Query         038672
Match_columns 148
No_of_seqs    107 out of 122
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 13:28:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038672.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038672hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07911 DUF1677:  Protein of u 100.0 9.5E-56   2E-60  324.3   8.4   91   30-128     1-91  (91)
  2 COG0675 Transposase and inacti  45.2     8.6 0.00019   30.5   0.5   24   32-69    308-331 (364)
  3 PF08093 Toxin_23:  Magi 5 toxi  44.4     9.3  0.0002   23.6   0.4   10   37-46     14-23  (30)
  4 PF07637 PSD5:  Protein of unkn  34.9 1.4E+02   0.003   20.0   6.3   40   86-133    18-57  (64)
  5 PF13913 zf-C2HC_2:  zinc-finge  34.0      30 0.00064   19.6   1.4   12   90-101    14-25  (25)
  6 PF07874 DUF1660:  Prophage pro  34.0      18  0.0004   25.5   0.6   38   59-98     21-64  (64)
  7 PF04810 zf-Sec23_Sec24:  Sec23  32.3      18 0.00039   22.4   0.3   11   58-68     22-32  (40)
  8 TIGR03114 cas_csf1 CRISPR-asso  31.5      19 0.00041   30.5   0.5   15   58-72     30-44  (202)
  9 PF04959 ARS2:  Arsenite-resist  30.8      10 0.00022   31.8  -1.2   19   54-72     71-89  (214)
 10 COG1998 RPS31 Ribosomal protei  30.6      19 0.00042   24.6   0.3   25   34-67     20-44  (51)
 11 cd03132 GATase1_catalase Type   29.8      29 0.00064   25.1   1.2   26   45-70     80-106 (142)
 12 PF05605 zf-Di19:  Drought indu  28.2   1E+02  0.0022   19.7   3.4   40   33-73      2-44  (54)
 13 PRK00432 30S ribosomal protein  27.5      24 0.00052   23.2   0.3   23   35-67     22-44  (50)
 14 TIGR01562 FdhE formate dehydro  27.4      61  0.0013   28.5   2.9   92   33-130   184-293 (305)
 15 COG5028 Vesicle coat complex C  26.7      11 0.00023   37.7  -2.0   28   34-68    200-229 (861)
 16 TIGR01383 not_thiJ DJ-1 family  25.5      44 0.00095   24.9   1.5   27   45-71     81-108 (179)
 17 smart00547 ZnF_RBZ Zinc finger  24.4      29 0.00063   19.0   0.3   11   59-69      1-11  (26)
 18 COG2191 Formylmethanofuran deh  24.0      25 0.00054   29.8  -0.1   31   33-70    172-203 (206)
 19 PRK12722 transcriptional activ  23.9      22 0.00048   29.4  -0.4   33   29-68    130-162 (187)
 20 PRK09855 PTS system N-acetylga  23.5      87  0.0019   27.0   3.1   14   89-105    53-66  (263)
 21 PLN02489 homocysteine S-methyl  23.2      59  0.0013   28.3   2.0   19   38-60    316-334 (335)
 22 PRK11574 oxidative-stress-resi  22.8      53  0.0012   25.2   1.5   24   47-70     86-110 (196)
 23 cd03139 GATase1_PfpI_2 Type 1   21.2      63  0.0014   24.0   1.6   26   45-70     79-105 (183)
 24 COG1405 SUA7 Transcription ini  21.0      20 0.00043   31.1  -1.3   32   35-74      3-34  (285)
 25 PRK12860 transcriptional activ  20.8      36 0.00077   28.3   0.2   32   29-67    130-161 (189)
 26 PF00641 zf-RanBP:  Zn-finger i  20.8      38 0.00083   19.4   0.3   10   58-67      2-11  (30)
 27 PRK07534 methionine synthase I  20.1      73  0.0016   27.9   2.0   19   38-60    278-296 (336)

