss_pred             ccccccccCCcCCcccccHHHHHHHHHhcCCc
Confidence            3445554432 555889999999887664443


No 155
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=26.96  E-value=51  Score=28.26  Aligned_cols=61  Identities=15%  Similarity=0.230  Sum_probs=34.1

Q ss_pred             CCceeEeccccccccCHHHHHHhHHHhc--CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCchhH
Q 038669           94 QKLVFKCSVCDKAFSSYQALGGHKASHR--KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQAL  170 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~~~~~L~~H~~~H~--k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~~L  170 (244)
                      ..+.|.|..|...+=        +++-.  ..-.|..|.+.|.--..-      ..  -|---|.|..|++.|.....+
T Consensus       109 ~drqFaC~~Cd~~Ww--------Rrvp~rKeVSRCr~C~~rYDPVP~d------km--wG~aef~C~~C~h~F~G~~qm  171 (278)
T PF15135_consen  109 VDRQFACSSCDHMWW--------RRVPQRKEVSRCRKCRKRYDPVPCD------KM--WGIAEFHCPKCRHNFRGFAQM  171 (278)
T ss_pred             cceeeeccccchHHH--------hccCcccccccccccccccCCCccc------cc--cceeeeecccccccchhhhhc
Confidence            457899999975531        12211  334677777665432110      00  022348899999888765444


No 156
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.81  E-value=49  Score=21.88  Aligned_cols=16  Identities=25%  Similarity=0.613  Sum_probs=12.0

Q ss_pred             CCCceeCcccccccCC
Q 038669          151 TGRTHECSICHKSFPT  166 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~  166 (244)
                      ..+.|.|+.||..+..
T Consensus        43 ~~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDR   58 (69)
T ss_pred             ccceEEcCCCCCEECc
Confidence            3567999999887654


No 157
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=26.53  E-value=58  Score=32.18  Aligned_cols=21  Identities=24%  Similarity=0.567  Sum_probs=14.7

Q ss_pred             CceeCcccccccCCchhHhhc
Q 038669          153 RTHECSICHKSFPTGQALGGH  173 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H  173 (244)
                      |.-+|+.|+.+|.....+..|
T Consensus       677 RqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hcCCCCCCCCCCCcccccccC
Confidence            445788888888777666555


No 158
>PRK14873 primosome assembly protein PriA; Provisional
Probab=25.98  E-value=31  Score=33.97  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=8.4

Q ss_pred             CceeCcccccc
Q 038669          153 RTHECSICHKS  163 (244)
Q Consensus       153 kp~~C~~Cgk~  163 (244)
                      .|+.|+.||..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            46789999864


No 159
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=25.83  E-value=46  Score=30.79  Aligned_cols=30  Identities=7%  Similarity=0.001  Sum_probs=20.9

Q ss_pred             CCCCCCCCCCCCCCCccccccccccCCCCceeCcccccccCCch
Q 038669          125 GGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKSFPTGQ  168 (244)
Q Consensus       125 ~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~F~~~~  168 (244)
                      .|+.|+....+.              |..-|+|..||+.+....
T Consensus       352 ~Cp~Cg~~m~S~--------------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA--------------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc--------------CCCCcccccccccCCccc
Confidence            688887665442              223699999998887654


No 160
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=25.58  E-value=22  Score=26.30  Aligned_cols=25  Identities=36%  Similarity=0.493  Sum_probs=21.6

Q ss_pred             CCCceeCcccccccCCchhHhhccc
Q 038669          151 TGRTHECSICHKSFPTGQALGGHKR  175 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~L~~H~r  175 (244)
                      |.-.|-|-.|.+-|.+..+|..|++
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            3456889999999999999999975


No 161
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=25.38  E-value=41  Score=20.98  Aligned_cols=14  Identities=21%  Similarity=0.788  Sum_probs=10.5