No 1  
>PF07911 DUF1677:  Protein of unknown function (DUF1677);  InterPro: IPR012876 The sequences found in this family are all derived from hypothetical plant proteins of unknown function. The region features a number of highly conserved cysteine residues. 
Probab=100.00  E-value=9.5e-56  Score=324.29  Aligned_cols=91  Identities=68%  Similarity=1.246  Sum_probs=86.7

Q ss_pred             hhhceeeCccCCCccccHHHHHHHHhhcCCccccchhhHHHHHHHHHhhcccccCCCCCHHHHHHHHHHHHhhhccCCCC
Q 038672           30 EVEFARCECCGLTEECTAAYVSRVKERYGGRWICGLCTEAVKDEITCRSKKRENHMMISTDEALNRHMKFCEQFRSSSPP  109 (148)
Q Consensus        30 EVE~akCeCCGltEECT~~YI~~VR~ry~GrWvCGLCsEAVkeE~~~R~~~~~~~~~i~~eEAl~~Hm~fC~~fn~~~~~  109 (148)
                      |||+|+||||||+|||||+||++||++|+||||||||+||||||+. |.++     .+++||||++||+||++||+++|+
T Consensus         1 EvE~akCeCCG~~EECT~~YI~~VR~ry~GrWvCGLC~EAVkeE~~-r~~~-----~~~~eeAl~~Hm~fC~~f~~~~~~   74 (91)
T PF07911_consen    1 EVESAKCECCGLTEECTPEYIARVRERYGGRWVCGLCSEAVKEEVG-RSKP-----GISVEEALDRHMSFCRKFNSSTRP   74 (91)
T ss_pred             CCceeeecCCCCchhccHHHHHHHHHHhCCeehhhcCHHHHHHHHh-ccCC-----CCCHHHHHHHHHHHHHHcCCCCCC
Confidence            7999999999999999999999999999999999999999999998 7555     799999999999999999998755


Q ss_pred             CCCCchhHHHHHHHHHHHh
Q 038672          110 ARPAADDLISAMKHILRRS  128 (148)
Q Consensus       110 ~nP~a~~la~aMR~iLRRs  128 (148)
                       ||+ ++||+|||||||||
T Consensus        75 -np~-~~l~~amr~ilrRs   91 (91)
T PF07911_consen   75 -NPA-LSLASAMRQILRRS   91 (91)
T ss_pred             -Chh-HHHHHHHHHHHhcC
Confidence             999 99999999999986


No 2  
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.20  E-value=8.6  Score=30.50  Aligned_cols=24  Identities=29%  Similarity=0.699  Sum_probs=19.4

Q ss_pred             hceeeCccCCCccccHHHHHHHHhhcCCccccchhhHH
Q 038672           32 EFARCECCGLTEECTAAYVSRVKERYGGRWICGLCTEA   69 (148)
Q Consensus        32 E~akCeCCGltEECT~~YI~~VR~ry~GrWvCGLCsEA   69 (148)
                      -+..|-|||.              ...+.|.|.-|+.-
T Consensus       308 tS~~C~~cg~--------------~~~r~~~C~~cg~~  331 (364)
T COG0675         308 TSKTCPCCGH--------------LSGRLFKCPRCGFV  331 (364)
T ss_pred             CcccccccCC--------------ccceeEECCCCCCe
Confidence            4688999999              44677999999863


No 3  
>PF08093 Toxin_23:  Magi 5 toxic peptide family;  InterPro: IPR012628 This family consists of toxic peptides (Magi 5) found in the venom of the Hexathelidae spider. Magi 5 is the first spider toxin with binding affinity to site 4 of a mammalian sodium channel and the toxin has an insecticidal effect on larvae, causing paralysis when injected into the larvae.; GO: 0019871 sodium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1HP3_A 1G9P_A 2GX1_A.
Probab=44.41  E-value=9.3  Score=23.58  Aligned_cols=10  Identities=50%  Similarity=1.441  Sum_probs=7.1

Q ss_pred             CccCCCcccc
Q 038672           37 ECCGLTEECT   46 (148)
Q Consensus        37 eCCGltEECT   46 (148)
                      |||||+--||
T Consensus        14 ~CCg~tp~C~   23 (30)
T PF08093_consen   14 DCCGWTPVCK   23 (30)
T ss_dssp             CCCTT--EEE
T ss_pred             ccccCccccc
Confidence            7999998887


No 4  
>PF07637 PSD5:  Protein of unknown function (DUF1595);  InterPro: IPR013043  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013042 from INTERPRO.
Probab=34.92  E-value=1.4e+02  Score=19.95  Aligned_cols=40  Identities=25%  Similarity=0.451  Sum_probs=31.9

Q ss_pred             CCCHHHHHHHHHHHHhhhccCCCCCCCCchhHHHHHHHHHHHhcCCCC
Q 038672           86 MISTDEALNRHMKFCEQFRSSSPPARPAADDLISAMKHILRRSLDSPR  133 (148)
Q Consensus        86 ~i~~eEAl~~Hm~fC~~fn~~~~~~nP~a~~la~aMR~iLRRsldSpr  133 (148)
                      +++-+| ++..+.+-..-...+       .+..+||+..|.--|-||.
T Consensus        18 p~~~~e-~~~~~~~~~~~~~~g-------~~~~~a~~~~l~aiL~SP~   57 (64)
T PF07637_consen   18 PLTDEE-VDRYLALYDSARAQG-------EDFEEALKEALQAILCSPS   57 (64)
T ss_pred             CCCHHH-HHHHHHHHHHHHHcC-------CCHHHHHHHHHHHHHcCcc
Confidence            467677 999999987655422       5788999999999999986


No 5  
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=33.99  E-value=30  Score=19.56  Aligned_cols=12  Identities=33%  Similarity=0.830  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHh
Q 038672           90 DEALNRHMKFCE  101 (148)
Q Consensus        90 eEAl~~Hm~fC~  101 (148)
                      .++|..|+..|+
T Consensus        14 ~~~l~~H~~~C~   25 (25)
T PF13913_consen   14 PDRLEKHEKICK   25 (25)
T ss_pred             HHHHHHHHHhcC
Confidence            689999999984


No 6  
>PF07874 DUF1660:  Prophage protein (DUF1660);  InterPro: IPR012455 This entry is represented by Bacteriophage bIL285, Orf33. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.95  E-value=18  Score=25.55  Aligned_cols=38  Identities=26%  Similarity=0.510  Sum_probs=22.4

Q ss_pred             CccccchhhHHHHHHHHH------hhcccccCCCCCHHHHHHHHHH
Q 038672           59 GRWICGLCTEAVKDEITC------RSKKRENHMMISTDEALNRHMK   98 (148)
Q Consensus        59 GrWvCGLCsEAVkeE~~~------R~~~~~~~~~i~~eEAl~~Hm~   98 (148)
                      .+|-|-=| +.++....+      |++- +....+-+|.+|+.||.
T Consensus        21 ~~~~C~RC-~~~k~~~~~~~~~~NrsDl-Desenv~~ekwldkhmd   64 (64)
T PF07874_consen   21 MEWKCERC-KIVKATANRFAADFNRSDL-DESENVFPEKWLDKHMD   64 (64)
T ss_pred             hhHHHHHH-HHHHhhHhhhhhhhccccc-cccccccHHHHhhhhcC
Confidence            45777788 777654421      2221 11123567999999983


No 7  
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=32.26  E-value=18  Score=22.41  Aligned_cols=11  Identities=45%  Similarity=1.443  Sum_probs=7.7

Q ss_pred             CCccccchhhH
Q 038672           58 GGRWICGLCTE   68 (148)
Q Consensus        58 ~GrWvCGLCsE   68 (148)
                      +.+|+|-||..
T Consensus        22 ~~~w~C~~C~~   32 (40)
T PF04810_consen   22 GKTWICNFCGT   32 (40)
T ss_dssp             TTEEEETTT--
T ss_pred             CCEEECcCCCC
Confidence            35899999964