Q ss_pred             eeEeccccccccCH
Q 038669           97 VFKCSVCDKAFSSY  110 (244)
Q Consensus        97 p~~C~~C~k~F~~~  110 (244)
                      .|+|.+|+..|...
T Consensus         1 ky~C~~CgyvYd~~   14 (47)
T PF00301_consen    1 KYQCPVCGYVYDPE   14 (47)
T ss_dssp             EEEETTTSBEEETT
T ss_pred             CcCCCCCCEEEcCC
Confidence            37899999887553


No 162
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=25.37  E-value=31  Score=27.27  Aligned_cols=14  Identities=14%  Similarity=0.807  Sum_probs=9.9

Q ss_pred             CCceeEecccccccc
Q 038669           94 QKLVFKCSVCDKAFS  108 (244)
Q Consensus        94 ~~~p~~C~~C~k~F~  108 (244)
                      ...+|.|. |+..|-
T Consensus       114 ~~~~Y~C~-C~q~~l  127 (156)
T COG3091         114 TTYPYRCQ-CQQHYL  127 (156)
T ss_pred             cceeEEee-cCCccc
Confidence            45678888 887753


No 163
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=25.28  E-value=31  Score=20.79  Aligned_cols=12  Identities=17%  Similarity=0.598  Sum_probs=10.4

Q ss_pred             CceeCccccccc
Q 038669          153 RTHECSICHKSF  164 (244)
Q Consensus       153 kp~~C~~Cgk~F  164 (244)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            578999999887


No 164
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=24.95  E-value=48  Score=31.01  Aligned_cols=22  Identities=41%  Similarity=0.789  Sum_probs=19.7

Q ss_pred             eEeccccccccCHHHHHHhHHH
Q 038669           98 FKCSVCDKAFSSYQALGGHKAS  119 (244)
Q Consensus        98 ~~C~~C~k~F~~~~~L~~H~~~  119 (244)
                      +-|-+|+|.|.+..+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999988754


No 165
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=24.86  E-value=41  Score=20.08  Aligned_cols=12  Identities=17%  Similarity=0.495  Sum_probs=9.8

Q ss_pred             ceeCcccccccC
Q 038669          154 THECSICHKSFP  165 (244)
Q Consensus       154 p~~C~~Cgk~F~  165 (244)
                      -|.|..|+..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            489999998774


No 166
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=24.25  E-value=33  Score=30.76  Aligned_cols=31  Identities=29%  Similarity=0.423  Sum_probs=25.1

Q ss_pred             ceeCcccccccCCchhHhhccc--ccccccCCC
Q 038669          154 THECSICHKSFPTGQALGGHKR--CHYDGGEKS  184 (244)
Q Consensus       154 p~~C~~Cgk~F~~~~~L~~H~r--~H~~~~~~~  184 (244)
                      .+.|-.|.|.|..+..|..|||  .|..-.+..
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPkn  227 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKN  227 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCc
Confidence            4789999999999999999986  465555543


No 167
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=24.19  E-value=44  Score=19.86  Aligned_cols=17  Identities=24%  Similarity=0.509  Sum_probs=10.7

Q ss_pred             ccCCCCceeCccccccc
Q 038669          148 PNATGRTHECSICHKSF  164 (244)
Q Consensus       148 ~h~~ekp~~C~~Cgk~F  164 (244)
                      ...+.+.+.|.+|+..-
T Consensus        18 ~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen   18 FDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             EETTTTEEEETTT--EE
T ss_pred             EcCCCCEEECcCCCCcC
Confidence            34456789999998643


No 168
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=24.17  E-value=62  Score=16.83  Aligned_cols=7  Identities=29%  Similarity=0.937  Sum_probs=4.7

Q ss_pred             Ccccccc
Q 038669          157 CSICHKS  163 (244)
Q Consensus       157 C~~Cgk~  163 (244)
                      |+.||..
T Consensus        16 C~~CG~~   22 (23)
T PF13240_consen   16 CPNCGTP   22 (23)
T ss_pred             hhhhCCc
Confidence            7777754