No 8  
>TIGR03114 cas_csf1 CRISPR-associated protein, Csf1 family. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf1 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies closest to the repeats.
Probab=31.53  E-value=19  Score=30.48  Aligned_cols=15  Identities=40%  Similarity=1.010  Sum_probs=11.7

Q ss_pred             CCccccchhhHHHHH
Q 038672           58 GGRWICGLCTEAVKD   72 (148)
Q Consensus        58 ~GrWvCGLCsEAVke   72 (148)
                      .|.||||-|.--...
T Consensus        30 ~g~~vCG~C~al~sk   44 (202)
T TIGR03114        30 GGGMVCGHCTALMSK   44 (202)
T ss_pred             CCCeeecccHHHhhH
Confidence            689999999865443


No 9  
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=30.79  E-value=10  Score=31.81  Aligned_cols=19  Identities=37%  Similarity=0.805  Sum_probs=12.5

Q ss_pred             HhhcCCccccchhhHHHHH
Q 038672           54 KERYGGRWICGLCTEAVKD   72 (148)
Q Consensus        54 R~ry~GrWvCGLCsEAVke   72 (148)
                      .+....||.|+||+.--|.
T Consensus        71 ~e~~~~K~~C~lc~KlFkg   89 (214)
T PF04959_consen   71 KEEDEDKWRCPLCGKLFKG   89 (214)
T ss_dssp             -SSSSEEEEE-SSS-EESS
T ss_pred             HHHcCCEECCCCCCcccCC
Confidence            5578899999999855443


No 10 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=30.64  E-value=19  Score=24.56  Aligned_cols=25  Identities=32%  Similarity=0.765  Sum_probs=16.8

Q ss_pred             eeeCccCCCccccHHHHHHHHhhcCCccccchhh
Q 038672           34 ARCECCGLTEECTAAYVSRVKERYGGRWICGLCT   67 (148)
Q Consensus        34 akCeCCGltEECT~~YI~~VR~ry~GrWvCGLCs   67 (148)
                      -.|.-||=.         -+=+.+.-||.||-|+
T Consensus        20 ~~CPrCG~g---------vfmA~H~dR~~CGkCg   44 (51)
T COG1998          20 RFCPRCGPG---------VFMADHKDRWACGKCG   44 (51)
T ss_pred             ccCCCCCCc---------chhhhcCceeEecccc
Confidence            457778821         1234677799999996


No 11 
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Catalase catalyzes the dismutation of hydrogen peroxide (H2O2) to water and oxygen. This group includes the large catalases: Neurospora crassa Catalase-1 and Catalase-3 and, Escherichia coli HP-II.  This GATase1-like domain has an essential role in HP-II catalase activity.  However, it lacks enzymatic activity and the catalytic triad typical of GATase1 domains. Catalase-1 and -3 are homotetrameric, HP-II is homohexameric. It has been proposed that this domain may facilitate the folding and oligomerization process. The interface between this GATase1-like domain of HP-II and the core of the subunit forms part of a channel which provides access to the deeply buried catalase active sites of HPII.  Catalase-1 is associated with non-growing cells; C
Probab=29.75  E-value=29  Score=25.14  Aligned_cols=26  Identities=15%  Similarity=0.112  Sum_probs=20.9

Q ss_pred             ccHHHHHHHHhhc-CCccccchhhHHH
Q 038672           45 CTAAYVSRVKERY-GGRWICGLCTEAV   70 (148)
Q Consensus        45 CT~~YI~~VR~ry-~GrWvCGLCsEAV   70 (148)
                      -.+.+++-+|+.| .|+||++.|+-+.
T Consensus        80 ~~~~l~~~l~~~~~~~~~I~aic~G~~  106 (142)
T cd03132          80 PSGRALHFVTEAFKHGKPIGAVGEGSD  106 (142)
T ss_pred             cChHHHHHHHHHHhcCCeEEEcCchHH
Confidence            4577888888866 5999999998763


No 12 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=28.17  E-value=1e+02  Score=19.68  Aligned_cols=40  Identities=20%  Similarity=0.497  Sum_probs=26.9

Q ss_pred             ceeeCccCCCccccHHHHHHHHhhcCC---ccccchhhHHHHHH
Q 038672           33 FARCECCGLTEECTAAYVSRVKERYGG---RWICGLCTEAVKDE   73 (148)
Q Consensus        33 ~akCeCCGltEECT~~YI~~VR~ry~G---rWvCGLCsEAVkeE   73 (148)
                      +..|.-||- +==-...+.-|.+...+   .-+|-+|+..+++.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~   44 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVTDN   44 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhH
Confidence            456778887 32235677788876553   58999999755443


No 13 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=27.47  E-value=24  Score=23.19  Aligned_cols=23  Identities=35%  Similarity=0.837  Sum_probs=15.5

Q ss_pred             eeCccCCCccccHHHHHHHHhhcCCccccchhh
Q 038672           35 RCECCGLTEECTAAYVSRVKERYGGRWICGLCT   67 (148)
Q Consensus        35 kCeCCGltEECT~~YI~~VR~ry~GrWvCGLCs   67 (148)
                      -|.-||=      .    +-....++|.||-|+
T Consensus        22 fCP~Cg~------~----~m~~~~~r~~C~~Cg   44 (50)
T PRK00432         22 FCPRCGS------G----FMAEHLDRWHCGKCG   44 (50)
T ss_pred             cCcCCCc------c----hheccCCcEECCCcC
Confidence            5777772      1    233455999999985


No 14 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=27.42  E-value=61  Score=28.49  Aligned_cols=92  Identities=22%  Similarity=0.331  Sum_probs=45.9

Q ss_pred             ceeeCccCCCccccHHHHHHHHhh---cCCcc-ccchhhHHHHHHHHHhhcccccCCC---CCHHH---HHHHHHHHHhh
Q 038672           33 FARCECCGLTEECTAAYVSRVKER---YGGRW-ICGLCTEAVKDEITCRSKKRENHMM---ISTDE---ALNRHMKFCEQ  102 (148)
Q Consensus        33 ~akCeCCGltEECT~~YI~~VR~r---y~GrW-vCGLCsEAVkeE~~~R~~~~~~~~~---i~~eE---Al~~Hm~fC~~  102 (148)
                      ...|-+||-     ++.++.||..   =+.|| .|+||.-.=...-. +-..+|....   ++++.   -=......|..
T Consensus       184 ~~~CPvCGs-----~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R~-~C~~Cg~~~~l~y~~~e~~~~~~~~r~e~C~~  257 (305)
T TIGR01562       184 RTLCPACGS-----PPVASMVRQGGKETGLRYLSCSLCATEWHYVRV-KCSHCEESKHLAYLSLEHDAEKAVLKAETCDS  257 (305)
T ss_pred             CCcCCCCCC-----hhhhhhhcccCCCCCceEEEcCCCCCcccccCc-cCCCCCCCCceeeEeecCCCCCcceEEeeccc
Confidence            349999995     4566667652   23344 57887654333211 1111222111   23321   00122234433


Q ss_pred             hc---c-----CCCCCCCCchhHHHHHHHHHHHhcC
Q 038672          103 FR---S-----SSPPARPAADDLISAMKHILRRSLD  130 (148)
Q Consensus       103 fn---~-----~~~~~nP~a~~la~aMR~iLRRsld  130 (148)
                      -+   +     ..+..+|.++++++-+-+|+=.--+
T Consensus       258 C~~YlK~~~~~~d~~~~~~adDlaSL~LD~~a~e~G  293 (305)
T TIGR01562       258 CQGYLKILYQEKDPHADAVADDLASLALDMRMAEDG  293 (305)
T ss_pred             cccchhhhccccCCccCchHHHHhhhHhhHHHHhcC
Confidence            22   1     1234578888898888888775433