No 169
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=23.97  E-value=34  Score=21.84  Aligned_cols=27  Identities=19%  Similarity=0.248  Sum_probs=16.7

Q ss_pred             CceeCcccccccCCchhHhhccccccc
Q 038669          153 RTHECSICHKSFPTGQALGGHKRCHYD  179 (244)
Q Consensus       153 kp~~C~~Cgk~F~~~~~L~~H~r~H~~  179 (244)
                      ..|+|+.|...|--.-++-.|...|.-
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH~C   46 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLHNC   46 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-SS
T ss_pred             CeEECCCCCCccccCcChhhhccccCC
Confidence            569999999999888888888877753


No 170
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=23.56  E-value=57  Score=21.07  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=7.2

Q ss_pred             eeCcccccccCC
Q 038669          155 HECSICHKSFPT  166 (244)
Q Consensus       155 ~~C~~Cgk~F~~  166 (244)
                      -.|+.||..+.+
T Consensus        22 VvCp~CgapyHR   33 (54)
T PF14446_consen   22 VVCPECGAPYHR   33 (54)
T ss_pred             EECCCCCCcccH
Confidence            467777665544


No 171
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=23.31  E-value=42  Score=25.10  Aligned_cols=19  Identities=16%  Similarity=0.329  Sum_probs=13.5

Q ss_pred             ChHHHHHHHHHHHhcCCCC
Q 038669           43 TEEEYLALCLVMLARGTTS   61 (244)
Q Consensus        43 s~ee~~a~cl~~ls~~~~~   61 (244)
                      =+.+.|..|+-.++.+...
T Consensus        39 V~p~~L~faf~~~~~~t~~   57 (115)
T TIGR00100        39 VNPSQLQFAFEVVREGTVA   57 (115)
T ss_pred             cCHHHHHHHHHHHhCCCcc
Confidence            3567788888888776654


No 172
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=23.08  E-value=40  Score=25.12  Aligned_cols=21  Identities=19%  Similarity=0.336  Sum_probs=15.2

Q ss_pred             CChHHHHHHHHHHHhcCCCCC
Q 038669           42 PTEEEYLALCLVMLARGTTST   62 (244)
Q Consensus        42 ~s~ee~~a~cl~~ls~~~~~~   62 (244)
                      .=+.|.|..|+-.++.+....
T Consensus        38 ~v~pe~L~f~f~~~~~~T~~e   58 (113)
T PRK12380         38 CVEESAVRFSFEIVCHGTVAQ   58 (113)
T ss_pred             ccCHHHHHHHHHHHhCCCccC
Confidence            346778888988888776543


No 173
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=22.78  E-value=17  Score=35.72  Aligned_cols=54  Identities=15%  Similarity=0.148  Sum_probs=29.0

Q ss_pred             eccccccccCHHHHHHhHHHhc--CCC-CCCCCCCCCCCCCCCccccccccccCCCCceeCcccccc
Q 038669          100 CSVCDKAFSSYQALGGHKASHR--KGS-GGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHKS  163 (244)
Q Consensus       100 C~~C~k~F~~~~~L~~H~~~H~--k~~-~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk~  163 (244)
                      |..||=.|+--..|--- |-+|  ..| -|+.|.+.+....+       .|-|.  .|..|+.||-.
T Consensus       126 CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~n-------RRfHA--Qp~aCp~CGP~  182 (750)
T COG0068         126 CTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLN-------RRFHA--QPIACPKCGPH  182 (750)
T ss_pred             cCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccc-------ccccc--ccccCcccCCC
Confidence            77788777654443222 1122  333 47777665544332       22232  57789999853


No 174
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=22.74  E-value=28  Score=28.74  Aligned_cols=23  Identities=30%  Similarity=0.600  Sum_probs=0.0