No 15 
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion]
Probab=26.70  E-value=11  Score=37.67  Aligned_cols=28  Identities=32%  Similarity=0.920  Sum_probs=23.2

Q ss_pred             eeeCccCCCccccHHHHH-HHHhhcCC-ccccchhhH
Q 038672           34 ARCECCGLTEECTAAYVS-RVKERYGG-RWICGLCTE   68 (148)
Q Consensus        34 akCeCCGltEECT~~YI~-~VR~ry~G-rWvCGLCsE   68 (148)
                      ++|.+|       ..||. -|---++| ||.|-+|.-
T Consensus       200 vRCrrC-------rsYiNPfv~fi~~g~kw~CNiC~~  229 (861)
T COG5028         200 VRCRRC-------RSYINPFVQFIEQGRKWRCNICRS  229 (861)
T ss_pred             hhhhhh-------HhhcCceEEEecCCcEEEEeeccc
Confidence            999999       46887 66667889 999999963


No 16 
>TIGR01383 not_thiJ DJ-1 family protein. This model represents the DJ-1 clade of the so-called ThiJ/PfpI family of proteins. PfpI, represented by a distinct model, is a putative intracellular cysteine protease. DJ-1 is described as an oncogene that acts cooperatively with H-Ras. Many members of the DJ-1 clade are annotated (apparently incorrectly) as ThiJ, a protein of thiamine biosynthesis. However, published reports of ThiJ activity and identification of a ThiJ/ThiD bifunctional protein describe an unrelated locus mapping near ThiM, rather than the DJ-1 homolog of E. coli. The ThiJ designation for this family may be spurious; the cited paper PubMed:8885414 refers to a locus near thiD and thiM in E. coli, unlike the gene represented here. Current public annotation reflects ThiJ/ThiD bifunctional activity, apparently a property of ThiD and not of this locus.
Probab=25.46  E-value=44  Score=24.87  Aligned_cols=27  Identities=11%  Similarity=0.354  Sum_probs=21.6

Q ss_pred             ccHHHHHHHHhhc-CCccccchhhHHHH
Q 038672           45 CTAAYVSRVKERY-GGRWICGLCTEAVK   71 (148)
Q Consensus        45 CT~~YI~~VR~ry-~GrWvCGLCsEAVk   71 (148)
                      -.+..++-+|+-| .|+||+++|.-+.-
T Consensus        81 ~~~~l~~~l~~~~~~~~~i~~ic~G~~~  108 (179)
T TIGR01383        81 NSKLLLNILKKQESKGKLVAAICAAPAV  108 (179)
T ss_pred             hCHHHHHHHHHHHHCCCEEEEEChhHHH
Confidence            3567888888776 79999999988753


No 17 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=24.36  E-value=29  Score=18.99  Aligned_cols=11  Identities=45%  Similarity=1.072  Sum_probs=8.4

Q ss_pred             CccccchhhHH
Q 038672           59 GRWICGLCTEA   69 (148)
Q Consensus        59 GrWvCGLCsEA   69 (148)
                      |.|+|.-|.-.
T Consensus         1 g~W~C~~C~~~   11 (26)
T smart00547        1 GDWECPACTFL   11 (26)
T ss_pred             CcccCCCCCCc
Confidence            68999988643


No 18 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=24.01  E-value=25  Score=29.81  Aligned_cols=31  Identities=26%  Similarity=0.545  Sum_probs=25.1

Q ss_pred             ceeeCccCCCccccHHHHHHHHhhcC-CccccchhhHHH
Q 038672           33 FARCECCGLTEECTAAYVSRVKERYG-GRWICGLCTEAV   70 (148)
Q Consensus        33 ~akCeCCGltEECT~~YI~~VR~ry~-GrWvCGLCsEAV   70 (148)
                      +++|+-||       +|+-.-|+++. |+-||.-|.+..
T Consensus       172 ~v~C~kCG-------E~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         172 SVRCSKCG-------ELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeeccccC-------cccccchhhhcCCceecccccccc
Confidence            48999999       56666677776 999999998754


No 19 
>PRK12722 transcriptional activator FlhC; Provisional
Probab=23.94  E-value=22  Score=29.41  Aligned_cols=33  Identities=30%  Similarity=0.985  Sum_probs=24.9

Q ss_pred             chhhceeeCccCCCccccHHHHHHHHhhcCCccccchhhH
Q 038672           29 SEVEFARCECCGLTEECTAAYVSRVKERYGGRWICGLCTE   68 (148)
Q Consensus        29 ~EVE~akCeCCGltEECT~~YI~~VR~ry~GrWvCGLCsE   68 (148)
                      .++.-+.|-|||=      .||...-+. ....+||||.-
T Consensus       130 ~~L~l~~C~~Cgg------~fv~~~~e~-~~~f~CplC~~  162 (187)
T PRK12722        130 GMLQLSSCNCCGG------HFVTHAHDP-VGSFVCGLCQP  162 (187)
T ss_pred             CcEeeccCCCCCC------Ceecccccc-CCCCcCCCCCC
Confidence            3566788999985      477666444 66899999987


No 20 
>PRK09855 PTS system N-acetylgalactosamine-specific transporter subunit IID; Provisional
Probab=23.54  E-value=87  Score=26.97  Aligned_cols=14  Identities=14%  Similarity=0.475  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHhhhcc
Q 038672           89 TDEALNRHMKFCEQFRS  105 (148)
Q Consensus        89 ~eEAl~~Hm~fC~~fn~  105 (148)
                      ..||+++|+.|   ||.
T Consensus        53 ~~~Al~rHl~f---fNT   66 (263)
T PRK09855         53 LSAAMKDNLEF---INT   66 (263)
T ss_pred             HHHHHHHHHHH---HCC
Confidence            35899999999   885


No 21 
>PLN02489 homocysteine S-methyltransferase
Probab=23.15  E-value=59  Score=28.30  Aligned_cols=19  Identities=21%  Similarity=0.557  Sum_probs=15.6

Q ss_pred             ccCCCccccHHHHHHHHhhcCCc
Q 038672           38 CCGLTEECTAAYVSRVKERYGGR   60 (148)
Q Consensus        38 CCGltEECT~~YI~~VR~ry~Gr   60 (148)
                      |||-    ||+||+.+++...++
T Consensus       316 CCgt----~P~hI~al~~~l~~~  334 (335)
T PLN02489        316 CCRT----TPNTIRAISKALSER  334 (335)
T ss_pred             CCCC----CHHHHHHHHHHHhcC
Confidence            8987    599999999877655


No 22 
>PRK11574 oxidative-stress-resistance chaperone; Provisional
Probab=22.76  E-value=53  Score=25.17  Aligned_cols=24  Identities=21%  Similarity=0.476  Sum_probs=20.1

Q ss_pred             HHHHHHHHhhc-CCccccchhhHHH
Q 038672           47 AAYVSRVKERY-GGRWICGLCTEAV   70 (148)
Q Consensus        47 ~~YI~~VR~ry-~GrWvCGLCsEAV   70 (148)
                      +.++..+|..+ .|+||+++|.-+.
T Consensus        86 ~~l~~~L~~~~~~g~~v~aic~G~~  110 (196)
T PRK11574         86 PLLVETVRQFHRSGRIVAAICAAPA  110 (196)
T ss_pred             HHHHHHHHHHHHCCCEEEEECHhHH
Confidence            56888888776 6999999999984


No 23 
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus.   PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source.  Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=21.23  E-value=63  Score=24.02  Aligned_cols=26  Identities=15%  Similarity=0.437  Sum_probs=21.2