Q ss_pred             CCceeCccccc-ccCCchhHhhcc
Q 038669          152 GRTHECSICHK-SFPTGQALGGHK  174 (244)
Q Consensus       152 ekp~~C~~Cgk-~F~~~~~L~~H~  174 (244)
                      .+-|.|.+||- +|.-..++.+|-
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhc
Confidence            46799999983 444566667763


No 175
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.41  E-value=33  Score=26.47  Aligned_cols=47  Identities=23%  Similarity=0.409  Sum_probs=28.7

Q ss_pred             CCChHHHHHHHHHHHhcCCCCCccccCCCCCCcCcCCCCCCCCCCCCCCCCCCCCceeEeccccccccCH
Q 038669           41 PPTEEEYLALCLVMLARGTTSTAALTNCNTTTTASQRQKSPAPSTAATTSSSDQKLVFKCSVCDKAFSSY  110 (244)
Q Consensus        41 ~~s~ee~~a~cl~~ls~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~C~~C~k~F~~~  110 (244)
                      ..-+.+.+..|+-.++.+..-..+           .            -.-......+.|..||+.|...
T Consensus        37 s~V~pe~L~fafe~l~~gt~~ega-----------~------------L~i~~~p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         37 QDVDKEIVEFALNELLKGTILEGA-----------E------------IIFEEEEAVLKCRNCGNEWSLK   83 (135)
T ss_pred             hhhhHHHHHHHHHHHHcCCcccCC-----------E------------EEEEecceEEECCCCCCEEecc
Confidence            334677788888888876544310           0            0001123569999999988654


No 176
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=22.36  E-value=78  Score=20.03  Aligned_cols=17  Identities=24%  Similarity=0.647  Sum_probs=12.4

Q ss_pred             CceeEeccccccccCHH
Q 038669           95 KLVFKCSVCDKAFSSYQ  111 (244)
Q Consensus        95 ~~p~~C~~C~k~F~~~~  111 (244)
                      .--++|..||..|...-
T Consensus        26 ~v~W~C~~Cgh~w~~~v   42 (55)
T PF14311_consen   26 KVWWKCPKCGHEWKASV   42 (55)
T ss_pred             EEEEECCCCCCeeEccH
Confidence            34489999998886543


No 177
>PRK04023 DNA polymerase II large subunit; Validated
Probab=21.66  E-value=58  Score=33.54  Aligned_cols=11  Identities=36%  Similarity=0.585  Sum_probs=8.3

Q ss_pred             ceeEecccccc
Q 038669           96 LVFKCSVCDKA  106 (244)
Q Consensus        96 ~p~~C~~C~k~  106 (244)
                      ....|..||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            44678889877


No 178
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=21.07  E-value=50  Score=29.83  Aligned_cols=27  Identities=19%  Similarity=0.321  Sum_probs=20.4

Q ss_pred             ccCCCCceeCcccc-cccCCchhHhhcc
Q 038669          148 PNATGRTHECSICH-KSFPTGQALGGHK  174 (244)
Q Consensus       148 ~h~~ekp~~C~~Cg-k~F~~~~~L~~H~  174 (244)
                      .|.-++-|.|.+|| +++.-...+.+|-
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhh
Confidence            45556779999999 7777777777773


No 179
>KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=20.74  E-value=51  Score=30.68  Aligned_cols=24  Identities=17%  Similarity=0.596  Sum_probs=19.5

Q ss_pred             CceeEecccc-ccccCHHHHHHhHH
Q 038669           95 KLVFKCSVCD-KAFSSYQALGGHKA  118 (244)
Q Consensus        95 ~~p~~C~~C~-k~F~~~~~L~~H~~  118 (244)
                      ..-|.|.+|| +++.-..++.+|-.
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHhH
Confidence            4559999999 88888888888853


No 180
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=20.68  E-value=38  Score=21.44  Aligned_cols=12  Identities=17%  Similarity=0.982  Sum_probs=8.5

Q ss_pred             eEeccccccccC
Q 038669           98 FKCSVCDKAFSS  109 (244)
Q Consensus        98 ~~C~~C~k~F~~  109 (244)
                      |+|.+||..|..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            677888877653