Q ss_pred             ccHHHHHHHHhhc-CCccccchhhHHH
Q 038672           45 CTAAYVSRVKERY-GGRWICGLCTEAV   70 (148)
Q Consensus        45 CT~~YI~~VR~ry-~GrWvCGLCsEAV   70 (148)
                      -.+.++.-+|+.| .|+||+++|.-+.
T Consensus        79 ~~~~~~~~l~~~~~~~k~i~aic~g~~  105 (183)
T cd03139          79 NDPALLDFIRRQAARAKYVTSVCTGAL  105 (183)
T ss_pred             cCHHHHHHHHHhcccCCEEEEEchHHH
Confidence            4577888888765 7899999999874


No 24 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=20.98  E-value=20  Score=31.10  Aligned_cols=32  Identities=25%  Similarity=0.624  Sum_probs=23.3

Q ss_pred             eeCccCCCccccHHHHHHHHhhcCCccccchhhHHHHHHH
Q 038672           35 RCECCGLTEECTAAYVSRVKERYGGRWICGLCTEAVKDEI   74 (148)
Q Consensus        35 kCeCCGltEECT~~YI~~VR~ry~GrWvCGLCsEAVkeE~   74 (148)
                      .|.-||-+        ..|++-=.|.|||+-|+.-+.|.+
T Consensus         3 ~CpeCg~~--------~~~~d~~~ge~VC~~CG~Vi~~~~   34 (285)
T COG1405           3 SCPECGST--------NIITDYERGEIVCADCGLVLEDSL   34 (285)
T ss_pred             CCCCCCCc--------cceeeccCCeEEeccCCEEecccc
Confidence            57778876        233333379999999999888854


No 25 
>PRK12860 transcriptional activator FlhC; Provisional
Probab=20.85  E-value=36  Score=28.30  Aligned_cols=32  Identities=31%  Similarity=0.831  Sum_probs=22.7

Q ss_pred             chhhceeeCccCCCccccHHHHHHHHhhcCCccccchhh
Q 038672           29 SEVEFARCECCGLTEECTAAYVSRVKERYGGRWICGLCT   67 (148)
Q Consensus        29 ~EVE~akCeCCGltEECT~~YI~~VR~ry~GrWvCGLCs   67 (148)
                      .++.-+.|-|||=      .||...- .=....+||||.
T Consensus       130 ~~L~l~~C~~Cgg------~fv~~~~-e~~~~f~CplC~  161 (189)
T PRK12860        130 GMLQLARCCRCGG------KFVTHAH-DLRHNFVCGLCQ  161 (189)
T ss_pred             CCeeeccCCCCCC------Ceecccc-ccCCCCcCCCCC
Confidence            3567789999985      4664433 234589999998


No 26 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=20.80  E-value=38  Score=19.35  Aligned_cols=10  Identities=50%  Similarity=1.311  Sum_probs=8.0

Q ss_pred             CCccccchhh
Q 038672           58 GGRWICGLCT   67 (148)
Q Consensus        58 ~GrWvCGLCs   67 (148)
                      .|.|.|.-|.
T Consensus         2 ~g~W~C~~C~   11 (30)
T PF00641_consen    2 EGDWKCPSCT   11 (30)
T ss_dssp             SSSEEETTTT
T ss_pred             CcCccCCCCc
Confidence            3789998886


No 27 
>PRK07534 methionine synthase I; Validated
Probab=20.13  E-value=73  Score=27.86  Aligned_cols=19  Identities=21%  Similarity=0.651  Sum_probs=15.3

Q ss_pred             ccCCCccccHHHHHHHHhhcCCc
Q 038672           38 CCGLTEECTAAYVSRVKERYGGR   60 (148)
Q Consensus        38 CCGltEECT~~YI~~VR~ry~Gr   60 (148)
                      |||-    ||+||+.+++...++
T Consensus       278 CCGT----tP~hI~~la~~l~~~  296 (336)
T PRK07534        278 CCGT----MPEHLAAMRAALDAR  296 (336)
T ss_pred             ecCC----CHHHHHHHHHHHccC
Confidence            8997    599999999876653


Done!