No 181
>PRK14873 primosome assembly protein PriA; Provisional
Probab=20.59  E-value=63  Score=31.87  Aligned_cols=15  Identities=27%  Similarity=0.702  Sum_probs=9.6

Q ss_pred             cCCCCceeCcccccc
Q 038669          149 NATGRTHECSICHKS  163 (244)
Q Consensus       149 h~~ekp~~C~~Cgk~  163 (244)
                      |...+...|..||..
T Consensus       405 h~~~~~l~Ch~CG~~  419 (665)
T PRK14873        405 PSAGGTPRCRWCGRA  419 (665)
T ss_pred             ecCCCeeECCCCcCC
Confidence            334456778888764


No 182
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=20.55  E-value=2.1e+02  Score=17.28  Aligned_cols=29  Identities=21%  Similarity=0.181  Sum_probs=17.5

Q ss_pred             CCCCCCCCCCCCCCCCCCccccccccccCCCCceeCccccc
Q 038669          122 KGSGGGDEHSASTTTNTNATATTTGVPNATGRTHECSICHK  162 (244)
Q Consensus       122 k~~~c~~c~~~f~~~~~l~~~~~H~r~h~~ekp~~C~~Cgk  162 (244)
                      ..+.|+.|+..  ....+          .+...|+|..|++
T Consensus        17 ~g~~CP~Cg~~--~~~~~----------~~~~~~~C~~C~~   45 (46)
T PF12760_consen   17 DGFVCPHCGST--KHYRL----------KTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCCe--eeEEe----------CCCCeEECCCCCC
Confidence            44678888764  11111          1246799999976


No 183
>PRK12496 hypothetical protein; Provisional
Probab=20.53  E-value=57  Score=26.05  Aligned_cols=8  Identities=38%  Similarity=1.016  Sum_probs=4.7

Q ss_pred             eCcccccc
Q 038669          156 ECSICHKS  163 (244)
Q Consensus       156 ~C~~Cgk~  163 (244)
                      .|++||..
T Consensus       145 ~C~~CG~~  152 (164)
T PRK12496        145 VCEICGSP  152 (164)
T ss_pred             cCCCCCCh
Confidence            36777643


No 184
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=20.41  E-value=37  Score=21.48  Aligned_cols=12  Identities=17%  Similarity=0.703  Sum_probs=6.6

Q ss_pred             eCcccccccCCc
Q 038669          156 ECSICHKSFPTG  167 (244)
Q Consensus       156 ~C~~Cgk~F~~~  167 (244)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999999753


No 185
>PF11787 Aft1_HRR:  Aft1 HRR domain;  InterPro: IPR021756  This domain is found in the transcription factor Aft1 which is required for a wide range of stress responses. The HRR domain is involved in meiotic recombination. It has been shown to be necessary and sufficient to repress recombination []. 
Probab=20.02  E-value=77  Score=22.01  Aligned_cols=14  Identities=43%  Similarity=0.406  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHhcCC
Q 038669           46 EYLALCLVMLARGT   59 (244)
Q Consensus        46 e~~a~cl~~ls~~~   59 (244)
                      -|.|+.|.||+.++
T Consensus        63 ~dAANgLfmLAqg~   76 (76)
T PF11787_consen   63 NDAANGLFMLAQGR   76 (76)
T ss_pred             HHHHHHHHHHhcCC
Confidence            79999999999763


No 186
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.01  E-value=77  Score=25.18  Aligned_cols=19  Identities=21%  Similarity=0.450  Sum_probs=15.6

Q ss_pred             CCCceeCcccccccCCchh
Q 038669          151 TGRTHECSICHKSFPTGQA  169 (244)
Q Consensus       151 ~ekp~~C~~Cgk~F~~~~~  169 (244)
                      -+.|.-|..||+.|++...
T Consensus        65 ~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCCChhHHhCCCCCchHHH
Confidence            3589999999999998543


Done!